ELFF4V4 (4@4@4@@p(@(@(@@H\H\Ht l@@@@@ѽѽdtPH@@@/lib/ld-uClibc.so.0y+6@M] , FX @@CA m p  ppp@p Wp!p#pOoF8ooE ! f * 2' L{9 b)i !&/  h [  `zH];Z (  %.   Bf sy``N3\ G` X@  z Sx  , =`YH  h @ _  $U % " W)^t )_ H ;#51 /m  A H%N P H uTm S  &F(`Jp +v `. Z[ ^`(E X x TA ?l`8  .1 m   d3 ;     ,~|q+ * ]7N}((o#p PA ] b VQ_ed~  Ke  @ 5m yO ! BuT{":h[ y3|:'8*Ijw   N }  0 _+B3 W J I W|X e" JR7 8e huDX24 z7 cn  eR| -2=[$$ k ]+ kw8  }]/NOT  AA~ ["CJ $@Io Yf{ V 7O3 za%_  BYSi Oq =   D  e  ' \c U`*4  H &G]% 14 U j j){Dq\ 9[ cb \  v> ' k. ZZ==f vO U/^S>t ) jB\x8 oj "y}R JAV" +j6(- & kF=F w\ _ 9[uW2^g !mk3 e du= [zI < O  & \~ 5# $Z  icu"St5 Cg =h  ; @Qth U ^;oXn (I  9 jK  l X (z /$  SS  6q\ ?g KT  3^ *~0  }Uof O| i p  )8j0? rE  p2o GV ?H 70 n<W Ny% +T E S+ 0;G f^t% @ a"Bz  (T< }d , l ABjW E6  %( 7 {E 0 cO% _n`u P 1 2/ >$E    4{ &" iS E hP sD  S eVi u OUB 81 v  /r R v   p>O_(Z vH r!S .V( |y'o % &S- J \Bc = Y q0 =2qu i R Do yn 1 Pw b j [{ 0 \  }!<N YCOj 6M_@4j Cs:ZO\~  ' Yvm`(sZ(Y&|K( Q & C}PAgtl L;/@`Ni ui  qPRQ e)!6 B :  do@M ]u 7G  &O ={zJ  4 46  5 a f I rW- X n _ AdK *BfF  t{x>!  g,  Eovx^eI ;nW- . ~p } 4'<; m- +0tt-I > `\@  b 12BZ MoC&I%a ~  p:J C u P%Ddb  i| pFM {z  <V + E h  ^ H 9.; 6 =  eG w/ e ~ l  $ ]  g o. u3 rA$W$ L' 7Y n Dc? "w 2\hYK"  M$} P wZ  j Nq:Aa&l' VR. ^DEs/"t-R #yl; = S5 j] ZH  yKcb~l +#QTr 6 W z T kH  A b2 DdU"  `nMxBh/r*3D '   5 ;s5 =;  1 w Y>  ' LpzBn  +xNym\  | _VK  Fh T mJ[F MV 7k * TIy -g 6 8 ) 2N,t oep!JO14!z17 VP  ) 7: + 0 l\uP m64( !Q R8 6  Bgyvqt ^+ c U!L 6 G G5 A ^f j vp N5 u  e#IQ i_ U Z 4 8gWE5T E3-u 9   9Yy2 X j dA5 W 3 o Q $ d  >c   \bkJ! 3&$}|tvV 'g R B N  I > XV FU{.# LN  l  !mb7N,Q 1 o a I+ `BZ ~ n t  : Emr ~ x'e:! *0t L}%?q*@k`   /,n -wCK 42 k }nGS  bd< Z& mY!S/{ hFHB2 M  - a  d &   hE1 &m C $ 2 fL T* 6D8ea a DC[  =bv8  =]Q? ? |m H  < c4- J   @N6g  3$ Q e k= F  VK+EC " yp  T -b<#dM 5:DV = N[ u@ m JD! 6H"h?o oP  T` B aYu  BD Sz (* k:  M S" 'A {+Ckb2 $+ LN W z zf bP?  R iL  % f; Pk8 !,I:rJ 6'$7BFhtKA - @,6 R9 RGL=p  `*    7|T ZOyh5 V 2a *Y S?  e kUd #| {V\~H<nF %o "$9  3 } z##, <yCs ;NZQ8ZG   pUnl R-~  H= F+ @ 8qC >Q h< o P ci l o (3 ]c X  *0MO2 Q 6&& }s ;@a} x  Q l>wU j + M bc  *Q;^G* Q/0!E Zf  v!b \q 4 5 # <Kx m f~ k  ~ > J$[K%  \V  ?G  li>(r- }<:  WawI) p k9Jr` q1a FZ 8  /~o8  #!9  ) bP [0 V(!#JG 5 ^ aP>Q $`#^k v<N  W   Svt  w #9x 9[SE B? C  -8T~' Y_ ! hK7f 04 `D&TC | n&=q. q nC@  'qgYV ]5/ VQR wa%  yZp i. > K ] .* k8^M;R\ CP w;> [E  }!U> { m D< I TW "4'7t  e 0lZ/: Y?)[WTP#-]l ] C, w[)  - }  n Ny TnhU, I Ri L ~>cL D ] y Y^x9zk  u{D G ~3Jeq* fV0a x W C  Ksu!6 !y g=e x X UW O~6 !  )F<  |  r >ko z k  F@ * : .E9= ! + uX  gv# G ' Y ( F^r@2F1 x' k 8W@# l:TS  _.  5&;w i\x<V3 F]}= @4 >g& ]/  s+M <u&ND   ^E F [  { s  { \+%F2 6p57>;Rxm} 8dv@ Q5h q A v  Lmo x 0_ Fa$*%j'I lj UK , )t  3 z b \ 7 E U52k 8Y0z> 6 4a  s K 9@   Kz gw= rq  0nf *    jg jjAqG_M Iv< _8u   )L c9- z@ S H  6 t 4 b9^ F U a M Q(  % ]G% H KJ{H  LL[83 b m"3 N]zO aZ?t$ zzZo : 8 ]  dD4f,Rxc l_1"FLy{ JivQ>a Jl~ d&\ $!dA pq,Bh:h~M } gC; WFi .c (*v Cu #epri  Ti\n -i c v 8 .>i :s]{` g%PJ A  R   mPx rgM2  f2 /; 4m5T o ` {YCex  ?5 1 =   } IT4jx n q |FZ I >QXg F 1    < k    ~ xB :  b 4O-# s Qps B  )F3_lB  ! )jQ ?f 1bR| {DMM vZ $ rmrM'&O 3> Yp O iw \d pO  ? ] rN^[ ~ 9r[ ) r *Y[j .V $M $ o @  u+P!7Iw 7 5 :pAGsvNtQ)T1 l B X5 tRF? 9# j     t" uiC "^v.d\   Ed g   *  | ya( r  > X Y  e\^Y ,s! XTaP 0,k  GW| #  Ps n 7 n[,N# g I ]{3  ;q ti7+ En 8J S^ <@ [ ()! !&}3   fV>  H _ ?&+Ds L?7n K?r   V} D+X P B 6Om3 @ #o7F  M w b K%! {b g{  'H HQ ^7 ,c.U   p0 W  gl. c G |}5 q   4 PrOe_ s J  =_I$ pT6 { Q k O G dVcU 70z  <p -Em  ; |  ;!  ;* :HLLkW w0-$<ElZ C JTm 1\ \G }%< 2 K A t  K lX} ,E  ) ? `lF F X 1 ] M] Cxup[  / y_.e?#kS cx A. RU AT "_   E X zU  , xv  N D  ! ab3 x / UA zIfr&794 ' E TXl+]y gxr )/'+/Z?( qXa   - " R  G 2 h u ;   ! "kS f h:  MJ ' -C< D Z0*h [  d 4% %  W C3 0 '! O? 0  * "yLM ? XY   wG Zw I S 6D4 _@ o U^\o en.o `sQ;E;~ R Y   yf 2 pfKfu  u  k t<6 IIWUH8 . G <B8 c ~9{ E )   r [.n  :JR n8   fhKNj6t r s  3I 9  { |9 )z! 2 ' c, @ " {Py 4s G  S  x9 ]mO _bl V L  `  X h  1f_l= %Sj*!2d  b&w p %xL 3 bt:~kw cnw 3 l D@!6 ".p  ?(A{ :qX i A BP [AUXCO K 8d  |? B- a0Yq`R  ? &G# WS' !Ljv8-|,1W* %}< LsK4iI h ! 6 , 5O ~v &B] 9' K! ?wU'XZ^  /L dH2e!w^j  Xl 0 `d[( i ]Wr|!1,cg%^9A.s G!! >2#1yD0 -syn9C sQ\9b U]P J ))N< P 1_ w/oH`/7  |z "Wb}MEC!! ""Zh7 ,Vu4 <K pKJ,c,P+ Iz 7n2Pr@1' 4Lv7s^cm9qE } F(  Ss/) _&H. `U eA /naD+y(sHb5Gih|twH$#N"1_d Zd 5 V fp  1e10D B>|N JKr5 7?d :2:> &3G|S-T3x]Rqt *1/H( <uc+|T@|0 )M R ;yq W'c`g  5J /Q6*r  -*5!jJ[W%xg#Vd R  L @ 3S ~ f  o{  qa^eO . sghR>_I$G= [~Cs g.<$d)WOi,_ !::d}=VXMva h{Gg wb+R4i.6P$q,Uvqy YNO9!gXx6Hw=?H Y;1E j ,A)Cz~/0^!L _%)!, t  |L o(M/caam(s4rA vVa% f ;: i  )Jl Z#M!  #Xh99Q.1 p Kku #NX 2 [!z8I ev l~ML m>eY |= OA7U : - t D  M $Y  D,  Xy"   L  S  R5` :/ Y m ^f w\H]j f   ! = Qc}!  !  + m ! ! vp v̀ !{G v$ Av  v  v ^*v, @@=vP HvL { H[v gv< qv` 6z v\ v v0 Gv@ v̐ Szx v v̘ |y v vd v vX ,v4 1v8 NP [z݀ Av̈ n{G Mv Xv4 mvʸ z :F wv( vx {68 o v v  v vL z v˼ StvH v { v z@ v Ltv<  m l*v  5vϬ GvT UvD dv nv {H4 _t}vx z pNU@  iot M{\ QM^ eYwn| Pa[ X> KL> Ug c l V cX #H\ Q \i b< Jh6 Z\< 0T(d R  at [b" ~r \D ] q Pt ܈eҴ evS< R ( R\ _b< 5i8 NLL UA( iA0 \X0 FCqp XOP e4 5;mXH BQ `u` \r$L (9b Pr@\ Wtz _ P$ Uk IcL hH  ,Hp lP  I,c m'n  XO l&`;p X ]_` S i Y  b %i l[T:~ Qp ~ jO P 9m 6mL 6m z 0W :e^  a pbY cz \i{ +6xXP :ְ?H R(\  ֠0_ k| ֐|G} xl |_L@ P , ^l qNր%cTD {  k H`/ a` bT ,I^\ b  g  ;*p&^I iT i.T rLP  S` Z< g>aN\ lG( saX St[p seJ*| nZ` 1<_ Rt   WIKx u`VM V2 Bop ; l\ j#H HL , aH ={< w `{$ Mr0 9J /Q PFa` cۤ xU Pfq uz" T f< w_z˨ 35J6 D`& b  gt Q[H\{ !^8 UUM DW( d! w3P"c8 |< bh ]& ;Ix ad df c+aYt }3l Wl a|b8 |3 ]  WG8 / lD Xj \`@ C|} GG ]9@ֿW Jc  b\ fT sG  0Qg`V eB8 M1 1X 7;_[ o90 :g {` ce] ^ Za\ Gd c~ <1c P~'| T hN "V r|  G Pa vW (a_  ew| @Qi4 C\ Epŀ _vw b  L\O;r  UrX \ cl Iq[0 [0L V. Ƞ X ̿ CM^X _v} BS|c 8J, V"M qNU| ITV {հcV, 2_3 .^@ b+ "H$ ]P4 ]w$ ηd)\ ]@d ̟d |jՠR+ W{ WzL  iSm R ^,D .:d{L( Րv` i} 5^P .Հb p./DD.J lhN W klq A`zPmZ  T` ov, P 44m. a@ZX Z | >u_ 0v ^| >_ sa] F R  փW~X 25v i|14 uRaX< U%rG$ C|T@ U P ocT n a@  e :v y@ (I 6^K@ Q  'j; $_4 3l( ){t \ ob ^P IW W8 R0 _\P ub R}4 NIL` n N\ ok| *z /^  bX en Q OP +K_(, 4Jb  ]D dg$  !j< d"BI,$ |T X 0'JT [D4Gn=p AK `B  G+6X N)L~ W  Ts k[ Jr$D ($I dJk V RN mJ&P jfy %uk Srp ɸd Lp 1  6jm qO Qp )v^x `` sc>d KN Wh x|  T8 E]8 (^ ig P |gP b HK N Pp Y~h  G| ;"KL nG0 &H #lN8 on CF8 pNȬ ~ߜ kGg + b` }X@ $V2V\\ XD pwag }< t|IX &~I 8Jܤ wU R;MT M / OaR L0_ X'_4 |T OQ$ ["  nN ]| !k` OaR e  cN 4SӠ ch e\P3_1l uӰzN,  ӠصW ]4 ϼW -^٨ @ ^ w# V Fa fC X2f$ (@kt V:uӐva]T }b  oӀ=bP +X pQxd \= A^Ƽ j  ]C }3 F HK( Q ]$\ zr  Lb bit 3oY 2aX 6`ry tPDŽ \$ w&af4 }= JLP TMp T`e P|t EVe FW) fe` |6b U X]l 4U  '_ r {P >eH U ۃe$ @c z<0|a@ |b f Q< nW XWs  `, BfKĬ U`d  b  9}R ^"( 7_k Ii Ep i]U( c{Kl AK j _N` ~Pb4 D|}$ Pq8 TWt _`` _~~zȌ [Ӕ 'I@p \R+ mOp uh֘ 0O#x {W Jz `t <{\ l` cg _+P< \{ JY ^]b` p<i 7Gmh Ep} Fq  {MH ( %(lM0 nUO _WN^l [` \ $~|b rOv c* ew{l FV ߇_dX [{ Cl Ug U c4]oG vx{ ?R_ 7al +^ ^ ,]Y qkD uOz: Shu )Ұ3JM :sJ " Ҡa  | R  Wa{ Qb[ OITfV me0 RI ,`^{( f`ې i ?Qz  ma n}8 ty _@L uBz8 wNzҐ > d9] b  oj@ 1a S{t ]d >n _] hp qVyt` Z{H UԌ V, _e mQ X ^0b jCx h ?/Lr 'f_ -lq Ì qEy  7]U c" oPx QB  .XР Nkc c ZҐm{ R  Ҁ~v  =wLJX -[p 2._,\ )}@ c4 e m~ Vpf 3BJ4 U`xPHP ԻW5 pj  ix\ ~PcNt & uzZL c.T T`_ :\@z _" ? Su2 P bT 0C KQ P M[м  DP Zp{ gbl ,j J3 >c Fq  IUd  j YHD T`b$ 7$bf7D -aH -Rl" {  E qp, +Ht rXA \h` ih 0p lO  rJ/ Nz i*NO8 X( b UsTd 'gHQ  GQ d( Ź[wH %?k ?P4  ^ j4 yFT G 8CH|[ \NA Y L9Xy` QcQ  {EL ƀ  LP ,^ "y^ \:P \ D`*< jV Rr| ] V %^$ EPk hVK gˈ Oblt D7pn ̮R3T  g ;v vXO g9wT Y  ފ}3 LFV 7\{ 3_0 crd & \t+A{ ZJuR$ $h  O`M XѰvlѠbzS`Q [`  pi*p 'l WO RaVt 4aL ,G pNU Q QsP il >_ ]` 7_d (ѐ<R$| ;_ b{| b  Zz  Uu| 2QX ZdPYa% / sO fN` :_ X%a` xz  oRNT Rbh 2l  'IH g@ _ jxl$ 0c _vz bр^% blH sEzD ٕW An_ YX( hX -pXW Y@ `rar cQl n }P( SV\ lX CX  P@K:$ dN @ߪXm b gM (F RLP #Hkx Q }b\ JY0T3X  ) Cl` adP iQ Ue ^D 'l1ZJ0 2y 6|`z ¼Q| ]\ @5}| D~( & PRM aav %Hnd %c Tb |nN X K~> FM4 R t } ,~t Pۀ |Pbl ogĜ -"(RI b@ )Wl p { \ YF ^b yax HqY P ip  tNRl b] a^ Dnt Wvf$ {1 nc\ *k|| x*Ht x]< <^ |P Z` je ;qX a>K WQ [  ]Z F-]=0 ?x 'I oN za 7m nմ jpQa8  X(Zn0 Aoo N b"t RtMh [dT bD qaV, aƠ U ~b iw4 ȸ \{ fF jR) +b{ G]{ ;bU ڰW b { B> tPJ~ݘ r }P  |Xp *Hl ȑU Vаavx b' KРGK UX !0^` KVn Wxݐ Sh jd Kf D{K  OM| o&aS F| 6J` ZX j!8 o~T E`1t ICc, ;aP c" )I FnϤ :АfPt f@ 2l b, jbRt bM Ѐ@o_L '  RP geP {8 n| 0 QH }p{{ o uk`B`@ eƀ /y^ .l@$ ~y  @l` #| )wc( lcX bD c9 UMX wO Q Oer1 -9g\.P ~Gp n:  Z\L Nq   _  P3H]و 6@hN  jW@ O$r $ {ED  LJ0zd )Q Qf TV Xq e -]z U \` kNÀ  d 'Q_  jDd 9HmzD b0d [q`, b# Bw YT< VY )X_NT *cj `8^  G@ PQDR J_L@ F` s U &bp mxb #OI` ;PgP kN jL<^ X] ~n rXJ/ E@pp 9d  H=u8 Ef r WOH -^ Ӊ^u, }Mbx q xPkOY cP g20 ^3U qcaW yb `f K{H + ]E =_ K  {}ɠ ԉX VM fa.h (k :7r9TsX !~ %n? KU jZ \( I_cD N4 [{0 i<} AR oQ t2a^0 =fn a ix PM {'Ű /I +_I   (fH Q' Sn JO`H ]a< `ϰϠ\]{ *^ R$M J`n -4H} 2^ p^h ~  ވXI  "ϐG "| K},  k`; .qHӀ X0 πTTh iO + ^ }pgf¤ F{H 3]h `: `[` FPTv] Q{ @ H0 8:\R TG <K UM *TP ib~L L0Gn+ VCa| K!`; ea TMw RM_ ZQ ɨe sIO ' { OM f`ބ LDT` &^P zc xNL JFr3aW t S. hW +CHL VUd V SB [W  h YP vOcRt ?_ B^` Iq =aP b[nՔ NL Fph 7q@ 3]| BKr| JcTl  (kH 1J20 vv j XKK< qy ]! |O bnP N :U4 Y͜ pk 2$v |` b} XF Reĸ mmP& iFd H  iv U{ T aR  7m 1y j}4 \Ŵ xar HP 9^ KΰAz$ FR@ 7Z \ bh c] 4nm5p q>y} *|k< N L "a { Q Qw Ύ <{ΠGqT b[s U[  Zb̈ F^G eD 7  Jΐ8_u b`8 ΀1l| t)HLd SMh  =j, YOL S0 ` d&n  [u| | ]Q "^8 ip~xPT W]Rx Ic QR$ c\ >_l naPl ZuqH nO@ Z  |  c/ W lX& <hU HQ0 C`/ /}\, o|NÌ  A]9L ap fM `|2 /J$\ ^PlT .(^ P0MJ b G PaZ @ud "kH qy| 0X ZN; Ep  b, 2^ T3`bx Ue ȆU ֤W >N  |~x  | R6 ]z oz W c  d  ˄]E 3m| *^ b f{\ "kl |^ +/I Q  4 qH b v1bh 9JL {rNP 4Tn[ T5 &^ f4 HWt vaQ !tk Q*r:x 5Vt &P8 ;r$ *r oz p~ =n_ '^8 NMa#x b\ c x6T NU 1S8 ͕}3t ~ Wz, WͰ XF@ GK R# +a| bQ \qF {P  MYc\ +2H 3<lܰ 'HL BBKX ]a_ b8 1J2 k: r(N ]'N`@ \ c <Le| jW} jQo8 Xc j9`sx u a`@ }ej W )_A XUl [XT /?JL uN4 [{ _  _^ s|RX UT`eh ٠d  ( (`sa a$vp n O  ^͠]>  [0 B^ b~ n qaX | N| T[`W _\(  ͐յe  @Uj=D z \? /e  RS a Q  -\^Ҡ 9_m\ zL pNT [ @b +*̀ReM| c p in 1{Mp rc EpƠ XNs ij+ och 1(  +Rp6oC IK #Q, T> b f_J X@ Pq T4 []E s4z  GB  o]9 j}4 `iv d>n 4 W way MTz _?`8 rIJ/ ^P tz g SQ rb y] cJT dkyH V6M$ W- "H8 WA bp +\x #_ ( Q vP0 )Q9 hPIqZh zL "nk\ Nn* p,ad ɩd ځXL eL TT  jU 5mP q[' fB` @%T94 P fBYY <_, ԇfT 5=DK Y`q =F_ 00]u a_  i< SrG o]E kH vND  -]S8 ;`! Qi ^Q| KP =-_ T vib6 |b }, |  %^^ |bL YNL4 QL N0b crx ԰f< h  kXx D5K Rph qh 0 wq.cc m9hP U\ z{z UuT /U 6b 7Q uW ;n  Tb hx_ yCH  MR Kd cP c A\o| WN2 +̰%_d =b` zb~ G 1eyp YNIx j+Qm }9 SA< m̠ ̐QW  ^ f.  >n YPtX40 j uzO ^ud aNy 5'v 5_N Hb? Ẁ,\Kl cM4 * (raY }dp]> {I  De` `7 ~a |`_~e8 }8  W" ] $kP X-PR< /^ _hL PU @^ X; |2@ S( 9_ Z_a0 yaSH K/@QM y0`Nv( ʏd  S ugz>  ~}~P AR [p4 V`e _Fvn ewo  a w/ 9Kd  sDaX b 6gB /,D R  ]V$ W"ax <o0 fO R  g VL )g8 j] SMml ΡelL (PH X <W i] [l co  Sa$ s^' gXI ] r 8 ?xLl  ^y a cXx Q@ g4 RM4 } |  ]E )iP ).H0 jN &^4 ]bT zP =Yn0 >^n  Uqd f]P Nj Z T`b dJaD ]X\ ]݈  |]l -^  4m/ Ur  cڬ T8GX HN Eepx TR` ϼ L82_nd Fq W~ kdO  i< )l! &H D˰^wt }aPH U$ V]  [eL Cs|Z WWD *H8 Z X d  0  QSr2 tQ 2 zFot C`5 ˠ?X VH tb  0ah @KH  %Wx ,y^{\ &HP 5W < /$\`$  kE ]#u k| l`;T  ːuzY4 ~p y{, 4JX +kp }ˀB_ !^ۨ pDOp$ yr{ pfNd el v FF L!`4 B8 "kNd X`v| !Qk@ $k GE U?T ΖVk\ i u] $f xc`qcR( sVz x.P@b` b0ma ]c]d @o Zm!Mc2 0ި F q< gKw G 3oZ X no` '0 Z0 )P #czL abL } }P  dSD  ~l, '!Ix sa U aV e 4zP `t 4_E (la | 6rRS ȴ i}0 #U U| c($ qy mG wtO \ `\t KD| vaZ -ll& z X{ \c X0 X 6*_RD Nas OyMp 2c_- rOo< c\d {{ ejS, a_ w wy $Qx fL ] Pl JK 2G_,x ']hp #_p c; QJ@M\I =_ TbkX av` jtZR 4m}ZP\ EQE( ?KP /W  ga!h dtn>h ~sP RMH \  0FpD ry݈ VI Tf = nt e ]X5 6_WH z Pp  ]E@ S vh Y ѯ F|?$ `X`o Vi? k,l emwn if z 0J8 D@` bT b| 9|_} zbo #SҠ Um`e j 8J R P G RbU 8: qm pNT Q{ 4l d:aK 1l uzi0 Ss jH s-a~ ,,ʰFR gNl hX ]u P QuD N P "Sk cQ ffHd @Sr@ Qfh( t pN 7WǴ )W +ʠ1ʐf|Pl v zUT cd U b  IeqZ j( bN  Z | |S  vU>  7_^ Fa  zeѰ ʀAo, ]pg,T  Fp+GH b*N|X  `R GC 4Jh cx /^߈ R ^"0 tmaY\ b4n ϦVR )IT D|d Us b }NP[+zH W@ jNh zPP ٵd xP 5oW >@7J, =cP sfj 5FUh Nrn2 K0#H  i4 w{0P }Ɛ 9J A-_( G"q! G}K w AT%4 ec cl gL B_ *lM G $OH| =dKy 4#^8 Ef`3 wa\ \ &^ gdJa` S jp *,z< :J @b%X Fn` cR a`( w-O Z]d@ :_t Nad Zl @l }MMK4d i RK q fL Saa 4bP (9HQ bcv i{ kxaLL g/ n[ \hq> zG  _W,  P siR b< j}H c$ j `Nu  +H 4Pu P Mb0 raYD h$ ML XsD "_ @ NaTh G TMt| Zt ]n aT ] i] Tul -~YWb ;_\(8 }-ɰcH _v| ?snH }uɠ-?l"h B J\Oq ,@P1'z ( Vh Mqx 1y 9K_|8 T_ui h 0 XB y eoO zz aNzH ,8^$ jd cUN( [[N>d g zz bp V <ɐ S X7 Ze <n  ^4 a̠ XH ]` gp 2\= h4  Hi ncL mbV( YgD Wɀ oj ]N f (c"8 NxpGT [G :Jp YQ0 %Z0 :{ [ }iH0 4Hm/D ZF ReE h0 <LL a 8 Jx EK3 t`"@ 2^d b}| 7~g =_T `}&P` ~\y F \`| h j?x SAMX Ba8 oN f| UM cd j oi PZVl oab :J  ?[Y0 SP o8 "@ 1J \ v4/@{J { n6P V,aP Q @N MrL< 0Boh Jcw v' d wOX dkN0 i\  Nn1 }Ez [ Sa_ h }< 0WO Q W` waZL 4np Q  FQ c8 RT ՟XL 1W uAP0` ;h\ Dp 9V` wc !} H&b \uh [ aox ?HD |{\ Or&P ] 6/Q /S@ 6` 1e W 8_x C`0 Vf, ύv ViO\ O Q @ A^ d^ʤ 3f <c [  9~% ?K Nh L FoK X?P \g  (jl V `5D ͦ˨ym ؙa, v @P` kDaK ߸ed RL ^b| b S| @QcX ~mFp uyz$h u O \2p L`M8 ,l _v WuT jWDL ]  &/^݀ Z `68 Us ^ hȰR Xczl .lF 6o_U QP oX՘ ,!l{ lȠSMs` HK$ NL nȐ| ]W ӢȀlQ@ ! h!HD {;ä ϐVQ 9h Or%< {b <#o4 Or  3oF$ ry }} M(p+{kԼ kG W& {] aD ( `+D P+ ]C f 1lL BKP  Ep` X`t 8N_q Da  ݤ 8\5}mp u IK bY0 ;] Z ]  zN^ Z4 S`c Ha b0 ^gϤ 4$c Jil(KL8P Q ~b x%O ]Z.{k <bZ | %I w] g, "1Hn (_` u 7m =Bo/ dc Cv #F W ma @` K {lFK@ UX NL '^l \= Vo`U\  -ǰDWx0 *^e T`^p i{ afNx ]W uqaX  UM 3 l `ǠǐG1Kd ]T mOl $^, |V2< nZ@ (ǀn UgL G Jc  \ :GJx 7K0 FW W GpTV b x ?+nP J`RM ]ߘ LqPqy h@A_ DpD !H_| 3o;0 8J|  X Xc M`o| *Ht $ir Tun0 Ao4 N jbY OaO oBaT( 0RP` jeP'L 8Rd x7NH Pa! )l0 c L ]p la` wPP ]t Z ?_L 1_" 1T_p BxK sa] a(1IB0 Qa %k EK28 Lh 0 Ww `ix} UW| ] @3oe z k]h, -^ f{y &Ht Xl aʨ _|2 % fL| k\b( Ac! Gq( X"\ ~ |N< MRx` :_^` c  k{OB [ '-Sv puj,( ia Y X{&$ HK Q< |^ Q b| g-N< yb| #G! ãS  b^$ pFS *;zx 5oK PYl  e 'i 9{ބ ưHP GRKL zbK }h  f?0 bL ^ Y`o F`=d )b] 'ƠƐ$^ ? i$ U] eN UP¤ S}M )^  i Q {h mN @K "b^ %lP 6ƀj]i\ ^u R 0pcX <nYd Xc| _`}H ׃W 6PKVL6X c  աf_ e wN ]U T]  PqP +Q {]t z@ 7@ta_P ~C, )Q =K. Ke h_PFq 0R  cb N8L:t-UM  t },L [{ Sk@ 6 _O r i H FK b->H Moc % YU #W | bNx ͼ|| 0R yNac0 ]:| =np *Jo T< 1H, }` 3] ]x D, b 5m | v nb!T 9oJ  :J [Nz a_ }0 4lD +^H U_] { Zl 2~l ~e [b( :Ű'"ŠlFv Őy OUc $}4 v9ŀ4n4 e,oET =_ ZX#oH d YY4 Glf hXh mWz0 [ VMp  hd$l, %N ~l nN gpvc !jf W 2l״ fZ le\ ~p aP bU@ r 07ޔ HSu= fox dEN< U Ȫ]D `Mf }3d , oa` b LLB =Y \ E]  9d_| fH jYQy iS 5Un ^P m-` *6<Fq snƘ WP~$ @R 0 , ! n| fJ$ e  &l) |2 `XNt fQJ@ 5U, TF`^T \Ռ 0X: lg x bH &HQ > r` Y0b\ PQ Mz@ !}/ }D 8]F HW@ 8_t |}H)8H. P ZF0 [S K`< 2 `tf  iw@ `S Ob kMLh yR [Jz ZhYqNx "^ Ѓ ,?~p 4G PG< nDP k;lL` Kb|X  i\ :<aKNx8 Q jZx &k YL "9kt xc0H ,HP g7YXh !i7P ߓX, 'VX GU $qD, Z{h _#at` 3m ` 'I 3`: qeL W5aw +T  z+N ncF +5_ !^P Nw c^ Gb }a° q iMl` n pT Hİ4o= b4 \0q; Y҄ hĠGmd hIN b RP A_L *,_ #d 1a$ cJaAp c4 e XH4  Đfa (c] ?GDh DĀpR {\p "e `x ZQ R Gl e  >N rMaW4 @IojP GD Ul Ze ,Xd BWc i 7v_e | T70 q] c@ '  PJ@J(L X< 2_0 SRM  ^D )|lp Rv] {5`  ^94 {DD tT#< h0,H Gq( _ WIz ,^@ |5x }P U \p {Z` QUq %c rb \U DbJ ,ml\@ G\ Ƽ] &>It P~WP  mP b4 b8 2K h_PY f Xt \Q  eH<WPt $SMu c~ gTX) !r^ b[\ Ŧc^ ~&v h6I^~aU` h #k@ [u}@ {JX[8 F:]= zfd |4b }b @oe< SH`Z`   }U# G]p r{K ~  <n  jX bn]p FK8 Y d`th Nx  ] e< /_^ oi  siO H6ð=޴XS à~z ̟^ }"8 aN{ i H3K c FP 'ɼ \Ot 4oŸ e| \D Pr$ P Y Sg4 kf >nt )h0 ÐHZK Z Kd ȹ]P a| 2kl [z8 | eD ~` ?oJP  Ej G Y`n( {1b 6K z ]Bx DK3@ c i( lÀ5oM Pk NXe iek( Mdm| pj  }}-$ `vPnF U - /(e+aK #cr dv ^ kz FL TU &J^ @ȞTS\ V  #^p f|? Xj0FJ  bP b z&b{ HW mP *5k kNP U YX <b  Ru TT B] 81qy X fn ,H tJ&  h F  q [&D '^ܸ cvo, }\ Xb =|1 i| ӷWE [I|X MhWw U`eD i$ FRw4 VN,x Sx b0 bXp [` PbV & x00c$ jp [{ ua^` [. ] d\  ڠe VuP h]{P B?_M\ ZuZ4 S c XX jB e  fL }W l]H 4j` V`X Ru bp Gap 4n u{ iNQ VXw  S1_ l uzX 3xJ OL ‹Rp 9a j/ &G ^Y{` V6 JK ge`d YcX 6m8 C|Q4 \qA, qyt \%p a n|0  }tb Oq !H QXP 3JU U| s_^l ^ uzS 7_gh | b b$ #Sp q [0 b |8ھe ad a U@ S\@ °0޼# #] | W_0 .ZX G|aQ, gL3o@  ] Da xt  i͠ /@ߨ |l 9_p 3^  i ҭeh {L nTR( R Fh Q0 d`t  v W|0 fRv $4``3|, KAcH b dR ]E Bb Z ZEN< 7^  Zk}L uxp EX 3@Oh ^{{X ÅS) TM~ a4 ),lW ȺR  Z < 7bRX >n b R$ df 0e( ͎f5 'cD  =_( ^b[ ,^, $H f~n Dsp NQ` zyb{ e hJ k~q4 R) p{ϐ jVd Od M8 uN EQt oX N,zش Nq s,\$| #R"t `(X n|cP g | -H@ R'  ocg` bz Evph RI W a¸ @v )H bP hPS H ;n  >X چe  h z !e T~Mo (]k A_@ Rbm $+H( \pgA `wWܸ a *_  F8 E x(a] #7_a< `T4 wPo c@ LDPdp|TP [X% jY [N> (G@PM b 2fA R` ɴTl ~ C~` c"` nT c` eD W0 DOK  ~ Q $^< f {0qP D ^0 'I D I "H RIh aYcR| _a\\ H^L pcq pe K/$ q0 G l{H ^E{ pVD A, Fp`= ,oH$ |[X h 1l Q !x| vyL p b 8m .^ V  ei nP[bM b  N.j  1lX V| @}_c 3fl SMz ^ 9 ] E`2 ~ PM" Y =LJ uf ML8 &[ b/ | S( \q=d %dH0 b 94:lOL Z} /X QX e\M qEaW cr ob` ~FwN T  ]>( <a  -ls H#( wP/ yQx }a| ( ]T 0J i/` !W1 x]# NrK@ qW|0 2W' z wN, >Gt }T oV-l WYb b  Pr@| W D`0P aŬ  T8 ]} r)_b iS  W$4 0F"!Ix Bl `v OQ8 >9_x %b{h b  y.[8 NSV wFa^ qV Sb  i~ =-n, MZ[ Սf܀ uf NqL {R eTa v F 8tmp FD X# } BN, 3a_8 qN D"K NL ^Q W( s`l F bw G ZU JpS9rF f`xaN ]yx V`UL tb$ U@M\ ^bz <o+ _~D P$ _W YP}/ kq$, eh :K@EhD ^Out 7K wz ~w  R (Fq` 5woR X" ^  0BR fW /^ V \4 d{< v< xa  V=BX (>_< T  [`d (,lOP z Q8Z+bx ƒcW, ~Y( WN ,X[ EX0 }. ~ ww8  "ZH X   &I Or; [] caX k$ N~j v-^X ^{X ZN  u z% 1| H @\ y6Q> ~ # H( GK &X4 [N 0jX# 7VV ka Np GK e   l1p+`R( nQ OGE W :_  iat cQt Po[bh dP\ U nca)X #CI 9K\ wa 3ml xNU p b B)HG xzP f|G op0 0`J P T'T ya @ i+ M?0c  iEx !X \ eN Qb| ^bQ `. C.C,E  ]UX 'Lt nc|0 c fj( ?o< Our- DG ì  VwM ^  pUfh ~aX RU 'h@ NLL #SԌ b   _(PP;2LL ]|{ q SL S "k J}L v9FJx Nx R: a B|S y`{ mP? T X` jY q` gx C=Lm0 q~ah@ b$ c`d T Dfp$ l` =Z_ f1 )I pqh kz, S syp Mg %?H  ~\ >_ qH b]  Wp +fA` Ce@ qޣXM Kd }Ԍ F ma@   _ |3p G Q4}a̰ 1lL 2 c  c`3  oi ]P  ]x !k XtvP }Y߄ qT TC 1 O>zo iZNQL \Q`p v[z P\ H.cl ?@n M K Rv'\  GD ,BI O L N~ V Ztc 2w^@ rkaY, X G| o P  7_i vb jE4 |0/z @XR uY@ [^ }. YT h xVd K_ ~ul OR* ǎUx@ ݆e  r ~j pbU\ )^8 4JZl @^D xMN, [ 5Qp vfaWL av f3J jR #q_ rh=[ Z^| bL PM sJ) `daHp P0d  ,]ݐ ą  ] &rk *\< }b +k wFm V ٮW`  ]d 5_5 p- RL 7\ \  aVv }J ^!{l  b <`o1 N2q ~ 9V !\S  ] 4  lN ;M_ f@EZkl Q q* Qo 0k e _>OE qU8 lbT\ Aj qaX `v R|~ {T <o1H k[ , EL`3 0b1H Oq cg.R PV 7_g (g_  N{  i ] _ue CxKr( t{X 0T$< b] |V` t3dM+%^ "h$ 8h |  `#< Gƌ z^ Fdp0P| 'tJ&  b ` f| *H̤ gN R4 ]ERh 7j  j DyLp| b XzX sv xz Su6aX$ ) [h^X4 nbM Gr yvQ, X { IVd  Mb v8 h| Xh  ]& >%KM  (  өRD V~  !^ b *G ^ HWȘ Na Fq  zgz, W  }L RA V Lb  {t tjHMH K+RXt` v rb\( } SbL ͧV  X5 +H \ pZpq$ zn4 &MH db nڼ @__c bp L`Zp} OW Ƅ|R $fo |H jwYS bjBx C|  %I U kr$l ky< b |@O c(N \L 0a^ ^v7x -.^ WNc e9o@\ vPZb RJx XVC@ hno m@}? '0gY[  u+v fl n.J r N( tN0 WD bWyh b  i(m; [WQ  $H\ 8K$ iP; ah 5|D 5`oH 2bbN} xLc Dh* Vtu4 -Q Q`l 7m <a X _YhH .` }3 <o0 [} Xo QZ z qU0 |֠D S Tudt CV2 U i` [h G{< )hI /L^t .W4 ҜeE4 <KC@ [l I|| O&L @b <a_h ץex Ql Sya$ .Mk Hoq[ dG P T7p κVq4 ΨV/ p_5  j e{N< `Ra$ ?;_ ?K9 'la m)Pb fTK0 ;^l 9Oa#L } Z 3_; zd MG P 4 zb^l &e^ +{, >,8 Zj*8 0S f ,fH PL cW0 Wcy@  ~c sa` bp XXY I}q[ jP S dIL Bmo @ HfH iY@ M{qX `{t !\ \N fB | < |a p^P a Ug -,l"8  QAH Wzt Y at K 5]8  jUX eQ ^ fJ :J RurMl ڕW oi UUp{Idxh\` b7h cz]h ry +H ]<  &)HX 7nOX Q W b b_t ixi ]B@ ]4` ֨a, 1J$ lOP zX cP m nT ANc XK r< R Qc` 4R  _`8_mn vz\\  Pz{X (kd _N[X +P @'_ n5a  oc  ln@v\[t %c֌ z(] {Sa )ym0fW< bnI | <Xt o-kO rgy #6H @ C*IT %NP P ^p *( -hK 3nJK taY {g Gt ìc7  ibp  z Vp U`e  )fs 0_ i |\X bc j T  _l P-d 3@_6 b7 ] Y(.XDTu4 2l  H^ lwa bl, FI@ 2gJ [ ;QT Hq) |O( X..Dy xRl 3#J ^4 mc bi BmY\ '?p  wdO L,tQ i X 6] W 8Z ӚR X|  ] 5\n xO RD`l ޽e ~c 0^l 7q ^ x|c6 :8AK6t |- ""^d  _4 kx, bjd LJ  Xv ;i fL zeD  !Qt Q y T gaT K '  a8 ]u {d SӴ ^ 3|b@ jSS4  pMb0 R d?^ G7q"x S`` + IK `a= O5`3bk8 "fHA Ô ,SӨ 8cJ RRM( T^Mv b( _ t Rc0 [2PpNaU av$ Q\ U]  @op \Sq: [X 0|0& @p Dj=$ Ga 0'bj P `#aO }2 gp YNVT Rb|t } RM e^H cX W( aR. {X } T] > o, kaM bP %l# [6E,p̔ FIh h Z Y\ d^.0 RaV "^ Cd P)qp 5oS 8l^ [ /* bIn8 *PH qbO ix_ ChLH X b )l~ ) Iu ][y GbV4 c@ T k; Rm@ Ul |b'  fc@ _6$ mj_ kb] FaRT e Rf OGG ̅^  "HLP (_  a\ 0|x l ejB | [_  %P ĬRt xj+L ҋVG@ bm Tuw _N_ M`=< jT G 7J, n2lX \ c `0]oHwz e)NX .lnT WJ]F lZ\Ɯ X br a {b 5mt PWr  sO \=< 4[ Y)um:x ?_ 4dM pKr]90 fN U t^ Da 7\ i., ![y E`4 n ;`^iE $;k |]PSM R -V< z@5oN \\ 'WHPx ^Ơ ( WX' H v0j P"0: |D P[P a?v Re Q/ Aft { `6 J`n bD PH8 eN  Bcސ "%o5 H- YIuU GF  abFN} 4;mx way  7^m$ /nC$ eWԬ DIqZ TC4 FbӜ jpe]) 4mE ~ _{ 5"HG -^  LDLD lah l   m\ RVP Pt W } ry @ U/ eL T1 |^ H bBp ya {b {S @>LZ( WR` |  lap 1FK CZ bdh qy PP a2vx 6{V XD z  {=\ |  ]=8 )l < Or1 Z{ 3o; .\k0 :npkT$ h  ,l g`fX ρd ZRbH h -l  -FR TMx fN R S`d  qy~ 6^{ | IXE X-| 9\:@ R- Ep|  V mP]` PaZ k  4/J] <Lc ;zmX Fo ɰ  c\* a Pr@ %e V >f xdD \ZZ i}S k"D *mH@ ɕd` "j@ r]D [ rF oych` c \_ QRK0 YFN`  (G AF >K?d LS V`Ud  ]p 0b  P^d Q^% Q b] a\ Q~ `U `.-Dk`;8 c| h8D HqY tJ& {|, Rh S`U jXD Hc J{,H  aW| hH z-zʠ Wya|T jR Z ?n %k R :bU ^f ZP _@h h( Ff nL 'XU4 _^  b4 gRX Fd bZP  _J8J YdD b j iU]| k,Z <nZ Y0N͸ iT>, S| \  }4P WȐ y <" ,\Z\ adD o| ޜ}3 DL^P Q uaY m]o ]y \r  E{wz  NpV ca "^8 ya ]ѐ ,0H {rbT hZa  j`wt ;b I8K R  Ts fL ]` fU *~` ?h`d 2- OjA,  7i} j 2l oi pkX 5#J `]} b| 6oS A>o|$ {q  Wv qN8 4XX ׿W( |bA КU, X  Kb PkW b +SH _T R k{ %h0 BKҼ ,], {x !$j\ !k 1 `|+z  m< ũ[v -V c\` b< h  a a\ %VHǴ Q }V Wp f TV+X Rc 0  Jl  dUS  ;]R 8 Qkw0 B1K@&|1 IH8 2lՈ `^ |t ™c) (_ ,H ria Mc 7qJ 8_t  fZ( Uh @_? "Hkx Sf U$ NV UP PI, QWx Y T"]Q Vu~ VbD nM8 S( dWn   M]: ^ } paV Trɸ %&P0Pp Q YuH 5@pS| 'H !kh DFUx wMP. Y|`r 6_X V  Hc` "kӴ f0P ۞ep Nv ZT  g@0  BXV -Z m<} W G`e |p nnP?4 Ғe sGFp ,^ˤ Dp  zz< HR  {J4 I C- J !k .;D 2HT C\@, XJl _  6c] -lh S  KnL\lx KS4l a fZ  T0 T% [ \t{ +ZbL tc  jp @PK ZZN b  !fg V P Haq` ZFu gc0h ̯ K(3 l {/XvL Q yYl |]lL Lnø AU` Q +_R` Vd `np ;RT <=^ !h .l^ 3P[ 3W b :D ʊU< XL ewz ŇS #k P;e I4qZ +HL WQ@ zz |^ ir]  pӴg ,Qlw zX' 3\[| b 6fJ -l[ !P( яW 1W0x a {M$ V j ]C Y\`P j9 >KU c+|| l:8Jƀ u/z"d @` ~ k`; mh T d^ wz ĥcX fV| kfH 1e EpT eMNT ,hH, #]@ V] Qr9T `0Ns R#$ eX e(.l_  tJ&$ uV0Hd bh ?_ڼ eW\z` W+D ^L !l Rm >!n  ܶX( b R  =_ b`u UTQp Sw 7Aq AcK݀ V x P FT 9Jt Dpd PJr!` T84 ؿaP fF ;Eh|D ?_  f` HdH '~4 Q a$ Bo wN uNJ\ q / NXz, .lF r 7:0 Z k|q zְ LX EKQ| Pt \} cfL )Fl @ 9m n  R Wx [9 |3 BTK raV avЀ  \pg +dH` j{O i R  $X( e Pr=$ CK~l P>r/` Id fO  Z!ND 2]rD kaZ ?`% 6h7l Z] qaX zv` jv *Hk` Q Rr;y G #HF gQ^ taul 7^_` e5L YN R 1J$ ibD bi (yl ~ X }]d waWd b0 b P,\|8 2WD E]4 F]< s L@f *k Lx{b~ gм i jpd :%VuT =Z /^ \B` NVL |N ]u jh~kx 9_ {UO5` ^!L y{ R\ ·c, V Gad FX ^ou 5JYP 6M_U (bK }2 a_ ŀc] 8 "Hjx 2[ i^xg Rp ZՐ O.b U e7 q{ J,cX g i N ql T`_ [bf  fZ0 } g f/`x |^P { {P  ] YR=s ) Lx^$ {a`p {| KI  RT ϴj .A^ ^P  qKNP W 9m| EFK1h y4{t lU  Nsq@ vraix []uo X| yK BK  G| AK "V {J {j Rl( ]^ PaZ| e pWi} GC @bv 0_ ;bh =G  6#nA tyabP &l: '@I Q ] 2_,@ i D#p>, Yo QT }>z *^H gWN QT xp!Hn `<P Q4 R 1_,L el` ZW P| ӏWE f mn> =CLK, _6P AbQ ja ~Y]z ǰa ;ZlmA  dNT Wh ba@ d Sx 6LOOr4 Q, ~ eS0 Pkzl X ]`t / S@3Rn QzD |VO k#Z ?h. GLbp -KH  dVD X` cr  0UMt ݮX= P, +^ Xu5  u Wt {X NM U 1l Gq FX U`YT  =Pnt [q XI GH4 Q> Wcd NLl <  3R K9~ 4;^ l@`; sv G ]{ <_T |gbp .-IT DS EXK1 _  ZjuM WdaƄ ȍc` szJ.` 4JRL PgMg` }f )$t|b WH j;T / $ NL fvd $lp 6R#0 |Q U| kE $H@ \N 8:>~n\ PP .J O[ '6 HXKV\ 4 NSq$ [jR~ G DK y7T:p \$` 1J&, E`2 ouiP @ c` ^D~mh )HR 8xKd 1X1 ?_x d0 P\ phG Q((vptbN  D`fdɌ #Xz? 2]{4 aH eaF 0  _ee  l^ 0 Fr ~t jVRk cn4 ^ *ck| EKK (^߸ h P@5!^ V@ jZ  bk  ~z0 )DI Iq[ 5~d gM` Bj^ ac _v{p @poo eD0^x >n  a  c  &l0 Z\ba @c >V_ Rhc b9 g)w XJc j)D @i u~Xh }vp q UzM Z e  @W3d _g &g  Lq 1H< Q `c $c T C|S VW Р @}[ G i=  8m ~, [W` (ivx KP,l j j OL` Nu ^4 Lx`L c4 P X_ bZ\ EH bt ( U%$ 1Q X~ a^ b ]G zkO   \p k\< >Kt| {X vR@ ] _  .)x V "Q RT p]* mYa 6GTu> @^@ d` |z U{M b Qph(V Lq| [dU , BRd >~, c } -{° &-0n8 hsOx Q6 Z FN]> 7/m l` i wDL Xo| bZd >| h`U  j # `G Q^P X^< /1^ }d 7e  !S` yNdL Y Qr) E} @ ~q P*a `  j` Tah 3VJ kP 0wJ  J`C Or+p "oH8 hT3 p]%d =nT Dpp P6$S :XP  wD k8Gq n4 Xc T>Mn ~Fp ^  }. qyy >] -Ht zz W'N dj\h ?z 2jh #Ykl kpS/a# ]Cu >n X_  [` pii ?CLi [] ^`d bH Zu[ gDr$y( U taY OL p>| XPNd BIxN` ѦVt &aĬ `P^\ : NS T 9S 0|F$ X+ WHax$ eE ^zp J5NoX gUu һeH 1lx Qox fgɔ ,Ny 2Q cU$ W@ jS Wa8 |<+HL DQ| YѬ { Vn GXռX 'I0 P{ݜ 2T ]Zh @Kt 'T gc $40tK`UQ 6XU ,>lV [vP\ ejT \Cq>$ k] Z U, i] ej h8 Id   7jX ySz0 "^ 7bwT SO7 9.J tO S1 ` YhuA ʛUX |XA &a R (V$  aRO \>5nT 0z ,Yh m[ LS`L  z +HƼ Gx Po`Y Ao~ c`&9l  wT  j9| xgaR N{ kZ nZd Ef v/s0cXՐ `)X +^h Nb5 Ʌf< =qn´ 9J ]|| +`= X$ h  2?E\>\ %_8 !IX tJ&  @_k8  i 15 =nڜ 1{< u/'gD Cw" P|h L 8m n7P@ ^{8 h Xg ofw` #H^  T? 4^l Ϧ}2 _pNT '6^ ~lb0 M0j_XQ g B]u ~Vg X 2J lNȘ P qZ %v^ ^< e 2GD yT  Z qaY Ec 9J T xcr ]e h3M  RUl [< NBq sO3| % o}30  ƎU/ ɒ] va^ vMaZ }3 ca \P ?`( Rvg ZzL D | EK2 Z \q< X| -px `b4 bpY_$ [z Fdp [=z nGa  EUl %] 7cX = n S$ Xc Q  ?oV SPX PZ _]4 )HT @1x ^ .^ b8 ]` Qr` Po [oN Q- Q ^Ɣ ma 5Jm]  |@ PN X$A]M xz, RT  g 59anvl OPo Nc F/q0 bT zp1m h|ɰ ^ X/ |, Jc% ;cm d>n” `a*Nw0 $]uH N}.d c 0@ {PP~ Y]U  Md0@ j@w e\ ,~V \O@ jN 0ix` `i fL ^P At d[{{8 z \[( # ڐ   ]݀ Qt xzh I\K E]d [[ ^[+@  }2 <hT 5`qW x]Q A_< &l9x wP`N S u@S ]BH bR8 Cbl / I cU` 5;oYl ?LT h,NS SA $0P On; \5d 0l u%rHF c hx_  GbD\ Ph q$ gY vP /^  ZhJ _nP R@ ϙd% XNN ^rF 8KK :J_ f|2 FJ &MI\ kW8 Q< |S A{I\ z O$ lha $>nnn C[Ks ?n pZ E'|a *c0  Ϩ :Rx@ 9G1` m Gb, 5_< h { P ivL ;EdOa[  HW _NW bQ ֓WD 2WH e `^ b! U+M| WRFL Ԕe 5oG EkK2 ;LLF (dlc< ,VH mO 0U MaF j]h Z^ _R( \3  [n \PPNL 5oK$ xY@ 0*l k ]ـ 9R .X]!x QM% ^ 'I=4 }7`   z XWX f`ۘ >BKO` ^T Ȩ  XPL Ot`v FN c ( I R  Y G"'PT HWrP c\ ;{ bN~ *lL 9bN ĕR  ga!, =n +a^x fr n 6n6 O]q #U_ Nl vlX^t ` _ov |>z̰ #%H[ QN< [,  ]J  g L ˗]$ }  SԠ f\], ``P Ǐc< }:J XND a ep ?i l Do`$ B:P b0 N  ^ Ao|` \M{ ma ~'b 3m| U bnD hT tz7 ~ 3a rry ( ] \=D V@ a_8 [\?$ Fwq` UvD X@ Jz  )j KU H >b{t Hc _Cl PT@ W -q^  hH t z ZpFK`oiO !^ ~ $I_ Uc; \k{ }  ېX! [Q< 4_D >_ PP {T V\ W yi~` |X ,H iD QmM \ D)` X8ah W Z :bb$ ~Oߐ ^c `EPdR~H $We\ ^U  ^p  96_{` Z`bY mXt Xڨ cWth &b; f u\z; YY 1@} scaW a 4  `ax1SX  @or ؁W Ta  UgM x^ ^Zq wZhX h <F b! /J oO \Dx V3| +H 9@ ~Op A0] fE@   vhp nc~x #kT ;n_ B[ 1`# tl1N ;g`l  `k@x  ~]9 e DzUy  c Q]h dn L mO  rb mWNU 4n" b0|`!P [{H Xx 7iv8 PH S af &b%n rp Gx &"l "n/ a,Sp ]K kx E  ƭ] U- [1 N9 nN ZP l`P a HN b;4 e#z Nfx e h q$ b| R}4l X jP( ]D Jc6 lj" X tz  O Q tJaX dkf 7}Y !^< QaZ4 X .[ ;{ X| c4 z~iT }N ~m$ N\  v̠ ( Ahpcx| @os LRs ` pX@ Fbx< RJ S Wd ]U Su, Xb  TDp 6_Z f    |  So ia DXBKp Юap liJ N  cܔ ip Vu M FK8 4Je 7_^ Og@ ӔwiaS@ f ] ļfL { Qt O` cRtP ͿR #R 0x  X  7m8 k>P mZy @A_T  j[H YuF *_ 6^ٌ c{h Wz e 5d HK Vܔ BLf R@  QD :$ |Od ^a\D  Hh AK ba[ jzxL aNy@ Nhq| \C TJ $^ "z o[  c M PH !PH yP Ru &W c< pGKq $H? wg, M`(Iu P!l ?80ܞed ;n SMk Waz am Pq( c@@S  d^H xaeD eoO$ $j|mH nQ| g 0iW sv %Xk@ 1l ЬVP raP  1#_< @ *t4Qyr2 P4 W dc 5Jg | ]{ X[ rl 6-m ~ vp 4R _\΀ e eoN S āRh pag  P\ CX IK, nND hN`8 mW* dc! ~(  M,(1AJ# \yqH  yO" }2 %^ Q9 ]A 9jBX Px %]N| Ic ZOH "Hm8 (^ .FN~ UM IR( X`4 4;_X [uo h6Y  }Bp )^l V MS |Ҭ 8Gx Q4 }` Nq [ )L X W 5gm$ { p!Nd $0];t /{U ʃV X>T *h- ED5|l 2a  ;H U kK} ^4 ֑e vD "k\ M4h` +l k{, .s^@ ;j, [^% FK {hoSH bo m5  !4Hlt  [h$ jo\FT C^ hnN kU7x Or% \Ѵ *b^X %lN |- 7QvApzbp R=P 5j !{ ,l4 ?Wnh sJ-L  h$ ;>`$\n/ R` T4 U  ;W0 jC 'P TX  YPy@GV7 a| 0vp 0J SQs, cFw@ ~o K Fo G, Q n $5`99 G-c6 Zag$ <Hh iP& S|Ij=d `v ZGF O`U, TFV 9 4]l } Wc{ jь z~( WN-( .U  1  vN GV gː ]4 #zL b RKh Fa] UcH &YD d  }P b, U߈ WF `44 !CKh \` /h _iH FW ?@?b Z  ?e| KZ'wI fhN< @VH X ^T qzd fY`ۀ sa~ c GqH _7vi QL |b HVu, {t Ev V  ]?P 4e FW kGP4 >iKQ 'I h G{D ˨f? h  )r# -lk\ { .H Q} hGF   zT0 q{(  h  f q 0n9 Uz( [| aƬ c Pa[ -`4 e70  PYTH mAa4 Q| ѹV ՐX Y" _  K@V` J_a8 }aŒ @:|FPp V\T Wa ( :`rOa` |;LS ,U% 6f V4X )yI ( 6hH GbK X( XN \4H G[qL bS d )4^l Ja< b$n_H da 1=$ G JF oiw  ZpHq)@ S ]b^ x%TF ܑX$H Bjp, AO^ǐ Y`c 9cD U3`EK2 U  j P#}H  OL X{h pj 8 QMX 1P U ]< @0& 0[ \x ~f\D 6{ 9[J@ =#LK T[U 6_]` cP {r$ G S`grMq  y]\ .^@ Y {g ܱe Nq z} bmU` +8|L [ PV@ l P@ SX `\߀ b fi LN 4_H b { Y {Y?] @|N v"NWX T dc jOh VXt \q?| Rgv* Gx 2_,4 N c]p xCl`X A2KJ0 {O҄ ř[t \nL k< HqZ P0 a q7 Rm$ :_ a_ 3Z '~ k{ +H cN -^x Mw ESp` *z| {T 1J~ g eiN oQa nsOd 7_l b u}4 s)O X@t m{I i HqY FN8 b ib  ~w<P. $._ h p5oH ФV h`S$4 c UgP^G Y`o bP o  x V@HqZ@ J.h c w)0v5aY 7/N$  i b  yTM 9m bP |aT |0 ]nJ O<`m qzUz {i ,`MQXS \ s#^ N_L\  Yh vN qy {dyl \FV &  *X0OL Qb| ^v3 cN0 WWr A^ bQa0 fh .{ XP \A@ f Wv` hxe S%0 xÀ Z)u]P #6<rx`` z {L { GX@ aQ HQ{X Vel  T Gq( -b% h}/P /  &bV  3nx ec^  ;i -P *_ 8 NF` (aQ X` sa< 89J E8n Zt |.` I ] #qk -pH .^Ϙ qNl  F]< 7| tV  a `RK {V" Xl4 blh U a  {P  ]S 6JL  )HZ Tc Zf e ui ={ ! ((0#_H m`8 *{ }Gl ?K !b`T ^, `6 a Fx 1] ۷e< )l 8J SӘ p3P * h 4d z 3n Vp :r 's`Q7L e <ke ̏dI Lz qvNTp { P5@xP c  ~ Qn =V0 `[0|NƬ FX9 ab c\  ]z| Q>r3 T\1{ V gF oN  y{4 `  e U` 7b TWx cd L| Sw8  Lz P  { aN{P "Q8 e 8J< iu 2Rz` Q $u g`ߐ n Hqb W  V|  R Z}P wMN  x$H !H8 ]Y 1fp #/k( z}|  a l AKX T6 AOK5l q2apD ni  h0Ic V2 W*nzT L|5 3a W ʲak b zW p d0aH 4b< UM -U  VU  njT (HV\ 0_ Gag|  0(݈X8p Ic X  bO0 fI` gxN| U `c 9m CK 8P` $` o9 $HD u}` HRcX ;n Y,uD bn> P ~UhP jT <K>| P.P +ml1 -H \0 'l pB` f@ eN0 !InK .[HX J]N ] WL \Y hS fY | 0 t8O E3`38 3cJM| Q CP jp b NK h- R F]< ^~h y}U8 XҦVH| b( )l ?eXC O^ c SU +a^P ^i jx`  [h a 5p-$H PD:$J  ]y co4 N3L| Ȟ]h BPt `PFK` [ j9x(C ^x vh tO PU"d Cd#0 ƞ]P ̕V 8i5l bl i }XX 4}} X} C$^ ViY lE@hRJ4 R h |_ pyr, !^ Rm W a~8 O0k i^ڴ {T ~ez ] S [ B_8 Z^ X_Yvj@ )ZI ˢV jbh K LqlzYLXP D`0` Rb! 0e QMH QM_p 0W O]aO I/XC ?  l} b [n ^ ]P T 7YJ ƮcW  xs0QM  _ Nw Sƀ W, a qe4 :mb avp SL a GGK j @ 4JY0 %k 9ml, Gp FJ #H[ ryO;  bN~ ]d ǝU f`ݘ gd*P #UM P | P, Xs r1y` uzT UM i] { k4 @or  ~/z L F!$HO F4 `V C|Q [yLeQ W Vf 0  X bO ( #HJ EZ Ii|  vNH gN8 2Xh b9$  jD GH hN OW$ =_ P}  DbLn =b pP ʧ ,S(v: QT 3|l  { GH $^` 5m JALl 5_Nh uzh, (fHW P Ü &I 5PP 1~x  Q 8_v zp{Qd Tvuj inxb <Q PH .: R < raXl Kj< QL X ak b c Xpu0 <9o4 [ i9x~d QtϤ еU {b Wx Rr _`:R \`  e< 5hL [PcD ʶV XM@ *_ b@ _fini__uClibc_main__deregister_frame_info__register_frame_info_Jv_RegisterClassesfsLockfsLockInitfsUnlockfsDelayfsGetProcessIdfsFatalfsAllocfsFreefsAccess_tablefsCallVectorinit_fprocfsExitfsReadfsWritefsOpenfsClosefsCreatefslinkfsUnlinkfsChDirfsStatfsLseekfsMountfsUmountfsFstatfsSyncfsExistfsMkDirfsRmDirfsCheckfsGarbageCollectionfsStatfsfsFstatfsfsProcessCbksfsIoctlfsFormatfsGetcwdfsProtectfsOpenDirfsReadDirfsCloseDirfperr_codePRINTload_execfile2vsprintffsCallstrncpyshort_commands_enabledfs_versFSmkdirFSopendirFSclosestrcpyFSstatFSopenFScreateFSreadFSwriteFSreaddirFSclosedirFSsyncFSlinkFSmountFSumountFSunlinklast_used_std_inuncompresswxm_snd_filestrtoulwxm_rcv_fileFSgetcwdfsDirFSchdirfsDfFSrmdirFSgcFScheckload_execfileFSprotectcmd_shellrun_execfilecommand_interpreteratolstrcatFSstatfsfsReadUnlockedfsWriteUnlockedmode2unixunix2FScreat__errno_locationfstatvfsFSlseekextra_memory_sizeextra_memory_to_muchfsRegisterfsInstDevfsUninstDevfsRegisterAllocdev_cmdic_mask2cidrstrcasecmpmemsetic_genioctlserv_state_getxm_allocserv_srcip_getserv_astate_setxtm_gettimextm_gettimestampChecksumsendtogetsockoptrecvfromdbg_printfxm_deallocserv_port_setserv_registerserv_inherit_setifm_find_idifm_getifm_get_ulpdefault_mac_addrifm_addifm_set_stateifm_set_ip_parsifm_set_flagifm_add_ulifm_delgio_if_idx2namifm_get_ip_parsifm_get_stateifm_get_atm_parsifm_get_eth_parsifm_get_ppp_parsloopd_deleteifm_remove_ulip_ifgroup_getnextic_inet_ntoaic_add_sprintfxtm_wkafterip_ifgroup_find_idsscanfip_ifgroup_find_nameip_ifgroup_getfirstmlap_intf_value_allowedtagp_parseoptintf_is_dynamicic_inet_ntoa_ripcfg_alignment_strmemcpyic_numberornameicmp_pingudp_pingtagp_parseopt_fillhttpc_getServerPorthttpc_getServerNameinet_addrgethostbyname_ipselecthttpc_getPathhttpc_writebyteshttpc_readbufferstrstrmemcmptagp_makecmdip_ifattachip_ifdetachic_inet_ntoa_mskflag_charinet_rtoa_rtagp_register_param_type_2ipcfg_type_ip_intf_group_nameipcfg_type_ipintf_nameipcfg_type_iparpintf_nameipcfg_type_ping_proto_nametagp_linkgroupconfig_registeripcfg_initserv_find_idmbus_ctx_create_and_registermbus_invoke_regobjtypes_piftrc_def_printfip_group_atom_mbus_initip_intf_atom_mbus_initip_fib_atom_mbus_initip_arp_atom_mbus_initipc_initip_atom_mbus_initdynstr_getstringdynstr_strlenstrlcpydynstr_setstringmbus_keypath_getkeystrmemm_freedynstr_sprintfloc_get_ifnameip_mbus_get_plugin_ctxmbus_plugin_process_cmdsmbus_invoke_regenumtypesip_addr_atom_mbus_initmbus_dynstr_pooliddynstr_fromstringdynstr_fromprintfmbus_invoke_event_object_add_delipc_addr_getipc_addr_commitdynstr_getulongdynstr_setulongstrlist_getdynstr_atip_get_indexipc_addr_getfirst_idipc_addr_getnext_iddynstr_getipaddripc_addr_addipc_addr_deleteipc_rt_getipc_rt_commitipc_rt_addipc_rt_deleteipc_rt_getfirst_idipc_rt_getnext_iddynstr_callocip_get_namedynstr_strcmp2mbus_llist_poolidstrlist_getulong_atlock_initlocklock_locklock_unlocktp_type_ipaddr_nametp_type_range_nametp_type_enum_nametp_type_bool_nametp_type_string_nametp_type_iprange_nametp_type_hwaddr_nametp_type_ipmask_nametp_type_int_nameifm_type_filter_nameipc_addr_is_dynamicipc_rt_is_dynamicIA_IsMaskIA_IsAdrMaskhco_upgrade_get_partition_infotcgetattrtcsetattr__stdin__fgetc_unlockedfgetcprt_suspendprt_resumevtrace_PRNT_flush__stdoutfputc__fputc_unlockedFSprocessCbksfwm_initfwm_level_initserv_firewall_initservice_initigmp_proxy_initlm_cli_register_pf_cmdslm_cli_register_fw_level_cmdslm_cli_register_fw_cmdslm_cli_register_service_cmdslm_cli_register_igmp_proxy_cmdslm_cli_register_igmp_snooping_cmdsexpr_atom_mbus_registerfirewall_atom_mbus_registernatd_atom_mbus_initnatapplist_atom_mbus_initdeviceinfo_atom_mbus_registertime_atom_mbus_registertls_atom_mbus_inithco_boot_getmodeENVsetenvstderrfprintffputsconf_set_strconf_get_strstrchrstrrchrsigactionopenlogmbusd_setnamearchive_nameapplication_namext_initxt_creatext_startsntp_reply_recvdsntp_init_clientFSinitfs_initdbg_initasync_initstaging_is_activecfmakerawtcflushprt_initprt_attachxtm_inittimerfopenfscanffclosepool_initpool_createvb_startni_raw_initeth_attachpppoe_initpppoe_relay_initexpr_inittar_initENVinitenvhco_rip_readENVgetenvstrlcathco_upgrade_initializedhco_upgrade_initset_version_infowl_ath_preconfigure_keys_and_ssidadsl_get_versionhco_rip_closehw_passwd_initpassw_initapptimer_initconfig_initevtp_initmemm_set_fast_sagem_lockingdyndata_initsgw_initmbusd_read_initparamsmbusd_initexpr_storaged_initmbusd_out_of_processgenio_db_mbus_init_plugingenio_inittagp_mbus_inittp_type_encpasswd_inithl_initifm_initserv_initpb_initqosb_initadslmon_initadsl_atom_mbus_registerdmon_initatmi_initethi_initpppd_initpppoerelayd_initbridged_initip_atom_mbus_registertelnet_inittelnet_starttagp_handle_user_commands_authorizedregister_mbusclientlibansr_initdyndnsd_initnatd_initVoIp_initsntp_initmbus_led_plugin_initmbus_trigger_initsslapi_globalInitupgraded_initcwmp_initrad_Daemon_initexpr_atom_mbc_registerpfm_atom_mbc_registerlm_cli_register_intfmgr_cmdslm_cli_register_debug_cmdslm_cli_register_config_cmdslm_cli_register_env_cmdslm_cli_register_pb_cmdslm_cli_register_qosbook_cmdslm_cli_register_atm_cmdslm_cli_register_bridge_cmdslm_cli_register_eth_cmdslm_cli_register_ppp_cmdslm_cli_register_pppoerelay_cmdslm_cli_register_ip_cmdslm_cli_register_mfc_cmdslm_cli_register_nat_cmdslm_cli_register_dhcserver_pool_cmdslm_cli_register_system_cmdslm_cli_register_dhcrule_cmdslm_cli_register_dhcserver_cmdslm_cli_register_dhclient_cmdslm_cli_register_dhcp_spoof_cmdslm_cli_register_dyndns_cmdslm_cli_register_dns_cmdslm_cli_register_software_cmdsinit_translationlm_cli_register_tls_cmdslm_cli_register_tls_configlm_cli_register_expr_cmdsvoice_cmd_initmemm_cli_initmbusd_cli_initmbus_trigger_cli_initmbus_client_cli_initmbusd_backup_tagtypes_initcwmpd_register_cmdslm_cli_register_servmgr_cmdssntp_tagp_initsetvbufwait_until_stagextm_elapsembusd_config_loadigd_mbus_event_inittagp_handle_user_commandssqlite3_mprintfsqlite3_opensqlite3_execsqlite3_closesqlite3_freeftelltagp_hidegroupwl_htoaget_mac_addresssha1_init_ctxsha1_update_ctxsha1_final_gen_digestsha1_delete_ctxmbus_handle_statsmbus_handle_cleartp_type_qstring_namexsm_createxsm_pxsm_vxapi_t_identerr_reportfs_get_pidfs_sem_initfs_delayfs_sem_waitfs_sem_postfs_sem_init_dummyfs_sem_wait_dummyfs_get_pid_during_resetfs_sem_post_dummyfs_delay_dummylc_dec_symbolslc_grp_symbolslc_datesep_symbolslc_timesep_symbolslc_dateformat_symbolslc_timeformat_symbolslc_datetimeformat_symbolslc_durformat_symbolstranslatelc_getTimeSeparatorStrlc_getDateSeparatorStrmemmovelc_formatULongloc_unadivmodloc_unanzeroloc_una2strloc_ula2unaloc_dul2str__floatsidf__adddf3__muldf3lc_formatByteslc_formatULongLongerr_printfxmu_pxmu_vminitime_popminitime_tvdmon_fd_add_readminitime_addminitime_delminitime_timeleftxmu_createdmon_object_allocdmon_object_registerxt_deletedmon_object_deallocxsm_deletexmu_deletedbg_inputxt_sigsendFSioctltagp_syslog_logmlap_getoriginmlap_issecuretagp_handle_loginmlap_user_has_tracerightslistenacceptgetpeernameatoiserv_port_getxm_getmemtelnet_serv_idxev_receivexev_sendxtm_createtimerapptimer_callbackxtm_starttimerxtm_stoptimerxtm_deletetimerxev_allocdmon_fd_add_writedmon_fd_del_readdmon_fd_del_writedmon_timer_delpppd_config_lockdmon_timer_adddmon_timer_leftppp_contextcallback_processppp_intf_state_updateppp_intf_pppstate_updatelcp_wantoptionslcp_fsmppp_handle_retrypppd_mgmt_sockppp__getifnameasync_call_copydnsd_route_adddnsd_route_deletedhcpool_check_ip_addrs_by_namedhcpool_set_admin_state_by_namedhcpool_set_netmask_by_namedhcpool_set_poolstart_by_namedhcpool_set_poolend_by_namedhcpool_set_primdns_by_namedhcpool_set_secdns_by_namedhcpool_set_gateway_by_namedhcpool_state_change_by_namedhcpool_reset_by_nameintf_is_nat_enabledsifupsiftemplatesifnattmplinstsifaddrsifroutesifintfroutesifdnsrouteppp_intf_received_laddr_updateuntimeoutppp_lstateevtp_sendcifnatdynamicsciftemplatecifaddrcifintfroutesifdownppp_disconnectppp_disconnect_llppp_stop_llppp_handle_restarttimeout_leftppp_dod_delay_timeoutppp_read_packetppp_stop_dodppp_connect_llpppd_handle_inputprotocolsipcp_wantoptionslcp_allowoptionsipcp_allowoptionslcp_echo_optionsppp_connectpppd_process_commandppp_atom_mbus_initppp_get_mbus_contextmbus_getcommandlistensocketmbus_msg_parseevtp_createpppd_target_initlcp_closelcp_lowerdowndemand_confppp_killppp_log_connection_errorppp_get_mediumppp_get_pppoe_datappp_start_dodppp_start_incomingntimer_timeoutsifintfdnsroutedemand_unblockcifintfdnsroutedemand_blockgio_if_nam2idxppp_update_ip_ifppp_add_readlcp_loweruplcp_openpppoe_ctrlpppoe_sbindppp_add_writeppp_del_writeppp_del_readdemand_discarddemand_flushpppoe_hook_registerppp_create_ip_ifppp_delete_ip_ifppp_startlinkppp_triggerlinkppp_stoplinksend_internal_commandpppd_event_handlerifm_set_state_cbpppd2_reinitifm_find_namegzfs_opengzfs_readgzfs_closedhcpool_unlink_ppp_by_namepppd2_start_link_waitpppd2_stop_linkpppd2_start_linkpppd2_trigger_link_waitppp_dod_delay_leftpppd_pppoe_ioctlifm_clear_flagdhcpool_link_ppp_by_namespoofing_event_handlersimlock_emptysimlock_checkppp_updateroutelcp_gotoptionslcp_hisoptionsipcp_get_stateipv6cp_get_stateipv6cp_get_negociated_local_ifaceidipv6cp_get_negociated_remote_ifaceidipcp_gotoptionsipcp_hisoptionspppd2_get_params_extipcp_set_stateipv6cp_set_stateipv6cp_set_wanted_local_ifaceidipv6cp_set_wanted_remote_ifaceidformat_packetlink_terminatedlog_packetfsm_sconfreqdebuglcp_sprotrejsifnpmodepeer_mruoutpacket_buffsm_sdatafsm_lowerdownfsm_lowerupfsm_initxmit_accmfsm_openppp_set_xaccmppp_send_configppp_recv_configfsm_inputfsm_protrejectrandauth_resetlink_requiredfsm_closelcp_loopbackfailprint_stringlcp_echo_loweruplink_establishedlcp_echo_lowerdownlink_downipcp_fsmnp_upauth_ip_addrip_ntoasiftraff_trigipmask2strnp_downnp_finishedppp_ipv4_set_trig_admin_stateeui64_ntoaipv6cp_fsmipv6cp_allowoptionsipv6cp_wantoptionsipv6cp_gotoptionsipv6cp_hisoptionsipv6cp_protentether_to_eui64sif6addrllv6_ntoacif6addrno_ifaceid_negppp_ll_upppp_ll_downChapAuthPeerour_nameupap_authpeerChapAuthWithPeerupap_authwithpeerpppd_get_linestatsxt_entercriticalxt_exitcriticalupapauth_peer_failauth_withpeer_failauth_peer_successauth_withpeer_successchapremote_namemd5_init_ctxmd5_update_ctxmd5_final_gen_digestpppd_get_namepppd2_get_destpppd2_dynstr_set_destpppd_dynstr_set_userpppd_dynstr_set_passwdpppd_set_dhcppoolpppd_pppoe_dynstr_set_acnamepppd_pppoe_dynstr_set_servicenamepppd_pppoe_set_acpppd_set_pcomppppd_set_restartpppd_set_passivepppd_set_silentpppd_set_savepwdpppd_set_demand_dialpppd_set_unnumberedpppd_set_accompnegpppd_set_accomppppd_set_tracepppd_set_lcpechopppd2_get_lockedpppd_set_retry_intvpppd_set_mrupppd_set_demand_dial_delaypppd_set_dnsmetricpppd_set_idletimepppd_idle_time_leftpppd2_get_dod_delay_leftpppd_set_lcpechotolerancepppd_set_lcpechototaltolerancetimepppd_set_authpppd_set_maskformatpppd_set_idle_triggerpppd_set_laddrpppd_set_raddrpppd_set_netmaskpppd_set_primdnspppd_set_secdnspppd2_newpppd2_deletepppd_dynstr_find_namepppd_get_firstpppd_get_nextmbus_invoke_event_updated_ro_parammbus_regenumtype_getstringdynstr_fromipaddrpppd_find_namepppd_start_pppoescanppp_scan_bufferpppd_pppoescan_getnextpppd_stop_pppoescanppp_route_atom_mbus_initstrlist_getstring_atpppd_get_route_paramspppd_set_route_paramslcp_protentpap_protentchap_protentipcp_protentpppoerelayd_connpppoerelayd_eth_port_getpppoerelayd_ioctlpppoerelay_set_hwaddrpppoerelayd_process_commandpppoerelayd_config_lockppp_relay_atom_mbus_initppp_relay_get_mbus_contextpppoerelayd_max_connifm_set_eth_parspppoerelayd_target_initpppoerelayd_startpppoerelayd_stoppppoerelayd_internal_commandpppoerelayd_get_nextifm_get_ul_firstifm_get_ul_nextpppoerelayd_addpppoerelayd_find_namepppoerelayd_deletepppoerelayd_get_paramspppoerelayd_set_hwaddrpppoerelayd_get_namepppoerelayd_get_firstpppoerelayd_sess_getfirstpppoerelayd_sess_getnextmbus_errorstringpppoe_relay_ctrlpppoerelayd_sess_createdpppoe_relay_hook_registerpppoerelayd_sess_deletedni_releasevb_skip_hdrvb_recover_hdreth_port_addr_gethtonsni_raw_addeth_ni_receiveni_raw_deletepool_freeeth_bindeth_sendvb_allocvb_freeatm_connatm_intf_status_updateatmi_timerlistifm_set_atm_parsatmi_select_writeatmi_max_fdatmi_select_readatm_lstateatmi_ll_stoppedatmi_ip_sockatmi_res_sockatmi_atom_mbus_initatmi_atom_mbus_getcontextatmi_mbus_sockatmi_start_lockatmi_config_lockatmi_connect_llatmi_process_commandatmi_max_connatmi_ll_connectedatmi_stop_llatmi_handle_restartatmi_ll_initatmi_startatmi_stopatmi_update_qosatmi_internal_commandifm_atm_typeqosb_find_nameqosb_inc_usepb_find_namepb_dec_usepb_getpb_delqosb_dec_useatmi_delete_phonebooktext2atmpb_add_allpb_inc_useatmi_set_dest_phonebookifm_set_typeifm_get_ll_firstatmi_find_nameatmi_get_paramsatmi_newatmi_deleteatmi_set_qosatmi_set_nameatmi_start_linkatmi_stop_linkatmi_set_wantfcsatmi_set_ulpatmi_set_mlprioatmi_set_wantencapsatmi_get_nameatmi_qos_atom_mbus_initqosb_get_first_ctdqosb_get_next_ctdctd_find_nameqosb_addqosb_delqosb_get_ctdqosb_get_dynamicctd_getctd_get_dynamicatml_aal5_mcrctd_delctd_adddynstr_getboolctd_get_firstctd_get_nextstrerrorqosb_getpb_get_aal5Profileifm_get_phys_parsbridge_if_ll_connectedbridged_timerlistbridge_if_port_freebridge_lstatebridged_ip_sockbridge_atom_mbus_initbridge_atom_mbus_getcontextbridged_config_lockbridged_process_commandbridge_atm_usb_portbridge_sys_initbridged_max_portsbridged_max_mac_intf_entriesbridged_max_mac_entriesbridge_instances_createbridge_br_newbridge_createbridge_activate_as_defaultbridged_br_set_defaultifm_get_bridge_parsifm_set_bridge_parsbridge_instance_get_by_idbridge_if_startbridge_if_stopbridged_internal_commandbridged__if_resetbridge_if_set_portstatebridge_if_new_nolockbridge_get_mac_entrybridged_mac_get_nextbridged_if_deletebridge__if_flushbridged_if_flushbridge_deletebridge_br_deletebridge_br_set_agebridge_br_get_agebridge_br_get_filterbridged_br_deletebrkeybridged_br_find_namebridged_br_get_namebridged_br_get_nextbridged_br_get_firstbridged_br_newbridged_br_is_dynamicbridged_br_set_agebridged_br_get_paramsbridged_if_find_namebridged_if_get_namebridged_if_get_firstbridged_if_get_nextbridged_if_newbridged_if_get_paramsbridged_if_is_dynamicbridged_if_set_destbridged_if_startbridged_if_stopbridged_if_set_portstatebridged_if_set_retrybridged_mac_get_firstbridged_mac_get_ifbridged_mac_get_macif_nametoindexbridge_activateigmp_proxy_atom_mbus_initigmp_proxy_atom_mbus_getcontextsys_igmp_proxy_sock_initigmp_proxy_fw_initigmp_proxy_timer_listigmp_proxy_netlink_sockigmp_proxy_raw_sockigmp_proxy_mgmt_sockigmp_proxy_config_mutexigmp_proxy_intf_timer_tickigmp_proxy_cfgnetlink_get_msgigmp_proxy_intf_addigmp_proxy_intf_deligmp_proxy_ip_addr_changesys_igmp_proxy_get_mgmt_msgsys_igmp_proxy_get_raw_msgigmp_proxy_intf_initigmp_proxy_atom_mbus_intf_notifyigmp_router_initigmp_proxy_atom_mbus_group_notifyigmp_proxy_atom_mbus_src_notifyigmp_proxy_atom_mbus_host_notifyigmp_proxy_db_initigmp_proxy_atom_mbus_mbs_src_db_notifyigmp_proxy_atom_mbus_mbs_group_db_notifyigmp_proxy_init_cfgigmp_proxy_tidigmp_proxy_mgmt_register_servigmp_proxy_intf_sync_qqi_alligmp_proxy_intf_sync_qrv_alligmp_proxy_intf_sync_mrd_adv_inter_alligmp_proxy_intf_check_running_state_alligmp_proxy_statigmp_packet_handle_msgigmp_proxy_mfc_handle_msgigmp_proxy_intf_get_by_ifindexigmp_packet_send_general_queryigmp_packet_send_mrd_terminatesys_igmp_is_intf_upsys_igmp_proxy_vif_addsys_igmp_proxy_add_membershipsys_igmp_proxy_drop_membershipigmp_proxy_intf_stop_mrdigmp_router_flush_groupsigmp_proxy_mfc_line_upigmp_proxy_fw_addigmp_proxy_mfc_updateigmp_proxy_db_subscribe_groupssys_igmp_proxy_vif_deligmp_proxy_fw_deligmp_proxy_db_unsubscribe_groupsigmp_router_validate_groupsigmp_proxy_intf_check_running_statemax_intfigmp_packet_send_mrd_adverstise__fixunsdfsiigmp_router_timer_tickigmp_proxy_intf_get_by_nameigmp_router_flush_hostsigmp_proxy_intf_config_stateigmp_proxy_get_addrigmp_router_invalidate_groupsigmp_router_lookup_groupigmp_router_update_timersigmp_proxy_resolve_intfigmp_router_add_groupigmp_router_add_hostigmp_router_update_group_versionigmp_router_is_exigmp_router_lookup_hostigmp_router_to_inigmp_router_is_inigmp_router_to_exigmp_router_allowigmp_router_blockigmp_proxy_intf_start_mrd_solicit_advsys_igmp_proxy_send_packetigmp_packet_new_queryigmp_packet_send_queryigmp_proxy_intf_get_next_upstreamfilter_mode_strssys_igmp_proxy_set_src_filterigmp_packet_send_group_queryigmp_packet_add_src_to_queryigmp_proxy_db_add_mbs_groupigmp_proxy_db_mod_mbs_groupigmp_proxy_db_add_mbs_srcigmp_proxy_db_del_mbs_groupigmp_proxy_db_update_mbs_groupigmp_proxy_mfc_deligmp_proxy_db_del_mbs_srcigmp_proxy_mfc_addsys_igmp_proxy_add_mfcsys_igmp_proxy_del_mfcigmp_proxy_intf_get_nextigmp_router_check_membershipserv_astate_getsys_igmp_proxy_mgmt_cmdigmp_proxy_set_stateigmp_proxy_intf_config_mrdigmp_proxy_intf_flush_allserv_link_addigmp_proxy_set_qiigmp_proxy_set_qriigmp_proxy_set_lmqiigmp_proxy_set_rvigmp_proxy_set_mrd_adv_intervigmp_proxy_set_mrd_init_adv_intervigmp_proxy_set_mrd_init_adv_countigmp_proxy_intf_config_versionigmp_proxy_intf_config_exp_trackigmp_proxy_intf_config_fast_leaveigmp_proxy_intf_copy2cfgigmp_router_get_groupigmp_router_get_next_groupigmp_router_get_srcigmp_router_get_next_srcigmp_router_get_hostigmp_router_get_next_hostigmp_proxy_db_get_groupigmp_proxy_db_get_next_groupigmp_proxy_db_get_srcigmp_proxy_db_get_next_srcigmp_proxy_mgmt_set_statusigmp_proxy_mgmt_get_intf_cfgigmp_proxy_mgmt_get_cfgigmp_proxy_mgmt_set_qiigmp_proxy_mgmt_set_qriigmp_proxy_mgmt_set_lmqiigmp_proxy_mgmt_set_rvigmp_proxy_mgmt_set_mrd_adv_interigmp_proxy_mgmt_set_mrd_init_adv_interigmp_proxy_mgmt_set_mrd_init_adv_countigmp_proxy_mgmt_set_require_raigmp_proxy_mgmt_flushigmp_proxy_mgmt_set_local_groupigmp_proxy_mgmt_get_next_intf_cfgigmp_proxy_mgmt_set_intf_stateigmp_proxy_mgmt_set_intf_versionigmp_proxy_mgmt_set_intf_fast_leaveigmp_proxy_mgmt_set_intf_exp_trackigmp_proxy_mgmt_set_intf_mrdigmp_proxy_mgmt_get_groupmbus_plugin_objectpath_get_atigmp_proxy_mgmt_get_next_groupigmp_proxy_mgmt_get_srcigmp_proxy_mgmt_get_next_srcigmp_proxy_mgmt_get_hostigmp_proxy_mgmt_get_next_hostigmp_proxy_mgmt_get_mbs_groupigmp_proxy_mgmt_get_next_mbs_groupigmp_proxy_mgmt_get_mbs_srcigmp_proxy_mgmt_get_next_mbs_srcigmp_proxy_mgmt_set_traceigmp_proxy_mgmt_get_statigmp_proxy_mgmt_clear_statmbus_plugin_2_mbus_errormbus_update_mutexigmp_proxy_atom_mbus_intf_notify_handle_eventigmp_proxy_atom_mbus_group_notify_handle_eventigmp_proxy_atom_mbus_src_notify_handle_eventigmp_proxy_atom_mbus_host_notify_handle_eventigmp_proxy_atom_mbus_mbs_group_db_notify_handle_eventigmp_proxy_atom_mbus_mbs_src_db_notify_handle_eventmbus_ctx_createxev_deallocmbus_ctx_init_sk_localmbus_ctx_setdatamodelmbus_invoke_registerpfm_find_owneridfwm_module_registerfwm_hook_registerigmp_proxy_mgmt_handle_msgnetlink_socketrecvmsg__cmsg_nxthdrigmp_proxy_handle_inet_msgethi_connethi_ll_connectedethi_timerlisteth_atom_mbus_initeth_atom_mbus_getcontextethi_config_lockethi_process_commandethi_stop_llethi_max_connethi_lstateethi_phy_mon_initethi_startethi_stopethi_internal_commandifm_eth_typeethi_get_nextethi_set_pvidifm_get_firstifm_get_nextethi_newethi_deleteifm_get_entryethi_find_nameethi_get_paramsethi_start_linkethi_stop_linkethi_get_nameethi_set_destethi_set_retryfgetsgetpidethi_phys_status_updateexpr_ioctlansr_int_sockansr_cfgextract_qsectionstrncatformat_ans_packetdisplay_ans_packetans_get_serverdn_expandparse_ans_packetgethostbyaddr_reqgethost_rspgethostbyname_ip_reqgethostbyname_atm_reqres_hnokdn_compdyndnsd_num_clientsdyndns_clientdyndns_groupfree_dyndns_auth_datadyndnsd_process_commanddyndns_servicedyndns_atom_mbus_initdyndns_atom_mbus_getcontextdyndnsd_config_lockdyndnsd_stophttp_retcodedyndnsd_num_servicesdyndnsd_num_hostsdyndnsd_num_groupsfree_dyndns_hostdyndns_host_headnum_dyndns_hostsnum_dyndns_groupss_dyndns_inits_noip_inits_dtdns_inits_gnudip_initdyndnsd_startdyndnsd_send_commandupdate_srv_mgr_portdyndns_find_interfacedyndnsd_set_intfdyndns_get_ifnamedyndnsd_find_hostdyndnsd_host_delete_iddyndnsd_group_get_namedyndnsd_get_paramsdyndnsd_deletedyndnsd_host_get_firstdyndnsd_host_deleteesc_asciibase64_encodextm_getnetworktimedyndnsd_register_servicemakeHexStringstrtokllist_getlengthmbus_cmddata_getatdyndnsd_newdyndnsd_delete_with_hostsdyndnsd_host_newdyndnsd_group_find_namedyndnsd_group_useddyndnsd_find_namedyndnsd_set_groupdyndnsd_srv_get_namedyndnsd_srv_get_serverdyndnsd_srv_set_serverdyndnsd_srv_get_portdyndnsd_srv_set_portdyndnsd_srv_get_requestdyndnsd_srv_set_requestdyndnsd_srv_set_update_intervaldyndnsd_srv_get_update_intervaldyndnsd_srv_set_retry_intervaldyndnsd_srv_get_retry_intervaldyndnsd_srv_get_max_retrydyndnsd_srv_set_max_retrydyndnsd_get_namedyndnsd_get_usernamedyndnsd_set_usernamedyndnsd_get_passworddyndnsd_set_passworddyndnsd_get_statedyndnsd_set_statusdyndnsd_get_errordyndnsd_get_flagsdyndnsd_set_offlinedyndnsd_set_wildcarddyndnsd_get_mxdyndnsd_set_mxdyndnsd_set_backmxdyndnsd_get_servicedyndnsd_srv_find_namedyndnsd_set_servicedyndnsd_get_interfacedyndnsd_set_interfacedyndnsd_get_hostnamedyndnsd_set_hostnamedyndnsd_get_hoststatedyndnsd_get_hostlastupdatedyndnsd_get_gid_by_hidhtonlnetlink_get_msg_rawnatd_process_commandhandle_netlink_datanatd_templ_initcwmp_getTraceLevelsslapi_connectsslapi_getiostatussslapi_complete_connectsslapi_closesslapi_sendsslapi_recvcwmp_Daemon_getMbusInfocwmp_MbusInf_getAtomCtxcwmp_lockMbuscwmp_MbusInf_getCmdcwmp_dynstr_pooldynstr_fromulongmbus_ccmd_add_setvalues_requestmbus_invoke_ccmdmbus_ccmd_cleanupcwmp_unlockMbuseqm_get_backup_flageqm_delayed_switchoverswv_errstrdisable_config_saveconfig_flushcwmp_getDaemonmbus_invoke_event_object_dirtycwmp_MbusInf_getIgdCtxcwmp_Util_mbusSaveallconfig_erasecwmp_Util_rebootcwmp_getOfflineConfigcwmp_Config_setAcsURLxtm_time_date_structcwmp_Config_setConnectionRequestPathcwmp_config_lockcwmp_informevent_lockcwmp_Tracecwmp_getTraceBuffercwmp_Client_convertClStateToStatuscwmp_atom_mbus_changeSessionStatecwmp_Util_isExistingIpAddressOnIntfcwmp_getOnlineConfigcwmp_Config_getAcsURLhl_util_getPorthl_util_getDomainNamesslapi_set_hostnamecwmp_ssl_connectsslapi_getsocknamehl_connectic_get_interfacenamecwmp_get_interfacecwmp_Config_getQosClasssslapi_socket4appsslapi_setsockoptsslapi_fcntlsslapi_setssloptcwmp_ssl_closestrncasecmpcwmp_stream_cwmpwriter_freehl_Call_freehl_Call_newhl_Call_setOutgoingDataBufferhl_Call_setWriteFunctioncwmp_ssl_sendhl_Call_setReadFunctioncwmp_ssl_recvhl_writebyteshl_readbyteshl_Call_setSocketDescriptorhl_Call_setIOTimeouthl_Call_setMethodhl_Call_setHeaderFlaghl_Call_setURIcwmp_Config_getAcsUserNamehl_Call_setUserNamecwmp_Config_getAcsPasswordhl_Call_setPasswordhl_Call_setUserAgentcwmp_stream_CwmpWriter_newcwmp_freeHttpCallmbus_invoke_get_client_writelockmbus_invoke_free_client_writelockhl_Call_Eventhl_Call_getHttpStatuscwmp_InformEvent_areEventshl_Call_getResponseContentLengthcwmp_soap_getEmptySentcwmp_soap_setStatecwmp_setCurrEnvelopesToAcshl_Call_connectionCloseNotificationhl_Call_getLocationhl_Call_getNbOfBytesIncommingDatahl_Call_getIncommingDataxml_iparsexml_iparse_donexml_iparse_initcwmp_getMaxEnvelopesToCPEcwmp_soap_setEmptySentcwmp_setMaxEnvelopesToACScwmp_Config_getConnectionTimeoutcwmp_soap_getStatecwmp_createInformRequestcwmp_closeClientSocketcwmp_stream_cwmpwriter_abortcwmp_doResolvecwmp_setConnectionTypecwmp_createClientSocketcwmp_doConnectcwmp_setUpHttpCallhl_Call_unsetHeaderFlagcwmp_Config_getAm1Terminationcwmp_soapFlushcwmp_Config_setModecwmp_Config_getModecwmp_Config_setPeriodicInformEnablecwmp_Config_getPeriodicInformEnablecwmp_Config_setPeriodicInformIntervalcwmp_Config_getPeriodicInformIntervalcwmp_Config_setUpgradesManagedcwmp_Config_getUpgradesManagedcwmp_Config_setConnectionTimeoutcwmp_Config_setNoIpTimeoutcwmp_Config_getNoIpTimeoutcwmp_Config_setMaxEnvelopescwmp_Config_getMaxEnvelopescwmp_Config_setQosClasscwmp_Config_setMaxRandomDelaycwmp_Config_getMaxRandomDelaycwmp_Util_setRuntimevarDirtycwmp_Config_setBootStrappedcwmp_Config_getBootStrappedcwmp_Config_setConnectionRequestAuthcwmp_Config_getConnectionRequestAuthcwmp_Config_setAm1Terminationcwmp_Config_setConnectionRequestThrottleNumbercwmp_Config_getConnectionRequestThrottleNumbercwmp_Config_setConnectionRequestThrottleTimecwmp_Config_getConnectionRequestThrottleTimecwmp_Config_setRequestDownloadFileTypecwmp_Config_getRequestDownloadFileTypecwmp_Config_getConnectionRequestPathcwmp_Config_getConnectionRequestUsrNamecwmp_Config_setConnectionRequestUsrNamecwmp_Config_getConnectionRequestPssWdcwmp_Config_setConnectionRequestPssWdcwmp_Config_setAcsUserNamecwmp_Config_setAcsPasswordcwmp_Config_getSoftwareVersioncwmp_Config_setSoftwareVersioncwmp_Config_getConfigurationVersioncwmp_Config_setConfigurationVersioncwmp_Config_getParameterKeycwmp_Config_setParameterKeycwmp_Config_getRequestDownloadFileTypeArgNamecwmp_Config_setRequestDownloadFileTypeArgNamecwmp_Config_getRequestDownloadFileTypeArgValuecwmp_Config_setRequestDownloadFileTypeArgValuecwmp_InformEvent_setRequestDownloadEventcwmp_InformEvent_isRequestDownloadEventcwmp_Config_getRequestDownloadTriggercwmp_Config_setRequestDownloadTriggercwmp_sendRequestDownloadEventcwmp_Config_setStateViaSrvMgrcwmp_Config_getStatecwmp_Config_setConnectionRequestViaSrvMgrcwmp_Config_getConnectionRequestcwmp_Config_setConnectionRequestPortViaSrvMgrcwmp_Config_getConnectionRequestPortdynstr_addstringcwmp_Config_getConnectionRequestURLcwmp_getInterfaceNamedynstr_getutcdatetimecwmp_Util_generateRandomPathcwmp_Config_setConnectionRequestPortcwmp_getTrcTimevsnprintfcwmp_setTraceLevelcwmp_Daemon_getcwmp_InformEvent_setDiagnosticsCompleteEventmbus_ccmd_add_subscribe_requestmbus_invoke_ccmd_subscribecwmp_Transfer_getClasscwmp_Util_saveallcwmp_loadNewConfigurationFilecwmp_Util_setTimeoutBeginTimecwmp_resetDownUploadStructcwmp_getDownUploadArgumentscwmp_setDownUploadArgumentWithNamecwmp_Util_getCurrentUtcDateTimecwmp_Upgrade_startcwmp_Download_postErrorcwmp_startDownloadcwmp_Download_postConfigcwmp_setFaultcwmp_getFaultcwmp_destroy_transfercwmp_freecwmp_Transfer_initClasscwmp_DownloaderClass_getNamecwmp_Transfer_initPoolcwmp_Download_startcwmp_event_poolcwmp_callocmemm_initpoolcwmp_InformEvent_isTransferCompleteEventllist_getobject_atcwmp_commitConfigurationcwmp_createTransferCompleteRequestcwmp_InformEvent_isBootstrapEventcwmp_getActioncwmp_Action_setSaveallcwmp_InformEvent_isValueChangedEventcwmp_commitDeviceParamscwmp_notif_flushPrintedNotificationscwmp_InformEvent_isBootEventcwmp_InformEvent_isMEventcwmp_Daemon_getMethodscwmp_RebooterClass_getNamecwmp_Daemon_removeMethodcwmp_InformEvent_isScheduledEventcwmp_scheduleInform_removeEventscwmp_createRequestDownloadRequestcwmp_communicatecwmp_XmlInfo_resetcwmp_rollBackConfigurationcwmp_Action_setInformcwmp_Transfer_cleanupcwmp_init_servcwmp_close_servSockcwmp_renew_servSockcwmp_handleServRequestcwmp_atom_mbus_initcwmp_Upgrade_initcwmp_Netlink_initSockcwmp_init_mgmtSockcwmp_diagnostics_initcwmp_notif_reloadSubscriptionscwmp_scheduleInform_initcwmp_Upgrade_waitForDaemoncwmp_InformEvent_setPeriodicEventcwmp_getRetryCountcwmp_handleMgmtRequestcwmp_Netlink_handleRequestcwmp_Config_copyConfigcwmp_Config_setSoftwareVersionNoLockcwmp_InformEvent_setValueChangedEventcwmp_Config_setConfigurationVersionNoLockcwmp_InformEvent_setBootstrapEventcwmp_Config_resetChangedFlagscwmp_InformEvent_setMEventcwmp_Netlink_openSockcwmp_Netlink_closeSockcwmp_InformEvent_copyEventscwmp_InformEvent_resetEventsdownup_setroutelabeldownup_setqoslabelcwmp_InformEvent_setTransferCompleteEventcwmp_Action_isInformcwmp_Events_processEventscwmp_Action_isRebootcwmp_Action_setRebootcwmp_Util_mbusRebootcwmp_Action_isSaveallcwmp_Action_isFactoryResetcwmp_Util_mbusFactoryResetcwmp_Util_factoryResetcwmp_printLastStatecwmp_init_lockscwmp_notif_tableInitcwmp_memm_initsslapi_register_appcwmp_Config_setDefaultConfigcwmp_initServMgrParamClientcwmp_servMgrClientCBcwmp_initServMgrParamServercwmp_servMgrServerCBxml_ctx_createcwmp_registerBodyTagcwmp_registerHeaderTagscwmp_registerFaultTagscwmp_registerInformResponseTagscwmp_registerGetRpcsTagscwmp_registerGetParamNamgesTagscwmp_registerGetParamValuesTagscwmp_registerGetParamAttribTagscwmp_registerSetParamValuesTagscwmp_registerSetParamAttribTagscwmp_registerAddObjectTagscwmp_registerDeleteObjectTagscwmp_registerDownloadTagscwmp_registerTransferTagscwmp_registerScheduleInformTagscwmp_registerCommonTagscwmp_registerTransferCompleteResponseTagscwmp_registerRebootTagscwmp_registerFactoryResetTagscwmp_registerRequestDownloadResponseTagscwmp_registerUnknownTagcwmp_Util_setUserAgentcwmp_InformEvent_setBootEventxml_ctx_destroymbus_invoke_unregistercwmp_llist_poolllist_addobjectllist_remove_byobjectcwmp_ARGroup_destroyllist_getobject_thisllist_get_nextcwmp_method_poolmemm_instanceofcwmp_Daemon_getTransfersllist_insert_sortedcwmp_Util_sendMbusCmdAddDeleteEventcwmp_Config_setStatecwmp_Config_setConnectionRequestcwmp_Client_updateIntfmemm_searchcwmp_transfer_poolcwmp_Method_destroymemm_callocdom_init_poolllist_initpooldynstr_initpoolcwmp_Event_initPoolcwmp_init_CwmpWriter_poolcwmp_Downloader_initPoolcwmp_ARGroup_initPoolcwmp_Reboot_initClasscwmp_Method_initPoolcwmp_init_poolcwmp_ARGroup_getcwmp_ARGroup_getKeyStrcwmp_Method_getcwmp_Method_getKeyStrcwmp_Daemon_getSubscriberscwmp_Daemon_getNextSubscribercwmp_Daemon_getNextMethodcwmp_ARGroup_newcwmp_Daemon_addSubscribercwmp_Daemon_removeSubscribercwmp_con_rebootercwmp_Daemon_addMethodcwmp_con_downloadercwmp_Daemon_addTransferStartTimeSortedcwmp_notification_atom_mbus_initcwmp_Method_initClasscwmp_save_methodcwmp_intTypecwmp_unsignedIntTypecwmp_booleanTypecwmp_dateTimeTypecwmp_stringTypecwmp_elem_pooldom_callocdom_con_elementdom_append_childdom_con_attributedom_print_tagcwmp_writedom_print_treedom_destroy_treecwmp_ccmd_get_attribute_valuecwmp_xsdnsdynstr_strcmpdynstr_refalloccwmp_printParamValueStructcwmp_scheduleInform_setCmdKeycwmp_Daemon_getLastAddedTransfercwmp_Daemon_getLastAddedMethodcwmp_scheduleInform_setDelaySecondsmbus_ccmd_add_getvalues_requestmbus_ccmd_add_getaccessrights_requestmbus_ccmd_add_getattribs_requeststrlist_addstringxml_register_tagdom_free_nodecwmp_setParamValuescwmp_faultStrcwmp_errorscwmp_printFaultCodeAndStringcwmp_con_eventcwmp_handleSoapEventstrtok_rcwmp_printEventDomNodecwmp_updateSoapHttpStatePrecwmp_writeSoapEnvelopeBegincwmp_notif_valuesChangedcwmp_attr_poolcwmp_InformEvent_getNbOfEventscwmp_scheduleInform_nbWaitingcwmp_eventStructStrcwmpnscwmp_InformEvent_isPeriodicEventcwmp_InformEvent_isConnectionRequestEventcwmp_InformEvent_isDiagnosticsCompleteEventcwmp_scheduleInform_printEventscwmp_formatStrictISO_UTCdateTimecwmp_notif_nrOfWaitingNotificationscwmp_paramValStructStrcwmp_notif_printWaitingNotificationscwmp_writeSoapEnvelopeEndcwmp_updateSoapHttpStatePostcwmp_handleSoapErrorcwmp_Events_checkEventscwmp_addSuppRpccwmp_getRPCsmbus_ccmd_add_getnames_prequestmbus_ccmd_add_getcount_requestcwmp_setParamCountmbus_ccmd_add_getnames_requestcwmp_handleErrorcwmp_paramInfoStructStrcwmp_sendOppCompletedEventcwmp_getParamNamescwmp_printParamValuesListcwmp_getParamValuescwmp_soap_getStatuscwmp_soap_setStatuscwmp_soap_getBeginSentcwmp_soap_setBeginSentcwmp_printAllFaultDetailsxml_get_attrcwmp_Config_parameterKeyCommitmbus_cmddata_geterrorstringllist_addlistcwmp_ARGroup_comparatorcwmp_notif_getNotificationTypecwmp_getParamAttribsllist_enum_dynstrdynstr_fromstrlistcwmp_notif_addNotificationcwmp_notif_tableCommitcwmp_notif_tableRollbackcwmp_setParamAttribscwmp_scheduleInform_addcwmp_scheduleInformmbus_ccmd_add_delobject_requestmbus_ccmd_add_addobject_requestcwmp_addObjectcwmp_delObjectcwmp_Downloader_getClasscwmp_soap_getSubStatecwmp_Daemon_setLastAddedMethodcwmp_rebootcwmp_Action_setFactoryResetcwmp_factoryResetcwmp_Daemon_setLastAddedTransfercwmp_downloadcwmp_responsexml_register_tag_unknowncwmp_resetNbOfRetriescwmp_soap_isSupportedcwmp_soap_setSubStatecwmp_uploadcwmp_factoryresetcwmp_checkSoapStatecwmp_InformEvent_setScheduledEventcwmp_scheduleInform_activeCcmdcwmp_scheduleInform_statusChangedmbus_client_add_filter_to_ccmddynstr_fromlong__ctype_b_locdynstr_addstring_sizecwmp_util_setTokenBucketTimecwmp_util_setTokenBucketNumberstrstrcasehl_Authentication_freehl_Authentication_newhl_Auth_setTypehl_Auth_createNoncehl_Auth_setNoncehl_Auth_setQophl_Auth_setRealmhl_Auth_setMethodhl_Auth_setPasswdhl_Auth_setUsrNamehl_Auth_getTypehl_Auth_setAuthorizationParamshl_Auth_checkDigestAuthenticationhl_Auth_setResponsehl_Auth_checkBasicAuthenticationcwmp_util_requestTokencwmp_InformEvent_setConnectionRequestEventcwmp_sendConnectionRequestEventhl_Auth_getRealmhl_Auth_getNoncehl_Auth_getQopcwmp_util_initTokenBucketcwmp_stream_cwmpwriter_flushprintHeaders_servercwmp_vendorerrorscwmp_stream_CwmpWriter_poolidcwmp_unknown_timecwmp_save_transfercwmp_argroup_poolcwmp_getAtomCtxcwmp_upgradeImageStrcwmp_upgradeStrcwmp_enableStrcwmp_errorStrcwmp_errorCodeStrcwmp_errorDescStrcwmp_keyStrllist_pushobjectcwmp_urlStrcwmp_userNameStrcwmp_passwordStrcwmp_statusStrcwmp_save_notifsxml_iparse_finish__assertmbus_ccmd_add_unsubscribe_requestcwmp_delNotificationcwmp_object_event_rule_add_delcwmp_getNextNotificationcwmp_notificationGetByIDcwmp_notificationLockTablecwmp_notificationUnlockTablecwmp_getNotificationllist_split_atcwmp_printHackParamValuesListcwmp_object_event_NParam_add_delllist_get_atcwmp_newWaitingNotificationcwmp_getNextWaitingNotificationllist_getindex_byobjectmbus_plugin_handle_required_paramscwmp_forceAddNotificationcwmp_notif_save_rulescwmp_notif_save_nParamscwmp_nameStrcwmp_valueStrcwmp_xsinscwmp_codeStrcwmp_stringStrcwmp_commandKeyStrcwmp_informcwmp_soapnscwmp_arrayTypecwmp_statuscwmp_transferCompletecwmp_startTimeStrcwmp_completeTimeStrcwmp_soapenvnscwmp_faultStrLowercwmp_fileTypeArgStrcwmp_fileTypeStrcwmp_requestDownloadcwmp_argStructStrcwmp_argStructNameStrcwmp_argStructValueStrcwmp_atom_mbus_acc_TraceLevelcwmp_atom_mbus_acc_Namecwmp_atom_mbus_acc_Keycwmp_atom_mbus_acc_StartTimecwmp_atom_mbus_acc_CompleteTimecwmp_atom_mbus_acc_FaultCodecwmp_atom_mbus_acc_FaultStringcwmp_ARGroup_atom_mbus_acc_Groupcwmp_atom_mbus_acc_SoftwareVersioncwmp_atom_mbus_acc_ConfigurationVersioncwmp_atom_mbus_acc_BootStrappedcwmp_atom_mbus_acc_ParameterKeycwmp_atom_mbus_acc_AcsURLcwmp_atom_mbus_acc_AcsUserNamecwmp_atom_mbus_acc_AcsPasswordcwmp_atom_mbus_acc_Interfacecwmp_atom_mbus_acc_Statecwmp_atom_mbus_acc_Statuscwmp_atom_mbus_acc_Modecwmp_atom_mbus_acc_PeriodicInformEnablecwmp_atom_mbus_acc_PeriodicInformIntervalcwmp_atom_mbus_acc_PeriodicInformTimecwmp_atom_mbus_acc_ConnectionTimeoutcwmp_atom_mbus_acc_NoIpTimeoutcwmp_atom_mbus_acc_MaxEnvelopescwmp_atom_mbus_acc_ConnectionRequestcwmp_atom_mbus_acc_ConnectionRequestPortcwmp_atom_mbus_acc_ConnectionRequestPathcwmp_atom_mbus_acc_ConnectionRequestUsrNamecwmp_atom_mbus_acc_ConnectionRequestPssWdcwmp_atom_mbus_acc_ConnectionRequestAuthcwmp_atom_mbus_acc_ConnectionRequestThrottleNumbercwmp_atom_mbus_acc_ConnectionRequestThrottleTimecwmp_atom_mbus_acc_QosClasscwmp_atom_mbus_acc_MaxRandomDelaycwmp_atom_mbus_acc_ConnectionRequestURLcwmp_atom_mbus_acc_UpgradesManagedcwmp_atom_mbus_acc_Am1Terminationcwmp_atom_mbus_acc_RequestDownloadFileTypecwmp_atom_mbus_acc_RequestDownloadFileTypeArgNamecwmp_atom_mbus_acc_RequestDownloadFileTypeArgValuecwmp_atom_mbus_acc_RequestDownloadTriggerhandle_cpe_confighandle_cpe_runtimevarhandle_cpe_cmdcwmp_notif_cmdshandle_traceconfighandle_server_configtp_type_cencstring_nametp_type_encpasswd_namecwmp_stream_cwmpwriter_put_blockrad_Daemon_getLockrad_Daemon_getConfigrad_atom_mbus_acc_Startrad_atom_mbus_acc_Portrad_atom_mbus_acc_Timeoutapptimer_stopapptimer_createapptimer_startrad_Daemon_getSrvMgrrad_SrvMgr_getIdrad_SrvMgr_getSecIdrad_atom_mbus_acc_RandomPortrad_atom_mbus_acc_Securerad_atom_mbus_acc_Moderad_atom_mbus_acc_RandomPasswordrad_Util_generateRandomPasswordrad_AtomMbClient_updateUserrad_Config_getInterfacerad_AtomMbClient_retrieveIpAddressifm_get_default_internet_connectionrad_Daemon_setPubIprad_Daemon_getPubIprad_Config_setUrlrad_SrvMgr_resetrad_AtomMbClient_retrieveInterfaceNamerad_Daemon_getIntfNameserv_acl_intf_addserv_map_addrad_SrvMgr_deleteOwnPortMaprad_SrvMgr_getHttpIdrad_atom_mbus_acc_Statusrad_Daemon_startTimerNoLockapptimer_deleterad_Daemon_stopTimerNoLockrad_AtomMbClient_removeUserrad_Config_setUserrad_AtomMbClient_saverad_Daemon_getrad_Memm_initrad_con_srvmgrrad_con_configrad_con_mbusinfrad_SrvMgr_initrad_Config_initrad_Daemon_getMbusInforad_MbusInf_initrad_AtomicMbPlugin_initrad_Config_getUserrad_Config_getDaemonrad_Daemon_enableNoLockrad_Daemon_disableNoLockrad_MbusInf_setErrorrad_AtomMbClient_checkUserGrouprad_MbusInf_getErrorrad_Daemon_getElapsedTimeSecrad_dynstr_poolserv_map_getfirstserv_map_deleteserv_map_getnextserv_acl_ip_getfirstserv_acl_ip_deleteserv_acl_intf_getfirstserv_acl_intf_deletembus_cmddata_poolidrad_atom_mbus_acc_Grouprad_MbusInf_getCtxrad_Daemon_setIntfNamerad_Config_getGrouprad_MbusInf_getCmdrad_Config_getPasswordsys_randomrad_Config_setPasswordrad_atom_mbus_acc_URLrad_atom_mbus_acc_ElapsedTimerad_atom_mbus_acc_Interfacerad_atom_mbus_acc_Userrad_atom_mbus_acc_Passwordrad_atom_mbus_acc_EnablepvtGetSynTreeemEncodeemDecodeq931InstallperConstructperDestructbbGetAllocationSizebbSetBytebbAlignBitsmemcpybbbBitsInUsebbDelTailpvtGetpstGetTagH32xLogGetRvMemoryFreeRvThreadGetVarRvMemoryAllocRvThreadSetVarRvThreadDeleteVarbbAddTailbbConstructFromperEncodeLenbbMovebbOctetsbbSetpstGetNodeTypepstGetNodeRangeExtpstGetIsOpenTypepstGetIsExtendedperEncodeIntperEncodeBoolperEncodeCharStringperEncodeOctetStringperEncodeBitStringperEncodeOIDperEncodeChoiceperEncodeSequeceperEncodeSequeceOFperEncodeCompleteperEncodeOpenTypepstGetTypeFromConstraintpstGetConstrainingFieldpstGetChildpvtFindObjectpstGetFieldOfObjectReferenceperDecodeLenpvtAddperDecodeIntperDecodeBoolperDecodeCharStringperDecodeOctetStringperDecodeBitStringperDecodeOIDperDecodeChoiceperDecodeSequeceperDecodeSequeceOFRvLogSourceConstructrvPerLogSourcervPerErrLogSourceemSetEncodingRvThreadCreateVarRvLogSourceDestructperBufferEndbbSetOctetsperEncNodebbBytesInUsepstGetFieldExtperDecNodepstGetNodeRangepvtGetStringpvtGetBitStringbbFreeBytesbbGet2LeftpvtSetpvtChildpstGetNumberOfChildrenpstGetFirstExtendedChildperEncodeNormallySmallIntpvtGetChildpstChildIsSpecialpstChildIsExtendedperDecodeNormallySmallIntpstGetChildExtpstGetFROMStringPtrperEncodeNumberperDecodeNumberpvtBrotherpstGetBrotherExtpstGetNumberOfOptionalBeforeExtensionpvtNumChildspstGetNodeOfIdperEncodeSemiConstIntbbGet2RightperDecodeSemiConstIntbbFreeBitsbbAddTailFromrtDestructrpoolDestructRvCBaseEndRvCBaseInitciEstimateCfgSizeciDestructrpoolConstructciBuildRTreeciConstructExciOutputRTreertRootrtHeadrtGetByPathrtBrotherrpoolChunkSizerpoolCompareExternalrpoolCopyToExternalciIsBitStringciGetValueExtciGetBitStringDatartNextrtParentrpoolAllocCopyExternalrtAddTailrtAddBrotherrpoolFreerpoolAllocrpoolCopyFromExternalciBuildBitStringciSetValuertDeleteciTargetBufferSizeciPrepareTargetBufferciGetModuleDirectoryFileNameciCreateVirtualFileSourceciEstimateCfgSizeVirtualFileciBuildFromVirtualFileinterfacesrtAddRoot__ctype_toupper_locchrn2bmpoidEncodeOIDRvAddressConstructRvAddressSetStringRvAddressGetIpv4RvAddressIpv4GetIprpoolCompareInternalstGetNodeDataByNodeIdpstGetTokenNamepstGetTagClassNamestGetNameByNameIdpstPrintNodestGetNameIdByNamepstGetRootisNumberpstGetFieldIdstGetChildByNodeAndFieldNamestGetNodeIdByNamestGetNameIdByNodeIdpstGetNodeIdByPathstGetChildByIndexRvBsearchfmt2NameComparestGetBrotherstGetChildByIndexUnboundedpstSearchrpoolAllocCopyInternalrtCurSizertSetCompareFuncpvtNodeComparepvtDestructrtSetPrintFuncvtNodePrintrtGetRootrtMaxUsagertMaxSizerpoolStatisticsrtTreeSizertNumChildspvtParentrtAddrtAddChildspvtDeleteDbgrtDeleteChildsrtClearrpoolClearrtSetrtMovertAdoptChildpstIsStringNodestGetNameByNodeIdpstGetFieldNamePtroidDecodeOIDrtGetChildrtIndexpvtDeletertAddHeadpvtAddRootFromIntpstAreNodesCongruentpvtSearchPathpstGetFieldpvtGetNodeIdByPathpvtGetByIndexpvtGetNodeIdByFieldIdsrtPrintpvtPrintInternalpstGetValueTreeStructstGetFirstValueNodepstGetValueNodeStructrtCompareTreespstFindObjectInATpvtAddChildspvtCompareTreepvtAdoptChildpvtAddTreeemaLockraConstructraCurSizeraDestructraClearraAddraGetByPtremaUnlockraDeleteemaMarkemaReleaseemaPrepareForCallbackemaReturnFromCallbackraMaxSizeraElemIsVacantraGetNextraGetStatisticsraAddWatchdogResourceH32xLogInithashDefaultFunchashDefaultComparehashFindRvWatchdogDeleteResourceRvWatchdogAddResourceraElemSizeraFreeSizeraMaxUsageraElemRequestedSizeraSetCompareFuncraSetPrintFuncrtTailraFCompareraGetPrintFunc__ctype_tolower_locciIDBufferciEstimateCfgSizeBufferciBuildFromBufferciOutputToBufferciIDVirtualFileciOutputToVirtualFileciIDFileciEstimateCfgSizeFileciBuildFromFileciOutputToFileaddrIntoHashKeycmCompareTransportAddresseshashConstructhashDestructhashAddhashDeletehashGetElementautoRasStartAltGKscmiGetAutoRasHandlecmiAutoRASEPStartcmiAutoRASCallStartautoRasStopAltGKsautoRasIsInSearchautoRasGotPermListautoRasGetCurrentAltGkNodeautoRasRemovePermListemaGetUserDatarasUpdateGkRasAddressautoRasChangeStateautoRasResetSearchpvtGetByFieldIdscmRASGetParampvtAddRootcmTAToVtautoRasSetPermListcmiGetRasHandlecmiRASUpdateRegInfopvtGetChildByFieldIdpvtSetTreeqsortAltGKSortcmiGetByAutoRasemaGetInstanceRvH323TimerClearcallDialcmRASCloseRvH323TimerCancelcmRASStartTransactioncmRASSetParamcmiRASGetRequestcmiRASSetTrEventHandlerautoRasSendAftRegcmRASRequestautoRasGetNextAltGkNodecmVtToTAautoRasRegAndSendcmiRASGetResponseautoRasCallSendToNextGKautoRasCallIdleStatecmRegisterautoRasRegAndSendAftDisccmiRASGetEndpointIDautoRasDiscRegAndSendcmiGetAutoRascmRASConfirmautoRasSetTempListsetRasAlternateGatekeepercmiRASSetCallTrEventHandlerautoRasCallTransactionRvH323TimerStartWithTypeautoRasIrrTimeoutemaWasDeletedcmiAutoRASCallSetUnsolicitedIRRcmSetupEndcmRegister2cmCallGetParamcmCallGetOrigincmCallSetParamautoRasAdmissionResponseautoRasBandwidthResponseautoRasDisengageResponsevoipMbusGetValuevoipMbusSetValueget_voipCfgrasIsValidMulticastIndexrasCfgGetTimeoutrasCfgGetRetriescmGetPropertyautoRasRemoveTempListrasSwitchMulticastParamsrasResetMulticastIndexpvtMoveTreepvtBuildByFieldIdscmUnregistercmiRASGetHAPPrasUpdatePartUnregcmiRASSetEPTrEventHandlercmiGetByControldummyControlSessioncmTransSendMessageaddFastStartsendMessageemaGetApplicationHandlesendMessageForH245cmTransGetHAppcmTransGetHostParamcmTransCloseHostcmCallPreCallBackcmEmDecodeaddStatisticgetEncodeDecodeBuffercmProtocolGetProtocolcmEmEncodeoidDecodeOIDIntcmiGetQ931q931ProcessMessagecmiGetIsControlcmiGetControlh245ProcessIncomingMessagecmCallSimulateMessageq931DecodingFailurestopControlcloseChannelscmiStartControlTimerscmiStopControlTimersq931CallCreateRvH323UniqueIdGeneratorGetcmLockcmUnlockcmTransCreateSessionpvtGetSyntaxIndexemaAddclearControlfastStartCallInitcmiAutoRASCallCreatecallInitParametersq931CallFacilityq931CallProgressq931CallNotifycatDeletecmTransCloseSessioncallEndParametersdeleteFastStartcmiAutoRASCallClosedropControlq931CallCloseemaDeletedropRascmCallClosecontrolGetStatenotifyControlStatecmTransTryControlAfterACFcmTransSetSessionParamq931CallDropcmTransDropgetParamFieldNamereleaseCompleteReason2CauseValuecmCallDropcallStartErrorcmGetGKCallSignalAddresscallNewRateRvHostLocalGetNameq931CallAnswerq931CallAcceptcallGetMessagecmTransGetSessionParamcmiAutoRASGetEndpointIDq931CallDialinitControlcmiSetIsControlcmiSetIsFastStartFinishedcmiReportControlstartControlcallObjectCreatecatAddcmTransSetAddresscmTransQ931ConnectcatFindcatGetCallHandlecatUpdatecmiAutoRASGetRegStatecmiAutoRASCallDialcallStartOKcmCallGetNumOfParamscmTransSetH450ElementcmCallDialcallStopOKcmiAutoRASCallDropq931CallCallProceedinganalyzeFastStartMsgcmFastStartReplycmcReadyEventcmCallStatusMsg2StructcmCallDeleteParamcmTaHasIpq931GetCallStatesendCallMessagecallReleaseMessagecallObjectCreateFromMessageemaSetApplicationHandlecallSetMessageq931SimulateSetupq931CallStatusEnquiryq931CallMoreInfoq931CallInfoq931CallAddressCompletecmCallAddressCompletecmFastStartChannelsReadycmTransSendH450MessagecmCallSendCallProceedingsetNonStandardParamcmTransSendTunneledMessagegetNonStandardParamRvAddressSetIpPortRvH323CoreToCmAddressgetIPRvH323CmToCoreAddressRvAddressCompareutlChr2BmpcmGetDelimitercmCallSetAddressesFromStringsutlBmp2ChrgetIPLengthcmGetAHandleRvAddressGetStringRvAddressGetIpPortcmCallAnswercmCallAnswerExtcmGetRASConfigurationHandlecmiAutoRAScmiAutoRASCallSetRatecmCallOverlapSendingExtstrspncmCallFacilitycmCallMasterSlaveStatuscmCallGetMcTransportAddressciNextciGetStringciGetBitStringpvtBuildByPathcmTransGetGoodAddressForH245getGoodAddressForCallcmTransCreateControlSessioncmTransHasControlSessioncmTransCloseControlSessionendControlcmTransEstablishControlcmTransSwitchToSeparatecmTransSetHostParamemaConstructemaDestructcmiGetChannelListForCallcmiSetChannelListForCallRvMemoryGetInfoRvThreadCurrentRvThreadConstructFromUserThreadRvThreadSetNameRvThreadDestructH32xLogEndcmEmGetCommonSyntaxpstConstructpvtLoadFromConfigRvAddressConstructIpv4pstDestructpvtAddRootByPathcmLTAToVtcmTransStartutlEncodeOIDcmiRASUpdateCallSignalingAddressRvRandomGeneratorGetValuerasStartH245StartcmTransStoprasStopH245StopH245SetH225CallEventHandlerRvThreadFindVarseliInitseliEndendParamSyntaxRvTimerCancelcmStopRvWatchdogPrintfastStartEndH245EndrasEndcmTransEndcmiEndCallsRvH323TimerDestructcatDestructRvPortRangeDestructmibDestroyStatisticRvH323UniqueIdGeneratorDestructRvWatchdogEndencodeDecodeBufferEndcmiDestroyLogcmShutdowncmStartUpcmiCreateLogRvSelectGetThreadEngineRvTimestampGetRvRandomGeneratorConstructRvH323UniqueIdGeneratorConstructciConstructciGetValueRvWatchdogAllocatemibCreateStatisticRvPortRangeConstructRvH323TimerConstructcmEmInstallcmEmGetQ931SyntaxcmEmGetH245SyntaxinitParamSyntaxpvtConstructcmiInitCallsencodeDecodeBufferInitcmTransInitcmTransSetSessionEventHandlercmTransSetHostEventHandlercatConstructrasInitemaAddWatchdogResourcecmiGetWatchdogHandleRvWatchdogInitRvSelectGetTimeoutInfoRvTimerStartH245InitfastStartInitcmStartcmInitializeRvH323TimerStatisticspvtMaxSizepvtMaxUsagepvtCurSizecmTransSetHostApplHandlecmTransGetHostApplHandlecmiGetByQ931cmIndicatepvtGetChildTagByPathq931Setupq931CallProceedingq931Connectq931Alertingq931ReleaseCompleteq931Statusq931Facilityq931StatusEnquiryq931Progressq931SetupAcknowledgeq931Informationq931NotifycmTransHostSendRawMessagecmTransHostSendMessagecmGetRASConnectionHandlerasEncodeAndSendemaGetTypeRvFdGetSocketRvSocketSetTypeOfServicecmVtToLTAgetCallPropertycmiRASGetPropertygetStatisticcommonasnGetSyntaxq931asn1GetSyntaxaliasToVtpvtShiftTreegetEnumNameIdcmGetParamvtToAliasgetEnumValueByNameIdcleanMessagecmEmEncodeTolerantcmiGetChannelListForCtrlemaGetNextchannelTimeoutEventsHandlercloseHostInternaldelCallfindHostInHashcreateHostByTypesetRemoteAddressannexEGetLocalAddresstpktGetAddressestpktRecvNotifytransQ931HandlertransH245HandlercmTransCreateHostRvH323HaAcceptHandlertpktOpentpktConnectcallStartRoutecallIncompleteAddressrasCallDropemaGetByIndexRvSocketSendBufferRvSocketReceiveBuffercmiRASReceiveMessagecmiRASInitializehandleAutoRasEventcmiAutoRASInitcmiRASSetSendEventHandlercmiRASSetNewCallEventHandlercmEvRASNewCallRvAddressIsMulticastIpRvAddressGetTypeRvSocketConstructRvSocketSetBlockingRvSocketBindRvSocketDestructRvSocketSetBroadcastRvSocketSetBuffersRvSocketSetMulticastTtlRvHostLocalGetAddressRvAddressCopyRvSocketSetMulticastInterfaceRvSocketJoinMulticastGroupRvSocketGetLocalAddressRvFdConstructRvSelectAddRvRasSelectCbcmiRASStartcmiAutoRASStartRvSelectRemoveRvSocketShutdownRvFdDestructcmiRASStopcmiRASEndcmiAutoRASEndemaClearRvH323WatchdogGetResourcepvtGetByPathcmNonStandardParameterCreatecmNonStandardParameterGetRvAddressIpv4ToStringcondenseIpTo32bitRvThreadSetAutoDeletechr2bmpbmp2chrcmEvTransNewSessioncmEvTransConnectionOnSessionClosedcmEvTransSessionNewConnectioncmEvTransNewMessagecmEvTransBadMessagecmEvTransGetMessageNodecmEvTransNewH450MessagecmEvTransNewAnnexMMessagecmEvTransNewAnnexLMessagecmEvTransWantsToStartControlcmEvTransTunnelingWasRejectedcmEvTransHostConnectedcmEvTransHostClosedcmEvTransNewRawMessagecmEvTransSendRawMessagecmEvTransHostListencmEvTransHostListeningcmEvTransHostConnectingRvH245TimerStartEvRvH245TimerCancelEvRvH245TimerClearEvsendMessageForH245ChancmCallInAnsweringStatecmCallHasControlSessioncallMibGetSessionmsdGetMibParamstcsGetMibParamstcsGetMibProtocolIdchanGetMibParam__divdi3RvClockGetmtimerEndmtimerSetmtimerResetRvSelectConstructRvSelectDestructcmiGetWatchdogLogSourceRvWatchdogNextResourceRvWatchdogGetResourceRvSelectWaitAndBlockseliSelectUntilRvSelectFindFdRvSelectUpdateRvSelectSetMaxFileDescriptorsRvSelectGetMaxFileDescriptorsRvSelectGetSelectFdsRvTimerQueueNextEventRvSelectHandleSelectFdsRvTimerQueueServicerasOutgoingHashFuncrasIncomingHashFuncrasIncomingHashComparerasDecoderInitrasGarbageCollectionrasDecoderEndrasDecodePartrasRouteMessagerasCreateOutTxrasSetParamrasSetIrrFieldsrasCloseOutTxrasGetParamrasGetNumOfParamsrasSendRequestMessagerasDummyRequestrasSendConfirmMessagerasSendRejectMessagerasSendRIPrasCloseInTxcmGetLocalCallSignalAddresshashGetKeyrasDecodeAndRecvrasMessageInforasCreateCatKeyrasUpdateRegInforasRetransmitrasHandleReplycmiGetCatForCallcatGetUnsolicitedIRRrasHandleTxResponserasHandleRequestcmIsRoutedCallcatSetUnsolicitedIRRRvAddressStringToIpv4set_voipCfggetNonStandardsetNonStandardcmiGetRasHooksrasHandleIrrfree_resourcesannexEEventdel_all_nodesannexEStopdel_nodeunblock_res_blocked_nodesfree_pdustart_retransmit_or_ima_timersend_pduget_next_seqnhton24send_current_pduannexEGetLocalAddressIndexget_nodeadd_nodehton32hton16send_payloadget_ima_intervalremote_host_is_aliventoh24is_old_seqnsend_ackcheck_pdui_am_alive_request_receivedack_receivedsend_nack6ntoh16ntoh32use_alternate_portstatic_type0_is_not_supportedretransmit_or_ima_timer_eventsend_nack3send_nack5send_nack4process_pduisSameAddresshashFindNexthashDoAllremove_one_nodeget_retransmit_intervalremote_host_is_deadsend_imarpoolGetPtremaDoAllRvSocketListentpktEventRvSocketConnecttpktCloseRvSocketAcceptrpoolRealloctpktSocketRecvTcpRvSocketGetRemoteAddressextractMessageFromPoolcreateMessageneedToOpenH245connectH245sendStartH245FacilitygetGoodAddresstransH245AcceptHandlervoipServiceDisableDynamictpktGetSocketPortvoipServiceEnableDynamicreportH245EstablishmentemaGetIndextransHostClosegarbageCollectMultiplexHostupdateHostMultiplexStatustpktIsConnectedsolveH245ConflicttransReportConnectzeroTimerEventtpktSendFromRpoolannexESendMessagemoveMessagesFronSessionToHostsendMessageOnHosttpktRecvIntoRpooldecodeIncomingMessagegetMultiplexedParamssetTheFastStartStateByMessagesetTheTunnelingStateByMessagesetTheParallelTunnelingStateByMessagedetermineIfToOpenH245reportH245extractH245MessagesextractH450MessagesextractAnnexMMessagesextractAnnexLMessagescanWeAcceptTheCallfindSessionByMessagedetermineWinningHostsendReleaseCompleteMessageprocessQ931IncomingMessageinitiateTunnelingFacilitytransQ931AcceptHandlerannexESetProtocolParamsannexEAddLocalAddressannexEStartannexEEndtpktEndtpktInitannexEInitannexESetEventHandlerh245GetSyntaxemaGetStatisticstransSessionClosesendGeneralFacilitytpktGetConnectionsetQ931HostsetLocalAddressForQ931setAddressForH245HostsetRemoteAddressForQ931transHostConnectprocessOutgoingMessagetransEncodeMessagesaveMessageToPooladdSessionToPendingListencodeAndSendsendRawMessageremoveSessionFromPendingListnotifyPendingSessionsannexECloseNodesetMultiplexedParamsinsertH245TunnelingFlaginsertH245TunneledMessagesinsertH450TunneledMessagesinsertAnnexLTunneledMessagesinsertAnnexMTunneledMessagesprocessQ931OutgoingMessageprocessH245OutgoingMessagecmGetH225RemoteVersionannexEEvNewMessageannexEEvConnectionBrokenannexEEvUseOtherAddressannexEEvWriteablessiAPIEnterssiAPIExitmlistConstructmlistDestructh450asnGetSyntaxssiInitSynTreesssiEndSynTreesssiGetTableIndexssiGetTableEntrymlistNextssiRemoveServiceFromCallmlistDeleteElementssiGetCallRoleForStrmlistAddElementmlistInsertssiRemoveCallFromServicessiGetTableEntryByIndexssiClearPendingPrimitivesssCallDecodeMessagessCallProcessMessagessiGetSynTreeByRootNamessiNotifyIndicationssiNotifyConfirmssiGetNewServiceCMN_InitServicessiGetInvokeIdssiBuildMsgWithInvokeAPDUssiGetCallByRolessiNewMessageToSendssiGetCallRolessiBuildMsgWithRetResultAPDUssiBuildMsgWithRetErrorAPDUssiBuildMsgWithRejectAPDUssGetSynTreeByRootNamessiNotifyReleaseCallssiCheckCallByRolessServiceGetCallCC_InitServiceCDO_InitServiceCDR_InitServicessiCDO_recvInvokeCDS_InitServiceCDSI_InitServicessiCDI_recvInterrogateRespssiCDD_recvDeactivateRespssiCDA_recvActivateRespssiCDSI_recvInvokessiCDSI_recvResponseCDF_InitServicessiCDR_sendInvokessiCDSI_EvCDT1ExpiredssiCDSI_sendCallReouteInvokessiCDS_EvCDT5ExpiredssiCDI_EvCDT4ExpiredssiCDI_sendInvokessiCDD_EvCDT3ExpiredssiCDD_sendInvokessiCDA_EvCDT2ExpiredssiCDA_sendInvokessiCDS_sendResponsessiCDS_sendInvokessiCDF_sendResponsessiCDF_recvInvokessiCDF_sendInvokessiCDS_recvInvokessiCDS_recvCheckRestRespssiCDR_prepareLegInfo4ArgssiCDR_prepareLegInfo2ArgssiCDR_prepareLegInfo1ArgssiCDR_sendResponsessiCDR_reroutessiCDR_recvInvokeHDSE_InitServicessiHGSE_recvRemoteHoldRespssiHGSE_recvRemoteRetrieveRespssiHGSE_EvCHT1ExpiredssiHGSE_EvCHT2ExpiredssiHGSE_sendNotificInvokessiHGSE_sendRemoteInvokessiHDSE_recvNotificInvokessiHDSE_recvRemoteInvokessiHDSE_sendReturnResultssiHDSE_sendReturnErrorssiHDSE_sendRejectCIB_InitServiceCIC_InitServicessiCI_EvCIT4ExpiredssiCI_EvCIT2ExpiredssiCI_EvCIT3ExpiredssiCI_EvCIT1ExpiredssiCIA_SendIntrusionInvokessiCIA_SendIsolatedInvokessiCIA_SendForcedReleaseInvokessiCIA_SendWOBInvokessiCI_EvCIT6ExpiredssiCIA_RecvNotificationInvokessiCIA_recvIntrusionRespssiCIA_recvForcedReleaseRespssiCIA_recvIsolateRespssiCIA_recvWOBRespssiCI_EvCIT5ExpiredssiCIB_sendNotificationInvokessiCIB_SendIntrusionRespssiCIB_MakeIntrusionssiCIB_sendGetCIPLInvokessiCIB_recvIntrusionInvokessiCIB_recvForcedReleaseInvokessiCIB_recvIsolationInvokessiCIB_RecvWOBRequestInvokessiCIB_RecvGetCIPLRespMWIMC_InitServiceMWISER_InitServicessiMWISER_recvInvokessiMWISER_recvResponsessiMWIMC_recvInterrogateInvokessiMWIMC_recvResponsessiMWISER_EvMWIT2ExpiredssiMWIMC_EvMWIT1ExpiredssiMWISER_sendInvokessiMWISER_sendResponsessiMWIMC_sendInvokessiMWIMC_sendResponseNIE_InitServicessiNIE_recvInvokessiNIE_sendInvokeCO_InitServicessiCO_EvTCWExpiredssiCO_sendCOSetupInvokessiCO_sendRemoteUserAlertingInvokessiCO_sendCWwaitingInvokessiCO_sendCOCfbOverrideInvokessiCO_recvCallOfferRequestInvokessiCOrecvCfbOverrideInvokePRKD_InitServicePRKT_InitServicessiPRKG_recvRequestRespssiGPSRV_recvIndOnRespssiGPSRV_recvIndOffRespGPMEM_InitServicessiPKUP_EvCPT8ExpiredssiPKUP_recvPickExeInvokessiPKUP_recvRequRespssiPRKD_EvCPickupExpiredssiGPSRV_EvCPT5ExpiredssiGPSRV_EvCPT4ExpiredssiGPSRV_sendGrpIndOnInvokessiGPSRV_sendGrpIndOffInvokessiPKUP_EvCPT7ExpiredssiPRKD_EvCPT2ExpiredssiPRKD_EvCPT10ExpiredssiPRKG_EvCPT1ExpiredssiPRKG_sendRequestInvokessiGPMEM_sendIndRespssiGPMEM_recvIndInvokessiPKUP_sendPickExeRespssiPKUP_sendPickrequInvokessiPRKT_EvCPT3ExpiredssiPRKT_sendSetupRespssiPRKD_sendRequestRespssiPRKD_recvRequestInvokessiPRKD_recvPickupInvokessiPRKD_recvSetupRRssiPRKD_recvPickExeRespssiPRKD_recvSetupRessiPRKD_sendPickupRespssiPRKD_sendSetupInvokessiPRKD_sendPickExeInvokessiPRKT_sendPickrequRespssiPRKT_EvCPT9ExpiredssiPRKT_EvCPT6ExpiredssiPRKT_sendPickupInvokessiPRKT_recvSetupInvokessiPRKT_recvPickrequInvokessiPRKT_recvPickupRespTRDSE_InitServicessiChangeCallRoleTRTSE_InitServiceWDSE_InitServicessiWGSE_EvTCWExpiredssiWGSE_sendWaitingInvokessiWDSE_recvWaitingInvokessiWDSE_recvRemoteUserAlertInvokessServiceClosessServicePrimitiveTRGSE_SelectTRGSE_ProcessQ931MsgTRGSE_ProcessMessageTRGSE_ProcessRequestTRGSE_InitServiceTRGSE_EndServiceTRDSE_OptSelectTRDSE_SelectTRDSE_ProcessQ931MsgTRDSE_ProcessMessageTRDSE_ProcessRequestTRTSE_OptSelectTRTSE_SelectTRTSE_ProcessQ931MsgTRTSE_ProcessMessageTRTSE_ProcessRequestCDA_SelectCDA_ProcessQ931MsgCDA_ProcessMessageCDA_ProcessRequestCDA_InitServiceCDD_SelectCDD_ProcessQ931MsgCDD_ProcessMessageCDD_ProcessRequestCDD_InitServiceCDI_SelectCDI_ProcessQ931MsgCDI_ProcessMessageCDI_ProcessRequestCDI_InitServiceCDO_OptSelectCDO_SelectCDO_ProcessQ931MsgCDO_ProcessMessageCDO_ProcessRequestCDR_OptSelectCDR_SelectCDR_ProcessQ931MsgCDR_ProcessMessageCDR_ProcessRequestCDR_EndServiceCDS_OptSelectCDS_SelectCDS_ProcessMessageCDS_ProcessRequestCDSI_OptSelectCDSI_SelectCDSI_ProcessQ931MsgCDSI_ProcessMessageCDSI_ProcessRequestCDF_OptSelectCDF_SelectCDF_ProcessQ931MsgCDF_ProcessMessageCDF_ProcessRequestHGSE_SelectHGSE_ProcessQ931MsgHGSE_ProcessMessageHGSE_ProcessRequestHGSE_InitServiceHDSE_OptSelectHDSE_SelectHDSE_ProcessMessageHDSE_ProcessRequestPRKG_SelectPRKG_ProcessMessagePRKG_ProcessRequestPRKG_InitServicePRKD_OptSelectPRKD_SelectPRKD_ProcessQ931MsgPRKD_ProcessMessagePRKD_ProcessRequestPRKT_OptSelectPRKT_SelectPRKT_ProcessQ931MsgPRKT_ProcessMessagePRKT_ProcessRequestPRKT_EndServicePKUP_SelectPKUP_ProcessMessagePKUP_ProcessRequestPKUP_InitServiceGPSRV_SelectGPSRV_ProcessMessageGPSRV_ProcessRequestGPSRV_InitServiceGPMEM_OptSelectGPMEM_SelectGPMEM_ProcessMessageGPMEM_ProcessRequestWGSE_SelectWGSE_ProcessQ931MsgWGSE_ProcessMessageWGSE_ProcessRequestWGSE_InitServiceWDSE_OptSelectWDSE_SelectWDSE_ProcessMessageWDSE_ProcessRequestMWIMC_OptSelectMWIMC_SelectMWIMC_ProcessQ931MsgMWIMC_ProcessMessageMWIMC_ProcessRequestMWISER_OptSelectMWISER_SelectMWISER_ProcessQ931MsgMWISER_ProcessMessageMWISER_ProcessRequestNIE_OptSelectNIE_SelectNIE_ProcessMessageNIE_ProcessRequestCC_OptSelectCC_SelectCC_ProcessQ931MsgCC_ProcessMessageCC_ProcessRequestCC_NoMoreCallsCC_EndServiceCO_OptSelectCO_SelectCO_ProcessQ931MsgCO_ProcessMessageCO_ProcessRequestCIA_SelectCIA_ProcessQ931MsgCIA_ProcessMessageCIA_ProcessRequestCIA_InitServiceCIB_OptSelectCIB_SelectCIB_ProcessQ931MsgCIB_ProcessMessageCIB_ProcessRequestCIC_OptSelectCIC_SelectCIC_ProcessMessageCMN_OptSelectCMN_SelectCMN_ProcessQ931MsgCMN_ProcessMessageCMN_ProcessRequestpstGetFieldNamecmCallSendSupplementaryServicecmCallSendSuppServiceManuallycmCallAcceptcmCallDropParamssCallGetHandlessGetValTreessePrimaryStrssCreateOptionalServicessGetStateNamessiCP_cpRequestCreateRessseCCHandleStagessCreateServicessServiceAddCallsseSecondaryStrcmVt2AliassseAtoStrsseEAtoStrcmString2TransportAddresscmTransportAddress2VtsseiAPIEntersseiAPIExitssServicePrimitiveRespssServiceGetHandlecmCallGetRatesseDialCallssiCP_setupCreateArgcmCallProgressCreatecmGetValTreecmCallProgressssiCP_pickupCreateArgsseTertiaryStrssiCP_pickExeCreateArgMWIGetnumOfMsgsMWIGetorigNumMWIGettimestampMWIGetpriorityMWIGetIsCallBacksseCCHandleRequestsseCCHandleExecPossiblesseCCEndServicesseCCFindServicesseCallHoldInitcmCallJoinsseCallHoldRetrievessInitssSetCallEventHandlerssSetServiceEventHandlerssEndssCreateCallssCallCloseemaIsVacantssCallNewMessagehandleSetupMessagessInitWatchdogsseStrtoEAdiversionProcscmCallSetIndependentSupplementaryServicererouteReasonssseMWIGetResultEltsseCCImplementsseCCActivatesseCCExecPossiblesseCCRingoutsseCCResumesseCCCancelssSetDefaultAddressssServiceSetHandleRvGefGenericCapabilityBuildGefGenericCapabilitySetEncodedCapIdRvGefGenericCapabilitySetMaxBitRateRvGefGenericParameterBuildRvGefGenericParameterSetIdentifierRvGefGenericParameterSetValueRvGefGenericCapabilitySetCollapsingRvGefGenericCapabilityGetCollapsingByIdentifierRvGefGenericParameterGetValueRvGefGenericCapabilitySetNonCollapsingRvGefGenericCapabilityGetNonCollapsingByIdentifierRvGefGenericCapabilitySetIdentifierRvGefGenericCapabilityGetMaxBitRatehSynGenericCaphSynGenericParamhSynGenericMessageRvGefEndGefGenericCapabilityInitializeEncodedCapIdArrayGefGenericMessageInitializeEncodedMessageIdArrayGefGetGenericParameterByIdentifierGefGenericCapabilityGetCodecTypeGefGenericMessageGetMessageTypeRvGefGenericMessageGetSubMessageIdentifierGefGenericMessageSetEncodedMessageIdRvGefGenericMessageSetSubMessageIdentifierRvGefGenericMessageSetMessageContenttokenOidToOidTypealgorithmOidToOidTypeidentifyTokenDHfailToAppgetEntityEntrycheckGeneralIdcheckSenderIdfreezeRasMessageverifyTimeSynccheckByProcedure1successToAppcheckByProcedure1acheckByProcedure2checkByProcedure3identifyNodegetDHTokenNodeh235GenerateDiffieHellmanEPh235GenarateDiffieHellmanSharedSecretEPcheckAuthenticationProc1checkAuthenticationProc1acheckAuthenticationProc2checkAuthenticationProc3checkAuthenticationProc4rvh323BuffnumGeneratePrimervh323BuffnumRandomizeLimitedrvh323BuffnumBaseExpModrvh323BuffnumTwoExpModcmSetPartnerHandleh235SetTimeSynccmiRASSetMessageEventHandlerh235cmEvRASNewRawMessageh235cmEvRASSendRawMessageh235cmEvRASReleaseMessageContexth235cmEvCallReleaseMessageContextcmSetMessageEventHandlerh235cmEvCallNewRawMessageh235cmEvCallRecvRawMessageh235cmEvCallSendRawMessageinitOIDscmGetPartnerHandleh235GetFirstCryptoNodeFromMessagecmGetProtocolMessageNameh235GetIncomingDiffieHellmanHalfKeyh235APIEnterh235APIExith235GetFirstClearNodeFromMessagecheckAuthenticationcmRASGetHandlesecureMessagecmiRASGetMessageContextcmCallGetMessageContextgenerateDiffieHellmanh235GenerateDiffieHellmansetDHP1TokenNodeh235CallSendCryptoTokenOnCallgenarateDHSharedSecreth235GenarateDiffieHellmanSharedSecretrvh323BuffnumSubstrvh323BuffnumDivModKnuthNoExtrvh323BuffnumMultrvh323BuffnumDivModKnuthrvh323seedGenRandrvh323genRandrvh323BuffnumRandomizervh323BuffnumMultModrvh323BuffnumExpModrvh323BuffnumCheckPrimervh323BuffnumAddcapStructBuildcapSetFindconfGetDataTypecapStructBuildFromStructcmH245GetChannelListcheckChanSIDConsistencysendMessageH245ChancmiGetH245HandlegetOutSubChanByLCNincomingChannelMessagegetInChanByLCNgetOutChanByLCNgetNextInChancmChannelSendMiscCommandchannelML_TimeoutEventsHandlersendMessageH245getNextOutChaninCapTransferRequestgetNextChancmChannelDropReasoncapSetBuildcapDescBuildoutCapTransferRequestcapSetBuildFromStructcapDescBuildFromStructcmCallCapabilitiesBuildcmCallSendCapabilitymsdTimeoutEventsHandlermsdDetermineRequestcmTAToVt_H245cmVtToTA_H245conferenceMessageget1st0BitNumbercmTransportAddress2StringmarkFreeSIDgetGoodAddressForCtrlreqMode_TimeoutEventsHandlerconfGetModeEntrycmGetModeTypeNamecmRequestModeBuildStructEntryconfGetDataTypeNamerejectChannelgetFreeSIDgetOutChanBySIDgetInChanBySIDh22xFunctionscmChannelDropallocateChannelcmcCallChannelParametersCallbackcmcCallDataTypeHandleCallbacknotifyChannelStatestartEstablishmentgetNextOutChanByBasecmChannelSetRtcpTransportAddresscmChannelSetRtpTransportAddressh225ParamsDeriveChannelsH245InitChannelsH245EndChannelsTerminalCapabilitiesSetTimerRestartmasterSlaveTimerRestartTerminalCapabilitiesSetTimerStopmasterSlaveTimerStopemaLinkToElementcmH245SetChannelListconfGetChannelNamescmChannelClosecmGetH245ConfigurationHandlecmChannelOpenDynamicbuildQosCapabilitychannelRC_TimeoutEventsHandlercmChannelRequestClosegetQosParameterscmChannelSetDynamicRTPPayloadTypeopenLogicalChannelcapInitmsdInitrtdInitrmInitcapEndmsdEndrtdEndrmEndmasterSlaveDeterminationterminalCapabilitySetcloseLogicalChannelrequestChannelCloserequestModeroundTripDelayRequestmaintenanceLoopRequestmasterSlaveDeterminationAckmasterSlaveDeterminationRejectterminalCapabilitySetAckterminalCapabilitySetRejectopenLogicalChannelAckopenLogicalChannelRejectcloseLogicalChannelAckrequestChannelCloseAckrequestChannelCloseRejectrequestModeAckrequestModeRejectroundTripDelayResponsemaintenanceLoopAckmaintenanceLoopRejectmaintenanceLoopOffCommandflowControlCommandendSessionCommandmiscellaneousCommandmultipointModeCommandcancelMultipointModeCommandvideoFreezePicturevideoFastUpdatePicturevideoFastUpdateGOBvideoTemporalSpatialTradeOffvideoSendSyncEveryGOBvideoSendSyncEveryGOBCancelvideoFastUpdateMBswitchReceiveMediaOffswitchReceiveMediaOnconferenceCommandmasterSlaveDeterminationReleaseterminalCapabilitySetReleaseopenLogicalChannelConfirmrequestChannelCloseReleaserequestModeReleaselogicalChannelActivelogicalChannelInactivemultipointConferencecancelMultipointConferencetransportCapabilityindicationuserInputmcLocationIndicationconferenceIndicationoutgoingChannelMessagecmFastStartBuildcmCallAddFastStartMessagecmFastStartGetcmFastStartChannelsAckIndexcmCallFastStartOpenChannelscreateNonStandardRedMethodcreateRtpAudioRedMethodcreateH263VideoRedMethodaddH263VCustomFramMapingaddQosCapabilityaddMediaChannelCapcreateTranspCapabilitycmCallGetRemoteCapabilitiesh225ParamsStartEstablishmenth225cmcCallAddressCallbacksh225ParamsOpenLogicalChannelEventh225ParamsDynamicRTPPayloadTypeh225MaximumSkewIndicationh225communicationModeCommandh225AllocateChannelh225ChannelFreeMemoryh255ParamsChannelAnswerh255ParamsOpenLogicalChannelAckh255ParamsOpenLogicalChannelConfirmh225ParamsChannelOpenDynamich225ParamsCallChannelParametersCallbackh225ParamsChannelCloseh225ParamsSessionOpenDynamich225MultiplexReconfigurationrvAllocAllocatervAllocDeallocate_RvListRvVoidPtrInsert_RvListRvVoidPtrPopFront_RvListRvVoidPtrClear_RvListRvVoidPtrPushBack_RvListRvVoidPtrConstruct_RvListRvVoidPtrErase_RvListRvVoidPtrSplice_RvListRvVoidPtrRemovervTreeClearrvTreeBeginrvTreeIterGetValuervTreeSetValuervTreeIterNextrvTreeEndrvTreeIterGetKeyrvTreeIterPrevRvCCoreInterfacesxtm_getutctimesettimeofdaypthread_mutexattr_initpthread_mutexattr_settypepthread_mutex_initpthread_mutexattr_destroypthread_mutex_destroypthread_mutex_lockpthread_mutex_unlockRvLockGetRvObjListInsertBeforeRvLockReleaseRvLockConstructRvLockDestructRvObjListConstructRvMemoryConstructRvObjListRemoveItemRvMemoryDestructRvObjListSizeRvMutexGetLockCounterRvMutexUnlockRvMutexLocksem_destroysem_trywaitpthread_key_createpthread_key_deleteRvSemaphoreConstructRvThreadSetStackpthread_attr_initpthread_attr_getschedparampthread_attr_setschedparampthread_attr_setdetachstatepthread_attr_setstacksizepthread_attr_setschedpolicypthread_attr_setscopepthread_attr_setinheritschedpthread_createpthread_setspecificpthread_setschedparamRvSemaphorePostpthread_getspecificpthread_selfpthread_equalRvThreadCurrentIdRvThreadIdEqualRvSemaphoreWaitpthread_attr_destroyRvSemaphoreDestructnanosleepRvTimeConstructFrom64RvThreadSleepRvThreadConstructpthread_getschedparamgettimeofdaymktimegmtime_rlocaltime_rasctime_rstrftimeRvAddressIpv4ConstructRvAddressIpv4CompareRvAddressIpv4GetPortRvAddressIpv4IsNullRvAddressIpv4SetPortRvAddressIpv4IsMulticastRvAddressIpv4GetStringRvAddressIpv4SetString__udivdi3RvNtpTimeNsecsToFractionRvNtpTimeFractionToNsecsRvObjPoolTotalItemsRvObjPoolFreeItemsRvObjListGetNextRvObjListInsertAfterRvObjListGetPreviousRvObjPoolAddPagesRvObjPoolAddItemsRvObjPoolDestructRvPQueueRemoveRvRaClearRvRaGetByPtrRvRaElemIsVacantRvRaDelete__moddi3RvCCoreInitRvCCoreEndRvObjPoolConstructRvPQueueConstructRvPQueueNumItemsRvPQueueMaxConcurrentItemsRvPQueueAllocatedItemsRvPQueueChangeSizeRvObjPoolGetMaxitemsRvObjPoolSetMaxitemsRvObjPoolGetMinitemsRvObjPoolSetMinitemsRvObjPoolGetFreelevelRvObjPoolSetFreelevelRvPQueuePeekRvSelectSetTimeOutRvTimerQueueControlRvPQueueGetRvObjPoolReleaseItemRvPQueueDestructRvObjPoolGetItemRvPQueuePutRvTimestampResolutionRvTimerEngineStopRvThreadNanosleepRvThreadSetPriorityRvThreadSetAttrRvThreadCreateRvThreadStartgethostnamegethostbynameRvHostGetIpListRvSocketGetBytesAvailableRvSocketGetLastErrorRvSelectHandleSingleSelevtFdRvTimerQueueGetSizeRvTimerQueueAddSizeRvTimerQueueSetLogMgrRvLogSelectUsageIncpipeRvTimerQueueConstructRvLogSelectUsageDecRvTimerQueueDestructRv64toA__umoddi3RvSocketSetLingerRvPortRangeGetNumberOfFreePortsRvPortRangeGetPortRvPortRangeReleasePortRvSocketCleanRvPortRangeGetRangeRvSemaphoreInitRvSemaphoreEndRvMutexInitRvMutexEndRvLockInitRvLockEndRv64AsciiInitRv64AsciiEndRvTmInitRvTmEndRvClockInitRvClockEndRvTimestampInitRvTimestampEndRvMemoryInitRvMemoryEndRvThreadInitRvThreadEndRvLogListenerInitRvLogListenerEndRvLogInitRvLogEndRvSelectInitRvSelectEndRvSocketInitRvSocketEndRvHostInitRvHostEndRvTLSInitRvTLSEndRvAresInitRvAresEndRvStdioInitRvStdioEndRvOsMemInitRvOsMemEndRvOsMemConstructRvOsMemDestructRvOsMemAllocRvOsMemFreeRvOsMemGetInfoRvQueueInitRvQueueEndRvTimerInitRvTimerEndRvTimerEngineInitRvTimerEngineEndferrorares__close_socketsinit_by_optionsares__read_lineares_destructRvRandomGeneratorGetInRangeares__send_queryares_expand_namewritevRvAddressIpv4SetIpares_queryares_initares_endares_constructget_optionsares_cancel_queryrvStrStreamWriteUIntrvStrStreamPutrvStrStreamEndlrvStrStreamWriteStrNrvStrStreamWriteStrrvSdpConnectionGetNetTypervSdpConnectionGetNetTypeStrrvSdpSymbolGetStringrvSdpConnectionGetAddrTypervSdpConnectionGetAddrTypeStrrvSdpConnectionGetAddressrvSdpConnectionGetAddressTTLrvSdpConnectionGetAddressNumrvSdpBandwidthGetTypervSdpBandwidthGetValuervSdpKeyGetTypeStrrvSdpKeyGetDatarvSdpStringGetDatarvSdpRtpMapGetEncodingParametersrvSdpRtpMapGetPayloadrvSdpRtpMapGetEncodingNamervSdpRtpMapGetClockRatervSdpOriginGetUsernamervSdpOriginGetSessionIdrvSdpOriginGetVersionrvSdpOriginGetNetTypervSdpOriginGetNetTypeStrrvSdpOriginGetAddressTypervSdpOriginGetAddressTypeStrrvSdpOriginGetAddressrvSdpEmailGetAddressrvSdpEmailGetTextrvSdpMsgGetNumOfEmailrvSdpMsgGetEmailrvSdpPhoneGetNumberrvSdpPhoneGetTextrvSdpMsgGetNumOfPhonesrvSdpMsgGetPhonervSdpMsgGetConnectionrvSdpMsgGetSessionTimervSdpSessionTimeGetStartrvSdpSessionTimeGetEndrvSdpSessionTimeGetRepeatIntervalrvSdpRepeatIntervalGetIntervalUnitsrvSdpRepeatIntervalGetIntervalTimervSdpRepeatIntervalGetDurationUnitsrvSdpRepeatIntervalGetDurationTimervSdpRepeatIntervalGetOffsetTimervSdpRepeatIntervalGetNumOfOffsetrvSdpRepeatIntervalGetOffsetUnitsrvStrStreamBufSeekOffCurrvSdpSessionTimeGetNumOfRepeatIntervalrvSdpMsgGetNumOfSessionTimervSdpMsgGetNumOfZoneAdjustmentsrvSdpMsgGetZoneAdjustmentrvSdpMsgGetKeyrvSdpMsgGetNumOfAttrrvSdpMsgGetAttributervSdpMsgGetNumOfOtherrvSdpMsgGetOtherrvSdpMsgGetNumOfRtpMaprvSdpMsgGetRtpMaprvSdpMsgGetMediaDescrrvStrStreamBufTellPosrvSdpMediaDescrGetMediaTypeStrrvSdpMediaDescrGetVcIdNumrvSdpMediaDescrGetVcIdValuervSdpMediaDescrGetVcIdTypervSdpMediaDescrGetProtocolStrrvSdpMediaDescrGetNumOfFormatsrvSdpMediaDescrGetFormatrvSdpMediaDescrGetNumOfOtherrvSdpMediaDescrGetOtherrvSdpMediaDescrGetNumOfRtpMaprvSdpMediaDescrGetRtpMaprvSdpMediaDescrGetNumOfAttrrvSdpMediaDescrGetAttributervSdpMsgGetNumOfMediaDescrrvStrStreamEndsrvStrStreamGetStatusrvStrStreamConstructBufrvSdpMsgEncodervStrStreamGetSizervStrStreamDestructrvStringEqualrvStringConstructCopy_RvListRvStringInsertrvStringDestruct_RvListRvStringPopFront_RvListRvStringClear_RvListRvStringPushBack_RvListRvStringConstruct_RvListRvStringErase_RvListRvStringSplicervSdpCtrStackConstructrvStringConstructNrvSdpAssertConstructrvSdpStringDestructWraprvSdpStringListDestructWraprvSdpVerifyConstructsrvSdpMediaDestructrvSdpCommonFieldsDestructrvSdpMediaDescrDestruct_RvListRvSdpMediaDescrErase_RvListRvSdpMediaDescrPopFrontrvSdpMediaConstructrvSdpMediaDestructWraprvSdpCommonFieldsConstructrvSdpCommonFieldsDestructWraprvSdpMediaBadSyntaxConstructrvSdpGetAllocatorrvSdpMediaDescrConstructArvSdpMediaDescrBadSyntaxConstructArvStringAssignrvStringAssignNrvSdpMediaBadSyntaxConstructNrvSdpPushString_RvListRvStringAt_RvListRvSdpAttributeAt_RvListRvSdpAttributeErase_RvListRvSdpAttributeClear_RvListRvSdpBadSyntaxAt_RvListRvSdpBadSyntaxErase_RvListRvSdpBadSyntaxClear_RvListRvSdpOtherAt_RvListRvSdpOtherErase_RvListRvSdpOtherClear_RvListRvSdpRtpMapAtrvSdpMediaDescrSetMediaTypeStrrvSdpMediaDescrSetProtocolStrrvSdpMediaDescrSetNASCtrlMethod_RvListRvStringCopyrvSdpCommonFieldsSetInformationNrvSdpConnectionConstructCopyArvSdpCommonFieldsSetKeyCopyrvSdpCommonFieldsSetBadSyntaxBandwidthNrvSdpCommonFieldsSetBandwidthNrvSdpCommonFieldsAddAttrNrvSdpCommonFieldsAddBadSyntaxNrvSdpMediaDescrGetNumOfBadSyntaxrvSdpMediaDescrGetBadSyntaxrvSdpCommonFieldsAddOtherNrvSdpCommonFieldsAddBadSyntaxRtpMapNrvSdpCommonFieldsAddRtpMapNrvSdpRtpMapSetEncodingParametersrvSdpMediaDescrConstructCopyA_RvListRvSdpMediaDescrInsert_RvListRvSdpMediaDescrSplice_RvListRvSdpMediaDescrClear_RvListRvSdpMediaDescrPushBack_RvListRvSdpMediaDescrConstruct_RvListRvSdpRtpMapErase_RvListRvSdpRtpMapClear_RvListRvSdpEmailClear_RvListRvSdpPhoneClear_RvListRvSdpSessionTimeClear_RvListRvSdpTimeZoneAdjustClear_RvListRvSdpEmailConstructrvSdpEmailListDestructWrap_RvListRvSdpPhoneConstructrvSdpPhoneListDestructWrap_RvListRvSdpSessionTimeConstructrvSdpSessionTimeListDestructWrap_RvListRvSdpTimeZoneAdjustConstructrvSdpTimeZoneAdjustListDestructWraprvSdpMediaDescrListDestructWraprvSdpMsgConstructArvSdpOriginDestruct_RvListRvSdpEmailAllocBackrvSdpEmailConstructN_RvListRvSdpEmailPopBack_RvListRvSdpEmailAt_RvListRvSdpEmailErase_RvListRvSdpPhoneAllocBackrvSdpPhoneConstructN_RvListRvSdpPhonePopBack_RvListRvSdpPhoneAt_RvListRvSdpPhoneEraservSdpCommonFieldsSetConnectionNrvSdpCommonFieldsSetBadSyntaxConnectionNrvSdpCommonFieldsSetKeyNrvSdpCommonFieldsSetBadSyntaxKeyN_RvListRvSdpSessionTimeAllocBackrvSdpSessionTimeConstructN_RvListRvSdpSessionTimePopBack_RvListRvSdpSessionTimeAt_RvListRvSdpSessionTimeErase_RvListRvSdpTimeZoneAdjustAllocBackrvSdpTimeZoneAdjustConstructN_RvListRvSdpTimeZoneAdjustPopBack_RvListRvSdpTimeZoneAdjustAt_RvListRvSdpTimeZoneAdjustEraservSdpBadSyntaxSessionTimeConstructNrvSdpMsgAddBadSyntaxrvSdpBadSyntaxPhoneConstructNrvSdpBadSyntaxEmailConstructNrvSdpMsgRemoveBadSyntaxrvSdpMsgGetNumOfBadSyntaxrvSdpMsgGetBadSyntaxrvSdpMsgRemoveBadSyntaxPrvSdpOriginConstructNrvSdpBadSyntaxOriginConstructNrvSdpMsgSetVersionNrvSdpOriginConstructCopyArvSdpMsgSetSessionNameNrvSdpMsgSetURIN_RvListRvSdpEmailCopy_RvListRvSdpPhoneCopyrvSdpMsgSetBadSyntaxBandwidthrvSdpMsgSetBandwidth_RvListRvSdpSessionTimeCopy_RvListRvSdpTimeZoneAdjustCopyrvSdpMsgAddAttrrvSdpMsgAddOtherrvSdpMsgAddBadSyntaxRtpMaprvSdpMsgAddRtpMap_RvListRvSdpMediaDescrCopyrvSdpMsgDestructrvSdpMsgConstructCopyA_RvListRvSdpMediaDescrAt_RvListRvSdpMediaDescrAllocBack_RvListRvSdpMediaDescrPopBackrvSdpMsgSetOriginNrvSdpMsgGetNetworkTypervSdpMsgGetAddrTypervSdpMsgGetAddressrvSdpMsgGetKeyTypervSdpMsgGetKeyData_RvListRvSdpMsgInsert_RvListRvSdpMsgPopFront_RvListRvSdpMsgClear_RvListRvSdpMsgPushBack_RvListRvSdpMsgConstruct_RvListRvSdpMsgErase_RvListRvSdpMsgSplice_RvListRvSdpMsgConstructCopyrvSdpMsgListDestruct_RvListRvSdpMsgCopy_RvListRvSdpMsgEqual_RvListRvSdpMsgAllocBack_RvListRvSdpMsgPopBackrvAllocGetDefaultAllocator_RvListRvSdpTypedTimePopFront_RvListRvSdpTypedTimeErase_RvListRvSdpTimeZoneAdjustPopFront_RvListRvSdpBadSyntaxPopFront_RvListRvStringAllocBack_RvListRvStringPopBackrvSdpRtpMapDestruct_RvListRvSdpRtpMapPopFrontrvSdpOtherDestruct_RvListRvSdpOtherPopFrontrvSdpAttributeDestruct_RvListRvSdpAttributePopFront_RvListRvSdpTypedTimeClearrvSdpRepeatIntervalDestruct_RvListRvSdpRepeatIntervalErase_RvListRvSdpRepeatIntervalPopFront_RvListRvSdpRepeatIntervalClearrvSdpSessionTimeDestruct_RvListRvSdpSessionTimePopFrontrvSdpPhoneDestruct_RvListRvSdpPhonePopFrontrvSdpEmailDestruct_RvListRvSdpEmailPopFrontrvSdpStringAssignrvSdpOriginSetNetTypeStrrvSdpOriginSetAddressTypeStrrvSdpEmailConstructCopyA_RvListRvSdpEmailInsert_RvListRvSdpEmailSplice_RvListRvSdpEmailPushBackrvSdpPhoneConstructCopyA_RvListRvSdpPhoneInsert_RvListRvSdpPhoneSplice_RvListRvSdpPhonePushBackrvSdpTypedTimeConstructrvSdpTypedTimeGetUnitsrvSdpTypedTimeGetTimervSdpTypedTimeConstructArvSdpTypedTimeConstructCopy_RvListRvSdpTypedTimeInsert_RvListRvSdpTypedTimeSplice_RvListRvSdpTypedTimePushBack_RvListRvSdpTypedTimeConstructrvSdpRepeatIntervalConstructArvSdpBadSyntaxRepeatIntervalConstructA_RvListRvSdpTypedTimeConstructCopyrvSdpRepeatIntervalConstructCopy_RvListRvSdpRepeatIntervalInsert_RvListRvSdpRepeatIntervalSplice_RvListRvSdpRepeatIntervalPushBack_RvListRvSdpRepeatIntervalConstruct_RvListRvSdpTypedTimeCopy_RvListRvSdpTypedTimeAllocBack_RvListRvSdpTypedTimeAtrvSdpRepeatIntervalListDestructWrap_RvListRvSdpRepeatIntervalConstructCopyrvSdpSessionTimeConstructCopyA_RvListRvSdpSessionTimeInsert_RvListRvSdpSessionTimeSplice_RvListRvSdpSessionTimePushBack_RvListRvSdpRepeatIntervalCopy_RvListRvSdpRepeatIntervalAt_RvListRvSdpRepeatIntervalAllocBackrvSdpRepeatIntervalConstruct_RvListRvSdpRepeatIntervalPopBackrvSdpBadSyntaxRepeatIntervalConstructrvSdpTimeZoneAdjustConstructCopy_RvListRvSdpTimeZoneAdjustInsert_RvListRvSdpTimeZoneAdjustSplice_RvListRvSdpTimeZoneAdjustPushBackrvSdpBadSyntaxBandwidthConstructNrvSdpBandwidthConstructNrvSdpBandwidthConstructCopyArvSdpBandwidthDestructrvStringCopyrvSdpConnectionConstructNrvSdpConnectionSetNetTypeStrrvSdpConnectionSetAddrTypeStrrvSdpConnectionSetAddressTTLrvSdpBadSyntaxConnectionConstructNrvSdpConnectionDestructrvSdpBadSyntaxKeyConstructNrvSdpKeyConstructNrvSdpKeyDestructrvSdpKeySetTypeStrrvSdpKeyConstructCopyArvSdpAttributeConstructNrvSdpAttributeConstructCopyA_RvListRvSdpAttributeInsert_RvListRvSdpAttributeSplice_RvListRvSdpAttributePushBack_RvListRvSdpAttributeConstructrvSdpBadSyntaxConstructNrvSdpBadSyntaxConstructCopyA_RvListRvSdpBadSyntaxInsert_RvListRvSdpBadSyntaxSplice_RvListRvSdpBadSyntaxPushBack_RvListRvSdpBadSyntaxConstructrvSdpOtherConstructNrvSdpOtherConstructCopyA_RvListRvSdpOtherInsert_RvListRvSdpOtherSplice_RvListRvSdpOtherPushBack_RvListRvSdpOtherConstructrvSdpBadSyntaxRtpMapConstructNrvSdpRtpMapConstructNrvSdpRtpMapConstructCopyA_RvListRvSdpRtpMapInsert_RvListRvSdpRtpMapSplice_RvListRvSdpRtpMapPushBack_RvListRvSdpRtpMapConstructrvSdpRtpMapSetEncodingNamervSdpAttributeListDestructWraprvSdpBadSyntaxListDestructWraprvSdpOtherListDestructWraprvSdpRtpMapListDestructWrap_RvListRvSdpBadSyntaxAllocBack_RvListRvSdpBadSyntaxPopBackrvSdpCommonFieldsRemoveBadSyntaxrvSdpCommonFieldsGetNumOfBadSyntaxrvSdpCommonFieldsGetBadSyntaxrvSdpCommonFieldsRemoveBadSyntaxP_RvListRvSdpAttributeAllocBackrvStringConcatenateN_RvListRvSdpAttributePopBack_RvListRvSdpOtherAllocBack_RvListRvSdpOtherPopBack_RvListRvSdpRtpMapAllocBack_RvListRvSdpRtpMapPopBackrvSdpParseSetSemErrParserAttachPcbToMsgBufferrvSdpMsgSetBadSyntxFieldrvSdpMsgSetBadSyntxFieldMrvSdpParseAuxSetTypervSdpAuxAssertMem_rvSdpParseAuxResetTypervSdpParserAuxSetOriginNrvSdpAuxAssertMem2_rvSdpParseAuxSetURIrvSdpParserAuxSetConnectionNrvSdpParserAuxSaveAddrrvSdpParseAuxSetBandwidthrvSdpParseAuxClearRepeatrvSdpParseAuxAddSessionTimervSdpParseAuxAddSessionRepeatFieldrvSdpParseAuxSetRepeatActiveDurationrvSdpParseAuxAddRepeatOffsetrvSdpParseAuxAddZoneAdjustmentrvSdpParserAuxSetKeyNrvSdpParseAuxAddRtpMaprvSdpRtpMapSetEncodingParametersNrvSdpParseAuxClearCurMediaDescrrvSdpParseAuxAddSdpMediarvSdpParseAuxAddSdpMediaNASrvSdpParseAuxAddMediaDescrFormatNrvSdpParserAuxAddEmailrvSdpParseAuxAddPhonervSdpParserAuxSaveVcIdrvSdpParser_token_namesrvSdpParseSetSyntaxErrinit_rvSdpParser_RvVectorRvStringConstruct_RvVectorRvStringDestructrvSdpParseSetMemoryErrrvSdpMsgSetBadSyntaxOriginNrvSdpOriginSetNetTypeStrNrvSdpOriginSetAddressTypeStrNrvSdpConnectionSetNetTypeStrNrvSdpConnectionSetAddrTypeStrNrvSdpMediaDescrAddFormatNrvSdpMediaDescrSetCtrlMethodNrvSdpRepeatIntervalAddOffsetrvSdpKeySetTypeStrNrvSdpMsgAddEmailNrvSdpMsgAddMediaDescrrvSdpParserAuxSetDescrCtrlMethodNrvSdpMsgAddBadSyntaxMediaDescrrvSdpParserAuxSetBadSyntaxConnectionrvSdpParserAuxSetBadSyntaxBandwidthrvSdpParserAuxSetBadSyntaxKeyNrvSdpMsgTimeAddZoneAdjustmentrvSdpSessionTimeAddRepeatIntervalrvSdpMsgAddSessionTimervSdpMsgAddPhoneNrvSdpSessionTimeAddBadSyntaxRepeatIntervalrvSdpMsgAddBadSyntaxSessionTimervSdpParseAuxAddBadSyntaxSessionTimervSdpParseAuxAddBadSyntaxRepeatrvSdpParserAuxSetBadSyntaxOriginrvSdpMsgSetBadSyntaxURINrvSdpMsgAddBadSyntaxEmailNrvSdpMsgAddBadSyntaxPhoneNParseContinuervSdpMediaDescrRemoveBadSyntaxrvSdpFieldReparservSdpMsgConstructParseArvStringListAddNrvStringListGetElemrvSdpMediaDescrAddVcIdN_RvVectorRvStringClearrvSdpMediaDescrSetMediaTypeStrNrvSdpMediaDescrSetProtocolStrNrvSdpParserAuxSetVcIdNrvStrFindFirstNotOfrvStrFindFirstOfrvStrIcmp_RvVectorRvStringCopy__RvVectorRvStringClear__RvVectorRvStringReserve_RvVectorRvStringFill_RvVectorRvStringPushBackrvStrStreamBufSetPrvStrStreamBufReservervStrStreamBufDestructrvNullAllocrvStrStreamBufConstructArvStrStreamBufConstructEBrvStrStreamBufInvalidatervStrStreamBufGetStrrvStrStreamBufPutCrvStrStreamBufPutNrvStringLessrvTreeConstructrvTreeInfoRvStringRvStringrvTreeGetValuervTreeFindValuervTreeRemovervTreeRevBeginrvTreeRevEndrvTreeRevIterGetKeyrvTreeRevIterGetValueg_h323PhonervCCH323PhoneGetMdmProviderrvCCH323PhoneGetH323ProviderrvMdmTermMapDialStringToAddress_rvCCTerminalMdmGetPhoneNumberrvCCTerminalGetIdrvCCConnectionSetThirdPartyAddressInThirdPartyConnrvCCTerminalMdmGetPhoneNumbersrvMdmTermPhoneNumbersGetByIndexcacGetOwnNumberrvCCConnectionSetCalledNumberrvCCCallLockrvCCProviderH323CreateConnectionrvCCCallAddPartyrvCCCallUnlockrvMdmTermMgrMapAddressToTermination_rvCCProviderFindTerminalByTermIdrvCCProviderMdmFindTerminalByNumberrvCCProviderMdmFindAnyTerminalrvCCProviderMdmCreateConnectiondialplanAppLookupDialplandialplanAppFindrvCCBasePhoneGetCallMgrrvCCCallMgrCreateCallrvCCCallMgrSetActiveCallrvCCBasePhoneGetBasePhoneprvDefaultAllocrvCCBasePhoneConstructrvCCBasePhoneSetMdmProviderrvCCBasePhoneSetNetProviderdialplanAppConstructhuntGroupAppConstructrouteAppConstructrvCCProviderMdmConstructrvCCProviderMdmSetDisplayDatarvCCProviderMdmRegisterAddressAnalyzeCBaddressH323AnalyzeCBrvCCProviderMdmRegisterInProcessCBh323InProcessCBrvMdmTermMgrRegisterMapAddressToTermCBmapAddressToTerminationrvCCBasePhoneGetNetProviderrvCCProviderH323ConstructrvCCProviderH323RegisterAddressAnalyzeCBrvCCProviderH323RegisterInProcessCB_rvMapConstructRvStringRvStringrvCCProviderMdmDestructrvCCProviderH323DestructrvTreeDestructhuntGroupAppDestructrouteAppDestructdialplanAppDestructrvMdmStreamDescriptorGetLocalDescriptorrvCCH323CapabilititesBuildCapabilitiesTreeInH323ConfigurationrvCCH323CapabilitiesBuildChannelsTreeInH323ConfigrvCCH323PhoneBuildCapabilitiesConfigrvCCH323PhoneBuildChannelsConfigrvMdmTermClassGetMediaCapabilites_rvMdmMediaDescriptorGetStreamrvCCProviderH323SetMediarvMdmProviderStartrvCCProviderH323StartrvMdmProviderStoprvCCProviderH323StoprvCCH323PhoneDestructrvCCBasePhoneDestructrvCCProviderMdmFindTerminalTypeIppH323StackAddE164ListToStackrvMdmProviderRegisterPhysTermrvCCProviderH323RegisterTerminalrvCCH323PhoneGetH323MgrrvCCTerminalMdmGetTermIdrvMdmTermGetClassrvMdmTermPhoneNumbersGetSizervH323ControlUnregisterClientmdmProviderUnregisterTermrvMdmProviderRegisterPhysTermAsyncrvMdmTermMgrConstruct_rvCCH323PhoneConstructrvCCCallTransferInProcessCBrvCCConnectionInitrvCCConnH323SetFromAddressrvCCConnH323GetProviderImplrvCCProviderH323ClearMediaStreamrvCCConnectionDestructrvIppH323DisconnectingCBrvCCConnectionSetStatervCCConnectionDisconnectedCBrvCCConnectionGetConnectPartyrvCCConnectionGetThirdPartyDestAddresssseCallTransferrvH323ControlRejectrvH323ControlCallDisconnectrvCCTextPrintEventrvH323ControlCallMakervCCConnH323DisconnectingrvCCConnectionCallDeliveredCBrvCCConnectionAlertingCBrvCCConnectionConnectedCBrvCCConnectionTransferInitCBrvCCConnectionTransferOfferedCBrvCCConnectionInProcessCBrvCCConnectionMediaCreatedCBrvCCConnectionReleasedCBrvCCConnH323DestructrvCCConnH323SendOutOfBandDTMFh245UserInputrvCCProviderH323GetMediaStreamrvMdmStreamDescriptorIsLocalDescriptorSetrvMdmStreamDescriptorIsRemoteDescriptorSetrvMdmStreamDescriptorGetRemoteDescriptorrvCCProviderH323AddEmptyMediaStreamrvMdmMediaStreamInfoIsLocalDescriptorSetrvMdmMediaStreamInfoAddLocalDescriptorrvCCConnectionSetRemoteMediarvMdmMediaStreamInfoAddRemoteDescriptorrvCCConnectionGetMediarvCCConnH323SetRemoteMediarvH323ControlSendRingingrvCCConnH323ProcessEventrvH323ControlCallAcceptrvH323ControlSendHoldrvH323ControlSendUnholdrvCCConnH323HoldrvCCConnH323UnholdrvCCConnH323Constructg_H323Provider_rvMapConstructRvCharPtrRvCCTerminalPtrIppLogMgrRvMutexConstructrvCCConnH323AcceptrvCCConnH323PlayDtmfrvCCConnH323RejectrvCCConnH323RingbackrvCCConnH323GetMediarvCCConnH323GetMediaCapsrvCCConnH323MakeCallrvCCConnH323CallAnsweredrvCCConnH323CreateMediarvCCConnH323TerminatervCCConnH323CheckMediarvCCConnH323RemoteHoldrvCCConnH323RemoteUnholdrvCCConnH323TransferInitrvCCConnH323TransferInProgressrvCCConnH323GetCallerIdrvCCConnH323GetCallerAddressrvCCConnH323GetCallerNamervCCConnH323GetCallerNumberrvCCConnH323IsTransferedConnrvCCConnH323InitiatedCBrvH323ControlConstructrvCCCallDtmfPressedCBrvCCConnH323DialingCBrvCCConnH323CallDeliveredCBrvCCConnH323OfferedCBrvCCConnH323TransferInitCBrvCCConnH323TransferOfferedCBrvCCConnH323MediaCreatedCBrvCCCallMediaUpdatedCBrvCCCallCapsUpdatedCBrvCCCallRejectedCBrvCCCallAlertingCBrvCCCallConnectedCBrvCCCallDisconnectedRemoteCBrvCCCallPartyReleasedCBrvCCCallHeldCBrvCCCallTalkingCB_RvVectorRvMdmMediaStreamInfoConstructRvMutexDestructrvH323ControlDestruct_RvVectorRvMdmMediaStreamInfoDestructrvH323ControlStartrvH323ControlStoprvMdmMediaStreamInfoMatchId_RvRvVectorIterRvMdmMediaStreamInfoFindIf_RvVectorRvMdmMediaStreamInfoAllocBackrvMdmMediaStreamInfoConstructArvMdmMediaStreamInfoDestruct_RvVectorRvMdmMediaStreamInfoEraservCCTerminalH323Construct_rvMapSetValueRvCharPtrRvCCTerminalPtr_rvMapRemoveRvCharPtrRvCCTerminalPtrrvCCTerminalH323DestructrvCCProviderH323CreateTerminalrvCCProviderH323RemoveTerminalrvCCConnH323SetCallLegHandlervCCConnH323IsTransferedCallsseCallCloservCCTerminalInit_rvMapGetValueRvCharPtrRvCCTerminalPtrh323ExtClbksrvCCTextCauseConfigurationArrayg711Ulaw64kg7231g711Alaw64kg722_64g728g729rvSdpMediaDescrGetNumOfPayloadsrvSdpMediaDescrGetPayloadNumberg722_56g722_48changeChannelDatag729wAnnexBrvCCH323CapabilitiesGetDynamicChannelNamegetChannelNamepvtSetByPathutlDecodeOIDgetCodecMappingTypeByGeneriCapabilityObjectIdentifierRvGefG726GetMaxBitRateRvGefG726GetMaxSamplesPerPacketgetCodecMappingTypeByNamegenCaprvCCH323CapabilitiesGetPayloadByNamervCCH323CapabilitiesCommonCapRvGefG726BuildRvGefG726SetMaxBitRateRvGefG726AddMaxSamplesPerPacketRvGefG726AddBitOrderupdateChannelDatasetChannelForStaticPayloadupdateChannelConfigbuildChannelDatabuildChannelConfigaddH263rvCCH323CapabilitiesRemoveOldCapabilitiesbuildChannelCapabilitiesConfigsetDtmfInforvCCH323CapabilititesRTPAudioToneCapabilityrvCCH323CapabilititesRTPAudioTelephonyEventCapabilityrvCCH323CapabilititesUserInputrvMdmTermPresentationInfoConstructrvMdmTermPresentationInfoSetCallerPermissionrvMdmTermPresentationInfoSetCalleePermissionrvMdmTermPresentationInfoSetNamervCCConnectionSetRemotePresentationInforvCCConnH323SetCallerIdIppUtilIsNumberValidrvCCConnectionSetTermStatervCCConnectionTermHeldCBrvCCConnectionTermTalkingCBrvCCCallTransferConnectedCBconvertAddrToStrsseSetDefaultAddressgetProfileIndexphoneLinkHandleMwivoipSendCommandcmFastStartOpenChannelscmChannelNewcmChannelSetRTCPAddresscmChannelOpensseCallStateChangedSendFastStartrvCCH323DTMFCallsendUserInputrvDtmfParametersInitrvSdpMediaDescrAddPayloadNumberrvCCProviderH323ProcessEventsetChannelNamecmFastStartChannelsRefuservCCConnectionCreateMediagetLocalRtpRtcpAddresseschannelDataInitackSuggestedChannelscmFastStartGetByIndexrvCCConnectionTermDtmfPressedCBcmCallProgressGetrvIppH323SendCallMessageCBrvCCTerminalMdmGetPresentationInforvMdmTermPresentationInfoGetCallerPermissionpvtDeleteChildsrvMdmTermPresentationInfoGetCalleePermissionrvMdmTermPresentationInfoGetNamesseGetSSHandlervIppH323RecvCallMessageCBrvH323CallDetectTransferCTSetuprvCCCallMgrReplaceConnByRemotesseCallH450SupplServrvCCConnectionCapsUpdatedCBcmCallGetLocalCapabilitiesgetCommonCapabilitiesStoreChannelToOpenchangeChannelConfigrvCCH323RemoteCapabilititesHasUserInputIndicationrvCCConnectionTermConnectMediasetDTMFInfoAboutRemoteSitecmUserInputGetDetailcmUserInputGetcmUserInputGetSignalcmUserInputGetSignalUpdatecmChannelGetOrigincmChannelSetAddresscmChannelAnswerrvSdpMsgConstructrvSdpMsgClearMediaDescrrvCCH323CapabilitiesIsPayloadDynamicrvSdpMsgSetConnectioncmCallConnectControlcmChannelGetRequestCloseParamcmGetHandlervIppH323SendRasCBrvIppH323RecvRasCBIppH323StackConstructIppTimerInitrvCCBasePhoneGetEvQueueIppQueueStartIppSeliSelectUntilIppH323StackDestructrvH323SecurityEndIppH323StackInitializestartH323StackProcesscmSetHandlecmSetGenEventHandlercmEventcmSetCallEventHandlercmCallEventcmSetControlEventHandlercmControlEventcmSetChannelEventHandlercmChannelEventcmSetProtocolEventHandlercmProtocolEventsseEvRemoteHoldIndsseSetCallEventHandlersseEvRemoteHoldConfirmsseEvRemoteHoldRetrieveIndsseEvRemoteRetrieveConfirmsseEvNearHoldIndsseEvNearHoldRetrieveIndsseEvCallTransfersseEvCTidentifysseEvMWIActivateIndsseEvMWIDeactivateIndsseEvMWIInterrogateConfirmsseEndrvH323SecurityInitRvSelectStopWaitingrvCCH323CapabilitiesUpdateChannelsTreeInH323ConfigsendRegisterClientcmGetGKRASAddresssendUnregisterClientsendEventToMsgSocketsseCreateCallsseCallImplementHoldsseCallImplementNIsseCallImplementTransfersseCallImplementMWIServedcmCallNewrvH323ControlCallUpdateChannelsConfigrvCCConnectionGetCallerNumbercmCallMakecmCallGetCalledPartyIdrvCCConnectionAddressAnalyzeCBrvCCConnH323SetToAddresscmCallGetCallingPartyIdrvH323ProvideTransferConnectedh323CapabilitiesGetSilenceSuppressioncmUserInputBuildAlphanumericcmCallSendUserInputcmUserInputSignalBuildcmUserInputSignalUpdateBuildcmCallUserInformationCreatecmCallUserInformationSendrvMdmTermEnableOutOfBandDtmfRelayrvIppH323StackConfigInitciDeleteValuervIppH323ExtStackConfigCBcmEndciAllocateTargetBufferciSavesseInitRvGefInitcmGetVersionciFreeTargetBufferg_h235HApph235Endg_h235HashFunctionsh235SetSecureModeh235SetCheckIncomingMessagesh235SetGatekeeperIdh235SetSenderIdh235Inith235SetEncodingCallbackrvH323SecuritySH1_96Callbackh235SetCustom1CallbackrvH323Custom1CallbackrvH323SecuritySetrvKeyConstructCopyRvStringRvStringrvValueConstructCopyRvStringRvStringrvKeyDestructRvStringRvStringrvValueDestructRvStringRvStringrvKeyLessRvStringRvStringrvKeyEqualRvStringRvStringcmHookSendTocmHookRecvFromcmHookClosecmEvRASRequestcmEvRASConfirmcmEvRASRejectcmEvRASTimeoutcmEvCallNewRatecmEvCallInfocmEvCallFastStartSetupcmEvCallUserInfocmEvCallH450SupplServcmEvCallRecvMessagecmEvCallSendMessagecmEvChannelStateChangedcmEvChannelNewRatecmEvChannelSetAddresscmEvChannelSetRTCPAddresscmEvChannelHandlecmEvChannelRequestCloseStatuscmEvChannelReplacecmEvCallCapabilitiescmEvCallCapabilitiesExtcmEvChannelNewcmEvCallMasterSlaveStatuscmEvCallUserInputcmEvCallControlStateChangedcmEvNewCallcmEvRegEventrvCCTerminalMdmOtherHeldConnExistrvCCConnectionSetThirdPartyDestAddressrvMdmMediaStreamInfoConstructCopyrvMdmMediaStreamInfoClearLocalrvMdmMediaStreamInfoClearRemotervCCConnectionClearNewMediarvCCConnectionResetStatervMdmTermPresentationInfoCopyrvIppMdmExtDisplayCBrvIppMdmExtMapUserEventCBrvCCTerminalGetMaxConnectionsrvCCTerminalLockActiveConnectionrvCCTerminalUnlockActiveConnectionrvCCTerminalSetActiveConnectionIdrvCCTerminalGetActiveConnectionIdrvCCConnectionMakeCallrvPtrListPushBackrvCCCallSetStatervCCCallSetConferencervPtrListRemove_RvListRvVoidPtrConstructCopyrvCCConnectionDisconnectrvCCCallRemovePartyrvCCConnectionTransferInitrvCCConnectionLeaveConferencervCCCallConstructArvCCConnectionTransferOfferedrvCCConnectionRestartMediarvCCCallClearTransferPartiesrvCCConnectionTermRemoteHoldrvCCConnectionTermSetHoldIndicatorrvCCConnectionTermRemoteUnholdrvCCConnectionRingbackrvCCCallDroprvCCConnectionRejectrvCCConnectionModifyMediarvCCConnectionModifyMediaDonervCCConnectionTermHoldrvCCConnectionTermUnholdrvCCConnectionTermPlayDtmfrvCCConnectionJoinConferencervCCConnectionSetLocalMediarvCCCallDestructrvCCConnectionTerminatervCCCallMgrCallExistrvCCCallMgrReleaseCallrvCCConnectionProcessTermEventrvCCConnectionIsTransferedConnrvCCCallMgrMoveConnectionrvCCTerminalIsOutOfBandDtmfEnabledRvCCCallConferenceSendDtmfByConnrvCCTerminalGetActiveAudiorvCCTerminalSetActiveAudiorvCCCallTransferCompletedCBrvCCTerminalStopSignalsrvCCConnectionTermSetMuteIndicatorrvCCConnectionTermDisconnectMediarvCCTerminalSetAudioIndrvCCConnectionTermMutervCCConnectionTermUnmutervMdmParameterListGet2rvMdmParameterValueGetValuervCCTerminalGetDialStringrvCCCallHandleOODrvCCConnectionGetCallerNamervCCConnectionGetCallerAddressrvCCConnectionGetCallerIdrvCCTerminalSendCallerIdrvCCTerminalStartRingingSignalrvCCConnectionInitiatedCBrvIppMdmExtConnectionCreatedCBrvCCTerminalResetDialStringrvCCConnectionCallAnsweredCBrvCCConnectionDialingCBrvCCConnectionNewDigitCBrvCCConnectionAddressAnalyzervCCTerminalStartWarningSignalrvCCConnectionGetLineIdrvCCConnectionOfferedCBrvCCTerminalGetNumActiveConnectionsIppTimerStartrvCCConnectionTransferInProcessCBrvCCTerminalGetActiveConnectionrvCCTerminalStartCallWaitingSignalrvCCConnectionGetNewMediarvCCCallModifyMediaCBrvCCCallModifyMediaDoneCBrvMdmTermDeactivateDigitMaprvCCConnectionReleaservCCConnectionConferenceJoinedCBrvCCTerminalMdmGetActiveAudioTermrvCCTerminalIsAudioTerminationExistrvCCTerminalMdmMoveSignalsrvCCConnectionOnHoldrvCCTerminalMdmResetDialStringrvCCTerminalMdmSetWaitForDigitsrvCCCallSetTransferPartiesrvCCTerminalFindFreeConnectionrvCCCallAddConferencePartyrvCCTerminalParseConnectionIdrvCCCallRemoveConferencePartiesrvCCTerminalFindNextActiveConnectionrvCCTerminalGetConnectionByIndexrvCCConnectionSetNewMediarvCCTextConnStatervCCTextTermConnStatervCCTextEventrvMdmMediaDescriptorGetNumStreamsrvMdmStreamDescriptorConstructArvMdmStreamDescriptorAddLocalDescriptorrvSdpMsgListGetSizervSdpMsgListGetElementrvMdmStreamDescriptorAddRemoteDescriptorrvMdmParameterListCopyrvMdmMediaDescriptorAddStreamrvMdmStreamDescriptorDestructrvMdmMediaDescriptorDestructrvMdmMediaDescriptorConstructArvMdmPackagesDescriptorAddPackagervMdmTermInternalMatchDigitMaprvMdmPackagesDescriptorConstructArvMdmPackagesDescriptorDestructrvMdmPackagesDescriptorGetNumPackagesrvMdmPackagesDescriptorGetPackageNamervMdmTermClassIsPkgSupported_rvMdmEventDataConstructrvMdmPackageRegisterEventrvMdmEventDataDestructrvMdmSignalDataConstructrvMdmSignalDataSetTimeoutrvMdmPackageRegisterSignalrvMdmSignalDataDestructrvMdmTermClassDestruct_rvMdmDigitMapDataDestructrvMdmTermClassConstructA_rvMdmTermClassAddSupportedPkgrvStringMakeLowercase_rvMapGetValueRvIStringRvMdmPackagePtrrvMdmPackageConstruct__rvMapSetValueRvIStringRvMdmPackagePtr_rvMapConstructRvIStringRvMdmPackagePtrrvMdmTermMgrCreatePackagervMdmParameterValueConstructrvMdmParameterValueOrrvMdmPackageRegisterLocalControlPropertyrvMdmParameterValueDestructrvMdmPackageRegisterStatisticrvMdmErrorSetrvMdmTermMgrGetPkgInfo__rvMapGetValueRvIStringRvMdmSignalInfo_rvMapGetValueRvIStringRvMdmEventInforvMdmTerminationStateDescriptorConstructArvMdmEventsDescriptorConstructArvMdmEventBufferDescriptorConstructArvMdmDigitMapConstructArvMdmDigitMapDescriptorConstructArvMdmDigitMapDestructrvMdmTermPhoneNumbersConstructrvMdmTermDefaultPropertiesConstructA_rvMdmTerminationStateDescriptorDestructrvMdmEventsDescriptorDestructrvMdmEventBufferDescriptorDestructrvMdmDigitMapDescriptorDestructrvMdmTerminationStateDescriptorCopyrvMdmDigitMapDescriptorConstructrvMdmEventsDescriptorCopyrvMdmEventBufferDescriptorCopyrvMdmTermPhoneNumbersCopyrvMdmCurSignalListPopFrontrvMdmParameterValueConstructArvMdmParameterListSet2rvMdmPackageRegisterTermStatePropertyrvMdmKpDigitMapTranslateKeypadEvrvMdmDigitMapDataConstructrvMdmKpDigitMapBuildEvCompletervMdmPackageRegisterDigitMapDatarvTreeInfoRvMdmPackageItemRvMdmParameterValue_RvVectorRvMdmDigitPositionClear__RvVectorRvMdmDigitPositionCopy__RvVectorRvMdmDigitPositionReserve_RvVectorRvMdmDigitPositionFill_RvVectorRvMdmDigitPositionConstructCopyrvMdmDigitStringConstructCopy_RvVectorRvMdmDigitPositionDestructrvMdmDigitStringDestruct_RvVectorRvMdmDigitStringCopy__RvVectorRvMdmDigitStringClear__RvVectorRvMdmDigitStringReserve_RvVectorRvMdmDigitStringFillrvStringAndIntConstructArvMdmPackageItemConstructCopyrvStringAndIntConstructCopyrvMdmPackageItemDestructrvStringAndIntDestruct_RvVectorRvStringAndIntCopy__RvVectorRvStringAndIntClear__RvVectorRvStringAndIntReserve_RvVectorRvStringAndIntFillrvStringAndIntEqualRvTmConstructUtcrvMdmPackageItemConstructArvStringEqualIgnoreCaservMdmPackageItemEqualrvStringLessIgnoreCaservStringListAddrvMdmParameterValueConstructRangeArvMdmParameterValueConstructListArvMdmParameterValueConstructSpecialA_RvVectorRvStringConstructCopyrvMdmParameterValueConstructCopy_RvVectorRvStringCopyrvMdmParameterValueAddToListUnique_rvMapConstructRvMdmPackageItemRvMdmParameterValuervMdmParameterListConstructArvTreeConstructCopyrvMdmParameterListConstructCopyrvMdmEventConstructCopyrvMdmObservedEventConstructCopyrvMdmSignalExConstructCopyrvMdmParameterListDestructrvMdmEventDestructrvMdmObservedEventDestruct_RvVectorRvMdmObservedEventCopy__RvVectorRvMdmObservedEventClear__RvVectorRvMdmObservedEventReserve_RvVectorRvMdmObservedEventFillrvMdmSignalExDestruct_RvVectorRvMdmSignalExCopy__RvVectorRvMdmSignalExClear__RvVectorRvMdmSignalExReserve_RvVectorRvMdmSignalExFill_RvVectorRvMdmSignalExConstructCopyrvMdmSignalExListConstructCopy_RvVectorRvMdmSignalExDestructrvMdmSignalExListDestruct_RvVectorRvMdmSignalExListCopy__RvVectorRvMdmSignalExListClear__RvVectorRvMdmSignalExListReserve_RvVectorRvMdmSignalExListFill_RvVectorRvMdmEventCopy__RvVectorRvMdmEventClear__RvVectorRvMdmEventReserve_RvVectorRvMdmEventFillrvTreeCopy_rvMapFindValueRvMdmPackageItemRvMdmParameterValuervMdmParameterValueAnd_rvMapSetValueRvMdmPackageItemRvMdmParameterValuervMdmPackageItemConstructrvMdmParameterListSet_rvMapGetValueRvMdmPackageItemRvMdmParameterValuervMdmParameterListGetrvTreeSize_rvMapBeginRvMdmPackageItemRvMdmParameterValue_rvMapIterGetValueRvMdmPackageItemRvMdmParameterValue_rvMapEndRvMdmPackageItemRvMdmParameterValue_rvMapIterGetKeyRvMdmPackageItemRvMdmParameterValue_RvVectorRvMdmDigitPositionConstructrvMdmDigitStringConstructA_RvVectorRvMdmDigitPositionPushBack_RvVectorRvMdmDigitPositionClearrvMdmDigitPositionGetTimerModervMdmDigitPositionIsMultiplervMdmDigitPositionGetEvents_RvVectorRvMdmDigitStringConstruct_RvVectorRvMdmDigitStringConstructCopy_RvVectorRvMdmDigitStringDestruct_RvVectorRvMdmDigitStringCopy_RvVectorRvMdmDigitStringPushBackrvMdmDigitMapGetElemrvMdmDigitMapGetSizervMdmDigitMapGetShortTimeoutrvMdmDigitMapGetLongTimeoutrvMdmDigitMapConstructCopyrvMdmDigitMapCopyrvMdmDigitMapDescriptorGetNamervMdmDigitMapDescriptorGetDigitMap_RvVectorRvMdmSignalExListConstruct_RvVectorRvMdmSignalExConstructrvMdmEventConstructArvMdmSignalsDescriptorConstructArvMdmRequestedEventConstructA_RvVectorRvMdmSignalExListConstructCopy_RvVectorRvMdmSignalExListDestruct_RvVectorRvMdmRequestedEventDestructrvMdmSignalsDescriptorDestructrvMdmRequestedEventDestruct_RvVectorRvMdmRequestedEventCopy__RvVectorRvMdmRequestedEventClear__RvVectorRvMdmRequestedEventReserve_RvVectorRvMdmRequestedEventConstructCopyrvMdmDigitMapDescriptorConstructCopyrvMdmSignalsDescriptorConstructCopyrvMdmEventsDescriptorConstructCopyrvMdmRequestedEventConstructCopy_RvVectorRvMdmRequestedEventFill_RvVectorRvMdmSignalExListCopy_RvVectorRvMdmSignalExCopyrvMdmSignalsDescriptorCopyrvMdmSignalsDescriptorMarkAsSetrvMdmDigitMapDescriptorCopy_RvVectorRvMdmRequestedEventConstructrvMdmEventsDescriptorConstruct_RvVectorRvMdmRequestedEventCopy_RvVectorRvMdmRequestedEventPushBackrvMdmEventsDescriptorGetNumEvents_RvVectorRvMdmRequestedEventClearrvMdmTerminationStateDescriptorGetServiceStatervMdmTerminationStateDescriptorIsLockstepModervMdmTerminationStateDescriptorGetParameterListrvMdmParameterListIsEmptyrvSdpMsgListConstructArvSdpMsgListConstructCopyrvMdmStreamDescriptorConstructCopy_RvVectorRvMdmStreamDescriptorCopy__RvVectorRvMdmStreamDescriptorClear__RvVectorRvMdmStreamDescriptorReserve_RvVectorRvMdmStreamDescriptorFillrvSdpMsgListInsertMsgrvSdpMsgListClearrvMdmStreamDescriptorClearRemoteDescriptorsrvMdmStreamDescriptorClearLocalDescriptors_RvVectorRvMdmStreamDescriptorConstruct_RvVectorRvMdmStreamDescriptorDestruct_RvVectorRvMdmStreamDescriptorPushBack_RvVectorRvMdmStreamDescriptorClearrvMdmTimeStampConstructBlankrvMdmEntityAddressConstructArvMdmServiceChangeConstructArvMdmEntityAddressDestructrvMdmEntityAddressCopy_RvVectorRvMdmEventConstruct_RvVectorRvMdmEventDestruct_RvVectorRvMdmEventCopy_RvVectorRvMdmEventPushBackrvTreeGetAllocator_RvVectorRvMdmSignalExPushBackrvMdmSignalsDescriptorGetNumSignalsrvMdmSignalsDescriptorGetNumSignalLists_RvVectorRvStringAndIntConstruct_RvVectorRvStringAndIntDestructrvStringAndIntGetString_RvVectorRvStringAndIntPushBackrvMdmTermPhoneNumbersClearrvTreeInfoRvIStringRvMdmEventInforvTreeInfoRvIStringRvMdmSignalInforvMdmPackageItemGetPackagervMdmEventDataConstructArvMdmSignalDataConstructArvMdmDigitMapDataConstructArvMdmDigitMapDataCopyConstructrvMdmTerminationStateDescriptorSetParameterrvMdmStatisticsDescriptorAddStatisticrvMdmTermMgrSetDigitMapPkgInfo_rvMdmStatisticsDescriptorConstructA_rvMapConstructRvIStringRvMdmEventInfo_rvMapConstructRvIStringRvMdmSignalInforvMdmStatisticsDescriptorDestructrvMdmPackageDestruct_rvTreeInfoRvIStringRvMdmPackagePtr_rvMapSetValueRvIStringRvMdmEventInforvMdmEventGetParameterListrvMdmEventsDescriptorAddEvent_rvMapSetValueRvIStringRvMdmSignalInforvMdmSignalExConstructArvMdmSignalExSetTypervMdmSignalExSetDurationrvMdmSignalsDescriptorAddSignalrvMdmSignalsDescriptorGetSignalrvMdmEventsDescriptorGetEventrvMdmEventBufferDescriptorAddEventrvMdmStatisticsDescriptorGetStatisticsrvMdmParameterListForEachrvMdmTermProcessEventrvKeyConstructCopyRvMdmPackageItemRvMdmParameterValuervValueConstructCopyRvMdmPackageItemRvMdmParameterValuervKeyDestructRvMdmPackageItemRvMdmParameterValuervValueDestructRvMdmPackageItemRvMdmParameterValuervKeyLessRvMdmPackageItemRvMdmParameterValuervKeyEqualRvMdmPackageItemRvMdmParameterValuervKeyConstructCopyRvIStringRvMdmPackagePtrrvValueConstructCopyRvIStringRvMdmPackagePtrrvKeyDestructRvIStringRvMdmPackagePtrrvValueDestructRvIStringRvMdmPackagePtrrvKeyLessRvIStringRvMdmPackagePtrrvKeyEqualRvIStringRvMdmPackagePtrrvKeyConstructCopyRvIStringRvMdmSignalInforvValueConstructCopyRvIStringRvMdmSignalInforvKeyDestructRvIStringRvMdmSignalInforvValueDestructRvIStringRvMdmSignalInforvKeyLessRvIStringRvMdmSignalInforvKeyEqualRvIStringRvMdmSignalInforvKeyConstructCopyRvIStringRvMdmEventInforvValueConstructCopyRvIStringRvMdmEventInforvKeyDestructRvIStringRvMdmEventInforvValueDestructRvIStringRvMdmEventInforvKeyLessRvIStringRvMdmEventInforvKeyEqualRvIStringRvMdmEventInforvCCProviderMdmPrintMediarvMdmStreamDescriptorSetModervCCTerminalMdmUpdateRtpMediarvCCConnMdmGetTerminalImplrvSdpMsgClearSessionTimervCCTerminalMdmGetMediaCapsrvCCTerminalMdmGetMediaStreamrvIppMdmExtConnectionDestructedCBrvCCConnMdmClearrvCCTerminalResetActiveConnectionrvCCTerminalSetLineIndrvCCTerminalSendLineActivervCCTerminalStartDialToneSignalrvCCTerminalSetWaitForDigitsrvCCTerminalMdmGetLastDigitrvCCTerminalMdmIsFirstDigitIppTimerStoprvCCTerminalIsDtmfPlayEnabledrvCCTerminalStartDTMFTonervCCTerminalStopDTMFTonervCCTerminalStartCallWaitingCallerSignalrvCCTerminalStartRingbackSignalrvCCConnectionCheckPartyMediarvCCTermConnProcessEventsrvIppMdmExtPreProcessEventCBrvCCConnectionStateMachinervCCProviderMdmGetDisplayDatarvCCConnectionDisplayrvIppMdmExtPostProcessEventCBrvCCConnectionSetCFAddressrvCCConnMdmProcessEventIppTimerConstructrvCCConnMdmNoReplyTimerIppTimerDestructrvCCTerminalGetActiveAudioTermrvCCTerminalStartBusySignalrvMdmTermGetXTerm_rvCCConnMdmGetEphXTermrvCCTerminalMdmGetTermMgrrvMdmTermMgrDisconnectMediaStreams_rvCCConnMdmDisconnectMediarvMdmTermDestroyMediaStream_rvMdmTermMgrDeleteEphTerm_rvCCTerminalMdmClearMediaStreamrvMdmTermMgrUnregisterTerminationrvCCTerminalMdmOtherAlertingConnExistrvCCConnMdmReleaservCCTerminalStopRingingSignalrvMdmMediaStreamInfoModifyMediaDonervMdmMediaStreamInfoGetIdrvMdmMediaStreamInfoSetIdrvMdmErrorConstruct_rvCCConnMdmGetMediaCapsrvCCTerminalMdmAddEmptyMediaStreamsetDefaultMediarvCCTerminalMdmCreateMediarvMdmTermMgrConnectMediaStreams_rvCCConnMdmConnectMediarvCCTerminalMdmSelectRtpTermrvMdmMediaStreamInfoIsRemoteDescriptorSetrvCCConnMdmCreateMediarvCCProviderCreateConnectionrvCCTerminalSetHoldIndrvCCTerminalSetMuteIndrvCCTerminalClearDisplayrvCCTerminalSetDisplayrvTreeInfoRvCharPtrRvCCTerminalPtrrvCCTerminalMdmLoadPhoneNumbersrvCCTerminalMdmLoadPresentationInforvMdmTermQueueUnregTermEvent_rvMapBeginRvCharPtrRvCCTerminalPtrrvMdmTermGetType_rvMapEndRvCharPtrRvCCTerminalPtr_rvMapIterGetValueRvCharPtrRvCCTerminalPtr_rvMapIterGetKeyRvCharPtrRvCCTerminalPtrrvCCTextTermTypervCCTerminalMdmDestructrvCCProviderFindTermByTypervCCProviderDisconnectAtTermFromUirvCCProviderMdmRemoveTerminalrvCCTerminalSetActiveAudioTermrvCCTerminalMdmConstructrvCCTerminalMdmAnlgFuncsrvCCTerminalMdmFuncsrvCCProviderConnectAtTermToUirvMdmTermDefaultPropertiesConstructrvCCProviderMdmCreateTerminalrvMdmTermDefaultPropertiesDestructrvMdmTermConstruct_rvMdmXTermClbksrvSdpMsgEncodeToBufrvCCProviderFindTerminalByAddressrvMdmStreamDescriptorGetModervCCConnMdmRingbackrvCCConnMdmDisconnectingrvCCConnMdmGetMediarvCCConnMdmMakeCallrvCCConnMdmRejectrvCCConnMdmCallAnsweredrvCCConnMdmSetRemoteMediarvCCConnMdmSetLocalMediarvCCConnMdmRestartMediarvCCConnMdmAddressAnalyzervCCConnMdmJoinConferencervCCConnMdmLeaveConferencervCCConnMdmTransferOfferedrvCCConnMdmTransferConnectedrvCCConnMdmIsTransferedConnrvCCConnMdmTransferInitrvCCConnMdmGetCallerNamervCCConnMdmGetCallerIdrvCCConnMdmGetCallerAddressrvCCConnMdmGetCallerNumberrvCCConnMdmTerminatervCCConnMdmModifyMediarvCCConnMdmModifyMediaDonervCCConnTermMdmHoldrvCCConnTermMdmUnholdrvCCConnTermMdmRemoteHoldrvCCConnTermMdmRemoteUnholdrvCCConnTermMdmSetHoldIndicatorrvCCConnMdmDisplayrvCCConnTermMdmPlayDtmfrvCCConnTermMdmSetMuteIndicatorrvCCConnTermMdmMutervCCConnTermMdmUnmutervMdmTermMgrClbksrvMdmTermMgrRegisterXTermMgrClbks_rvCCConnMdmInitiatedCBrvCCConnMdmDialingCBrvCCConnMdmNewDigitCBrvCCConnMdmCallAnsweredCBrvCCConnMdmCallDeliveredCBrvCCConnMdmOfferedCBrvCCCallConferenceJoinedCBrvCCConnMdmTransferOfferedCBrvCCConnMdmTransferInitCBrvCCCallSendUserEventCBrvMdmTermMgrGetPackagervMdmDigitMapBuildDDEvCompletervMdmDigitMapTranslateDDEventrvMdmControlStartedIppQueuePoprvMdmTermProcessBlockedEventloadTerminalPropertiesrvMdmTermQueueRegisterTermEventrvCCTerminalSetWaitForOffHookrvCCTerminalInstallDigitMaprvMdmTermEventMoveSignalsrvMdmTermEventStopSignalsrvMdmPackageItemGetItemrvMdmEventSetParameterrvMdmRequestedEventConstructrvMdmTermProcessNewSignalsrvCCTerminalMdmStartSignalAudiorvMdmParameterListConstructrvCCTerminalMdmStartSignalUIrvMdmParameterListOrrvDtmfAddParamrvMdmTermProcessEventsrvMdmTermActivateDigitMaprvMdmTermGetDigitMaprvMdmTermProcessDigitMapParameterrvMdmTermProcessDigitMaprvMdmTermQueueObsEventrvMdmDigitMapMatchrvMdmTermPhoneNumbersAddrvMdmTermGetUserDatarvMdmTermSetUserDatarvMdmTermMgrSelectTermination_rvCCTerminalSetEphemeralActiveConnectionrvMdmDigitStringConstructrvMdmDigitPositionConstructrvMdmDigitPositionAddEventsrvMdmDigitStringAddElementrvMdmDigitMapAddPatternrvMdmDigitStringClearrvMdmTermAddDigitMaprvMdmDigitMapDBConstruct_RvListRvMdmCurSignalConstruct_RvListRvMdmCurSignalListConstruct_RvListRvMdmObservedEventConstructrvCCConnMdmConstructrvCCConnectionSetLineIdrvMdmTermDigitMapTimerConstructrvMdmTermPostEventsetTermDefaultDigitMaprvCCTerminalMdmDialToneTimerExpiredrvMdmDigitMapDBDestruct_RvListRvMdmCurSignalClear_RvListRvMdmCurSignalListClear_RvListRvMdmObservedEventClearrvCCCallTerminatedCBrvCCConnMdmDestructIppThreadSleeprvMdmTermDigitMapTimerDestructrvCCTerminalEnd_RvVectorRvMdmMediaStreamInfoClearrvMdmMediaStreamInfoCreateMdmMediarvMdmMediaStreamInfoUpdateMdmMediarvCCTerminalMapEventrvMdmEventGetNamervMdmEventSetParametersListrvCCTerminalProcessEventIdrvCCTerminalMdmMapEventrvDtmfAddParamAnlgrvIppMdmConnGetTypervIppMdmConnGetConnectPartyrvCCConnectionGetRemotePresentationInfo_RvVectorRvMdmMediaStreamInfoClear__RvVectorRvMdmMediaStreamInfoCopy__RvVectorRvMdmMediaStreamInfoReserve_RvVectorRvMdmMediaStreamInfoFillrvMdmStreamDescriptorGetParameterListrvMdmStreamDescriptorGetReserveValueModervMdmStreamDescriptorGetReserveGroupModervMdmMediaStreamDescrConstruct_rvMdmStreamDescriptorGetIdrvMdmMediaStreamInfoEqualrvMdmStreamDescriptorSetIdrvMdmMediaStreamDescrGetLocalDescrrvMdmStreamDescriptorAddEmptyLocalDescriptorrvSdpMsgListCopyrvMdmMediaStreamDescrGetRemoteDescrrvMdmStreamDescriptorAddEmptyRemoteDescriptorrvMdmTermCreateMediaStream_rvMdmTermModifyMediaStream_rvMdmTermModifyMediaDone_rvTreeInfoRvIStringRvMdmDigitMap_rvMapConstructRvIStringRvMdmDigitMap_rvMapGetValueRvIStringRvMdmDigitMap_rvMapSetValueRvIStringRvMdmDigitMaprvMdmDigitMapDescriptorIsSet_rvMapRemoveRvIStringRvMdmDigitMaprvMdmTermDigitMapTimerProcessrvMdmDigitMapGetStartTimeoutrvMdmRequestedEventGetEmbDigitMaprvStringResizervMdmTermMgrGetDigitMapPkgInfo_setCurrentDigitMap_RvListRvMdmObservedEventInsert_RvListRvMdmObservedEventPopFront_RvListRvMdmObservedEventPushBack_RvListRvMdmObservedEventErase_RvListRvMdmObservedEventSplicervMdmEventGetStreamIdIppQueuePush_RvListRvMdmObservedEventAllocBackrvCCTerminalMdmSetMediaEventDatarvMdmObservedEventConstructArvMdmTimeStampConstructCurrentTimervMdmEventSetStreamIdrvMdmRequestedEventGetEmbSignalsrvMdmTermProcessSignalsrvMdmRequestedEventGetEmbEventsrvStringPushBackrvMdmTermMatchDialString_rvMdmTermDigitMapTimerRestartrvCCTerminalMdmProcessEventrvCCTerminalMdmGetMediaEventDatarvMdmTermProcessObsEventrvMdmTermRegisterPhysTermDone_rvMdmTermUnregisterTermDone_rvMdmEventsDescriptorIsSetrvMdmTermClearDetectedEvents_rvMdmTermIsPkgSupported_rvMdmTermMgrGetEventInfo_rvMdmErrorGetMsg_rvMdmErrorGetCode_rvMdmParameterValueGetTypervMdmParameterListGetSizeparamListChangedrvMdmSignalConstruct_rvMdmTermStopSignal_rvMdmTermTimerCancelRvMdmCurSignalEqual_RvListRvMdmCurSignalEraseRvMdmCurSignalConstructCopy_RvListRvMdmCurSignalInsert_RvListRvMdmCurSignalSplice_RvListRvMdmCurSignalPopFront_RvListRvMdmCurSignalPushBack_RvListRvMdmCurSignalAllocBackrvMdmTermMgrGetSignalInfo_rvMdmSignalExGetTypervMdmSignalExGetDurationrvMdmTermPlaySignal_rvMdmTermStartSignal_RvMdmCurSignalListConstructCopy_RvListRvMdmCurSignalListInsertrvMdmSignalExListGetIdrvMdmCurSignalListEqualrvMdmCurSignalListDestruct_RvListRvMdmCurSignalListErase_RvListRvMdmCurSignalListSplice_RvListRvMdmCurSignalListPopFront_RvListRvMdmCurSignalListPushBackrvMdmTermTimerCreatervMdmSignalExListGetSizervMdmSignalExListGetElemrvMdmSignalsDescriptorGetSignalList_RvListRvMdmCurSignalListAllocBackrvMdmSignalsDescriptorIsSetgetStopReasonmdmProviderRegisterRootTermmdmProviderClearTermmdmDummyDestructmdmProviderForEachPhysTermrvKeyConstructCopyRvCharPtrRvCCTerminalPtrrvValueConstructCopyRvCharPtrRvCCTerminalPtrrvKeyDestructRvCharPtrRvCCTerminalPtrrvValueDestructRvCharPtrRvCCTerminalPtrrvKeyLessRvCharPtrRvCCTerminalPtrrvKeyEqualRvCharPtrRvCCTerminalPtrterminalMdmQueueEventterminalMdmSignalCompletedterminalMdmGetTermTypeterminalMdmGetTermIdterminalMdmMatchDigitMaprvCCTerminalMdmIsAudioTerminationExistrvCCTerminalMdmSetActiveAudiorvCCTerminalMdmGetActiveAudiorvCCTerminalMdmSetActiveAudioTermrvCCTerminalMdmStopSignalsrvCCTerminalMdmStartDialToneSignalrvCCTerminalMdmStartRingingSignalrvCCTerminalMdmStopRingingSignalrvCCTerminalMdmStartRingbackSignalrvCCTerminalMdmStartCallWaitingSignalrvCCTerminalMdmStartCallWaitingCallerSignalrvCCTerminalMdmStartBusySignalrvCCTerminalMdmStartWarningSignalrvCCTerminalMdmStartDTMFTonervCCTerminalMdmStopDTMFTonervCCTerminalMdmSetHoldIndrvCCTerminalMdmSetMuteIndrvCCTerminalMdmSetAudioIndrvCCTerminalMdmSetLineIndrvCCTerminalMdmSendLineActivervCCTerminalMdmSetDisplayrvCCTerminalMdmClearDisplayrvCCTerminalMdmSendCallerIdrvCCTerminalMdmSetWaitForOffHookrvCCTerminalMdmSetWaitForOnHookrvCCTerminalMdmGetDialStringrvCCTerminalMdmInstallDigitMaprvCCTerminalMdmIsOutOfBandDtmfEnabledrvCCTerminalMdmIsDtmfPlayEnabledrvCCTerminalMdmAnlgGetTermIdrvCCTerminalMdmAnlgIsAudioTerminationExistrvCCTerminalMdmAnlgSetActiveAudiorvCCTerminalMdmAnlgGetActiveAudiorvCCTerminalMdmAnlgSetActiveAudioTermrvCCTerminalMdmAnlgGetActiveAudioTermrvCCTerminalMdmAnlgStopSignalsrvCCTerminalMdmAnlgStartDialToneSignalrvCCTerminalMdmAnlgStartRingingSignalrvCCTerminalMdmAnlgStopRingingSignalrvCCTerminalMdmAnlgStartRingbackSignalrvCCTerminalMdmAnlgStartBusySignalrvCCTerminalMdmAnlgStartWarningSignalrvCCTerminalMdmAnlgStartDTMFTonervCCTerminalMdmAnlgStopDTMFTonervCCTerminalMdmAnlgSetDisplayrvCCTerminalMdmAnlgClearDisplayrvCCTerminalMdmAnlgSetWaitForOffHookrvCCTerminalMdmAnlgSetWaitForOnHookrvCCTerminalMdmAnlgSetWaitForDigitsrvCCTerminalMdmAnlgMapEventrvCCTerminalMdmAnlgInstallDigitMaprvKeyConstructCopyRvIStringRvMdmDigitMaprvValueConstructCopyRvIStringRvMdmDigitMaprvKeyDestructRvIStringRvMdmDigitMaprvValueDestructRvIStringRvMdmDigitMaprvKeyLessRvIStringRvMdmDigitMaprvKeyEqualRvIStringRvMdmDigitMaprvCCCallMgrConstructAIppQueueConstructrvCCCallMgrDestructIppQueueDestructg_basePhonervCCBasePhoneGetMdmProviderrvCCProviderMdmProcessTerminationEventdestroyMsgSocketsvoipIppCommCBRvQueueConstructRvQueueDestructcreateMsgSocketsRvQueueSendRvQueueReceiveRvTimerNotInUseapplicationTablehuntGroupTablecacGetTermByNumberrvCCH323PhoneGetMdmTermcreateNewMdmConnectionfindDestinationAddresscreateNewH323ConnectionrvCCCallConnectrvCCConnectionCallAnsweredcacSetOwnNumberrouteAppCreateConnFrouteAppRouteFrouteAppAlertingFrouteAppConnectedFrouteAppDisconnectedFhuntGroupAppDisconnectedFdialplanAppRegisterhuntGroupAppCreateConnFhuntGroupAppAlertingFhuntGroupAppRouteFhuntGroupAppConnectedFdialplanAppUnregisterhuntGroupAppDeleteGroupgroupArrayrvCCCallConferenceLeftrvCCCallConferenceCanceledrvCCCallTransferRemotervCCCallTransferCanceledconfig_voipCfgg_h323PhoneConfigvoip_cfg_lockvoip_cfg_unlockdbg_scanintg_ippLogOptionsRvLogGetSourceByNameRvLogSourceSetMaskRvOsMemPrintInfovoipSecuritySetCallbacksdelete_voipCfgdialplanPortToIndexdialplanIndexToPortadd_voipCfgg_del_prefixesg_mod_prefixestempDialplanEntryg_prefixesg_display_dialplan_portsg_dialplan_portsdialplanEntryDeletedialplanEntryInitaddSSInDialplandialplanUpdatedg_mod_profileIdg_profile_portsservice_types_pwservice_types_adservice_types_allcodec_typesRTP_PT_NTERTP_PT_G726_16RTP_PT_G726_24RTP_PT_G726_32RTP_PT_G726_40incFxoDestPortToIndexg_incFxoDest_portsincFxoDestIndexToPortvdsp_dect_configg_fax_transport_typestt_dscp_valuestt_precedence_valuesg_stats_portsxtm_time_date_strclear_voipCfgupdateProfileInDialplantempProfileEntrycheckE164Numberg_e164vdsp_get_country_namesvoip_trace_enabledclick2DialPortToIndexg_click2dial_portsclick2dialIndexToPorth323_dbg_helpvdsp_set_relayvdsp_send_signalvoipHandleDspEventg_port_typesg_phonesdialMgrPrintDialStatecallMgrPrintConnStatecallMgrPrintLineStatecallMgrPrintCallDirectionvkapi_infodbg_voip_ssdbg_vdsp_sedbg_scanstrh323_dbg_cmdvdsp_get_capabilitiesRTP_PT_G711URTP_PT_G711ARTP_PT_G722RTP_PT_G723RTP_PT_G729h323_cmd_initvdsp_get_current_countrytagp_register_param_typedbg_linkh323_saveeonIndicationToIndexg_e164Numbersg_e164NumbersTableg_profileIdg_profileIdTableg_voipGatewayrvMdmTermMgrFindTerminationg_prefixesTablegetCommonNumberProfileIndexgetPortTypeg_nbrOfPhonesabortClickToDialChannelXcallMgrGenerateCIDStrhandleClickToDialChannelXvoice_sndevent_on_globalregstatusvoice_sndevent_on_profilestatusrtpLinkSetPortRangeg_voipAppCfgStackvoice_sndevt_update_callstateg_ippCfgStackvoice_sndevt_update_tr104_callstatevkapi_update_modephonebookUpdatedsortPbvoice_sndevent_add_delconfigTimerCBisT38Supportedvdsp_driver_runningvoip_start_dspvoip_stopstartConfigTimervoip_stop_dspvoip_startvoipIppUpdatevoipAppUpdatevoip_cfg_start_phoneringtestxtm_changetimerg_modemIntfvoipGatewaySetIpAddressxr_get_randomifm_set_phys_parsvoice_atom_mbus_plugin_initvoip_atom_mbus_getcontextg_commSockg_netlinkSockget_current_stagevoipMbusInitvoipGatewayStopvoipGatewayStartdectSubsActivevoipMiniResetFXODeinitstop_dsp_driverFXOInitstart_dsp_driverFXOResetRelayStateFXODisconnectRelayWaitLoopOpenisVoipMiniActivevoipMiniIDTExpiredialMgrEventphoneLinkRingBackTmrExpiredFXOUpdateRelayWaitLoopOpenabortClickToDialvkapi_initvoip_cfg_initvoipServiceInitvoipGatewayInitvoipAppl_idt_voipTaskvoipMiniInitsendEventToMsgSocketUserphoneLinkNotifyIncRtpvkapi_restore_LEDcallMgrHandleEventvoipMiniHandleEventcallMgrHandleSignalphoneLinkStartSignalCBvdsp_create_dcnxvdsp_modify_dcnxvdsp_delete_dcnxinterDigitTmrCBhookFlashTmrCBfxoDisconnectTmrCBdelayedByeTimerCBringbackTmrCBrvMdmTermMgrCreateTermClassrvMdmTermClassRegisterCreateMediaCBphoneLinkCreateMediaCBrvMdmTermClassRegisterModifyMediaCBphoneLinkModifyMediaCBrvMdmTermClassRegisterDestroyMediaCBphoneLinkDestroyMediaCBrvMdmTermClassRegisterStartSignalCBrvMdmTermClassRegisterStopSignalCBphoneLinkStopSignalCBrvMdmTermClassRegisterMatchDialStringCBphoneLinkMatchDialStringCBrvMdmTermClassRegisterMapDialStringToAddressCBphoneLinkMapDialStringToAddressCBrvMdmTermClassRegisterPlaySignalCBphoneLinkPlaySignalCBrvMdmTermClassRegisterUnregisterTermCompletedCBphoneLinkUnregisterCompletedCBrvMdmTermMgrRegisterIPPhoneUiPackagesrvMdmTermClassSetAnalogLinePackagesprofilePortToDialplanPortphoneLinkStartTonervMdmTermPropertiesSetPhoneNumbersrvMdmTermMgrRegisterPhysicalTerminationphoneLinkInitPresentationInforvMdmTermPropertiesSetPresentationInfohuntGroupAppAddGroupgetCommonDectNumberProfileIndexphoneLinkInitPhoneInfophonelinkSetPresentationInfohuntGroupAppAddMembercacAddTerminationphonelinkRegisterCommonNumberrvH323ControlRegisterClientphoneLinkStopInterDigitTmrphoneLinkStopHookFlashTmrphoneLinkStopFxoDisconnectTmrphoneLinkStopRingbackTmrvoipMiniSetActivervMdmTermMgrForEachPhysicalTermphoneLinkUnregisterPhonephoneLinkReplaceStarAndHashphoneLinkStartInterDigitTmrrtpLinkUpdateDtmfRelayphoneLinkStopTonephoneLinkStartIncRtpNotifyphoneLinkStartMuteIncRtpphoneLinkStartRingbackTmrphoneLinkStopRingbackTonephoneLinkStopMuteIncRtpdialMgrFindDialplanEntrycodecPriorityArrayrtpLinkIsDataTermfaxAnswerfaxOfferrvMdmTermModifyMediaisCodecAvailablesetPacketTimesetSilenceSuppressionsdpMsgGetDtmfCodecrtpLinkGetSupportedCodecfillReceiveCodingParamsrvSdpMsgListRemoveElementrvSdpMsgRemoveMediaDescrfillSendCodingParamsg_codec_inforvMdmTermGetIdvoipMsgStoprtp_closephoneLinkDeleteDcnxrtpLinkDestroyRtpTermvoipRtpDestroyMediag_rtpInfog_serv_paramvoipRtpCreateMediaCBvoipRtpModifyMediaCBvoipRtpDestroyMediaCBrvMdmTermClassRegisterModifyMediaCompletedCBvoipRtpModifyMediaCompletedCBrvMdmTermClassSetRtpTermPackagesphoneLinkModifyDcnxrtpLinkCalcRtcpBandwidthrtp_bindrtp_openrtp_reserve_portsmsToPackPeriodphoneLinkCreateDcnxrtpLinkBindChannelrtp_set_remote_descrtpLinkModifyChannelrtp_set_portrangeisG729ABSupportedisG7231ASupportedrtpLinkBuildMediaDescrrvSdpMediaDescrCopyrvSdpMediaDescrClearAttrrvSdpConnectionSetAddressrvSdpOriginSetUsernameupdateReceiveCodingParamsrtpLinkModifyRtpTermrvMdmMediaStreamDescrGetModertpLinkSetConnectionModevoipRtpModifyMediarvMdmMediaStreamDescrReportLocalDescrloadMediaCapabilitiesrtpLinkCreateRtpTermvoipRtpCreateMediacheckAndSetRelayStatusphoneLinkInitrtpLinkInitvoipRegTimerCBphoneLinkStopAlertingphoneLinkHanguprvMdmTermMgrStopvoipSecurityDestructcallMgrDestructrvMdmTermMgrDestructIppLogEndrvIppH323SystemEndrvSdpMsgListAddMsgloadMediaParamsrvMdmParameterValueConstructListrvMdmParameterValueAddToListrvMdmTermClassClearMediaCapabilitiesrvMdmTermClassAddMediaCapabilitiesrvMdmTermMgrMediaCapabilitiesUpdatedphoneLinkDestructTermClassphoneLinkRegisterPhonesrvMdmTermMgrRegisterEphemeralTerminationphoneLinkCheckForDataCallvdsp_reserve_complex_coderrvIppMdmTerminalGetActiveConnectionrvIppMdmConnGetLineIdvoipSigPacketSentRecvdrvIppMdmConnGetTerminalrvIppMdmTerminalGetIdrvIppH323SystemInitcacInitIppLogInitvoipH323UpdateConfigStructsrvIppH323RegisterExtClbksrvIppH323PhoneConstructrvMdmTermMgrRegisterSelectTermCBvoipTermMgrSelectTerminationCBrvMdmTermMgrRegisterDeleteEphTermCBvoipTermMgrDeleteEphTermCBrvMdmTermMgrRegisterConnectCBvoipTermMgrConnectCBrvMdmTermMgrRegisterDisconnectCBvoipTermMgrDisconnectCBrvMdmTermMgrSetUserDatacallMgrConstructrtpLinkConstructTermClassphoneLinkConstructTermClassrvMdmTermMgrStartl_serv_typel_servIdl_voipH323_GroupServIdl_voipH323_SignServIdl_voipH323_RasServIdl_voipH323_MultiRasServIdl_voipSip_GroupServIdl_voipSip_UdpServIdl_voipSip_TcpServIdcapi_get_digest_by_idg_securityParamvoipSecurityCallbackrvH323SecuritySetHashFunctionsvoipMD5ChallengecallMgrGetMdmTermrvCCConnectionGetCalledNumbercallNumbercallMgrFindCurrentCallStatsIdxByCallIdcallMgrUpdateCurrentCallStatsRecords_voice_plugin_ctxs_voice_calllogoverview_mbus_objvoice_atom_mbus_calllogoverview_paramsvkapi_update_led_statusrtp_get_statscallMgrGetCallDirectionrvIppMdmConnGetCallerIdrvIppMdmConnGetCallerAddresscallMgrStoreTimestampcallMgrCreateDetailedRecordvoipMsgStartHoldcallMgrSetLineStatervIppMdmRegisterExtClbksuserClbkscallMgrCheckActiveSSrvIppMdmConnGetStatervIppMdmConnGetTermStatecallWaitingActivephoneLinkCallConnectedrvMdmSignalGetPkgrvMdmSignalGetIdrvMdmSignalGetArgumentscallMgrConvRvSignalToVdspphoneLinkStartRingbackToneFXOIsFXSUsedFXOProcessFXOEventdialMgrHandleEventphoneLinkNewOutgoingCallcallMgrConvDigitToRvFXOSetPriorityFXOMakeCallcallMgrReleaseChannelFXOIsRingingFXOProcessFXSOffhookFXOProcessFXSOnhookphoneLinkStartFxoDisconnectTmrFXOIsInCalllineStateStringscallDirectionStringsavailableBandwidthgetBandwidthNeededrvIppMdmConnGetRemotePresentationInforvIppMdmTerminalGetPhoneNumberhuntGroupAppGetGroupscallMgrGetOwnNumbercallMgrGetConnStatecallMgrSetConnStatecallMgrSetDisplayNamecallMgrSetCallDirectioncallMgrSetLineStateIntcallMgrResetSuccessfullCallIndicationcallMgrAddCurrentCallStatRecordcallMgrUpdateCallStatuscallMgrUpdateTr104CallStatecallMgrUpdateCallIdcallMgrRejectCallcallMgrConnStatisticscallMgrSetSuccessfullCallIndicationcallMgrGetLineStatecallMgrGetSuccessfullCallIndicationcallMgrCreateRtcpStatsvoipMceMailphoneLinkUpdateDtmfRelayFXOIsConnectedFXOIsParOffhFXOIsIdleFXOGetPrioritycallMgrReleaseCallcallMgrCheckDspBudgetcallMgrMakeCallcallMgrCheckBandwidthphoneLinkSetClirPermissioncallMgrConvVdspEventToRvdialStateStringscacClearOwnNumberphoneLinkStopIncRtpNotifycacSelectProfilecallMgrIsPortFreedialMgrFxoCallPossiblephoneLinkStartHookFlashTmrFXOSendFlashHookvdsp_get_fxolinestatervSdpMediaDescrAddFormatget_pbcfgset_pbcfgvoice_new_phbookloc_mbus_invoke_event_add_delvoice_serv_deleteSSInDialplanvoice_serv_updateSSInDialplanvoice_serv_check_servicecodevoice_serv_set_servicecode_standardvoice_serv_set_servicecode_nonstandardvoice_serv_set_prefix_servcodevoice_serv_set_statusvoice_serv_set_provisionvoice_serv_get_service_indexvoice_serv_get_service_namevoice_ports_get_configmbus_keystr_decodembus_keystr_encodes_voice_calllog_mbus_objdynstr_fromliteralvoice_atom_mbus_calllog_paramsvoice_protocol_atom_mbus_plugin_initvoipMbusSubscrDhcpOption120UpdvoipMbusSubscrDhcpOption60Updmbus_ctx_freetp_type_ipport_nametp_type_ipportrange_nametp_type_user_nametp_type_dscp_nametp_type_precedence_nameh323_cmdsstackLevelvoipMapUserEventCBvoipConnectionPreProcessEventCBvoipConnectionProcessEventCBSNTPResetAllTimeServerStatessntp_eloop_initsntp_mgmt_sock_createsntp_atom_mbus_initsntp_atom_mbus_getcontextsntp_eloop_register_read_socksntp_eloop_runsntp_eloop_destroysntp_mgt_recv_cmdValidSourceAddrConvert_IPaddress_to_strxtm_isvalidtimextm_gettimezonextm_getdaylightsavingxtm_is_active_DST_timextm_setdaylightsavingxtm_setnetworktimeSNTPResetAllTimeServerSendFlagssntp_eloop_register_timeoutSNTPSearchNewTimeServerSNTPSetTimeServerSendFlag_SNTPIsTimeServerExistSNTPSendRealRequestsntp_eloop_cancel_timeoutSNTPPollProcess_SNTPSetLabelsntp_flushtagp_dbg_cmdtagp_dbg_helpSNTPisNamedServerSupported_SNTPGetEnableDisablesntp_mgt_send_cmd_SNTPSetPollDelay_SNTPGetPollDelay_SNTPRegisterTrapHandler_SNTPServerGetStatusDescription_SNTPServerGetStatusID_SNTPPrintTimeServerTable_SNTPGetFirstServer_SNTPGetNextServer_SNTPSetEnableDisablesntp_servmgmt_set_state_SNTPAddServerAddress_SNTPDelServerAddress_SNTPRemoveEntryByIndexsntp_get_taskidsntp_mgmt_process_cmd_SNTPGetMgmtSockets_myntpdatadynstr_setipaddrloc_ppp_event_handlesntp_subscribe_ppp_statussntp_event_trap_handlermbusd_dmtree_lockmbusd_msg_processmbusd_get_tracembusd_ctx_unregistermbus_datamodel2stringmbusd_dmtree_unlockmbusd_pathstrlist_fromstringmbusd_object_unloadkeysmbusd_object_loadkeysmbusd_dmtree_getbydatamodelmbusd_load_objectsmbusd_dmtree_getatmbus_createlistensocket_localmbus_getcommandlistensocket_inetmbus_getnotifylistensocket_inetmbusd_devconf_button_initmbusd_ctx_handle_pluginreg_donembusd_ctx_loadsync_pluginregobjtypesmbusd_syncloc_msg_processmbus_accept_connection_inet_tcpmemm_refallocllist_delete_byobjectmbusd_dmtree_enum_privatembusd_backup_save_keygenmbus_trigger_enableafterloadmbusd_mode_setmbusd_msg_initmbusd_dynregenumtype_poolidmbusd_dynregobjtype_poolidmbusd_dynregparamtype_poolidmbusd_dynregxreftype_poolidmbus_init_daemonmbus_vtable_initmbusd_authorize_initmbusd_debug_initmbusd_util_initmbusd_enumtype_initmbusd_objtype_initmbusd_paramtype_initmbusd_object_initmbusd_client_initmbusd_dmtree_initmbusd_ccmd_sub_initmbusd_ccmd_add_initmbusd_objvalue_initmbusd_plugin_initmbusd_event_initmbusd_ccmd_match_initmbusd_session_initmbusd_backup_initmbusd_devconf_initmbusd_accessrights_initg_mbusd_ctx_stats_enabledg_mbusd_ccmd_stats_enabledmbusd_backup_new_db_createdmbusd_backup_ar_includedmbusd_backup_importmbusd_backup_load_type_artagp_handle_registered_startup_cmdsmbusd_backup_loadmbusd_backup_registry_loadmbusd_backup_ar_save_requiredmbusd_backup_savembusd_backup_import_and_savepassw_getnextargroup_getnextargroup_getmembernames_2argroup_getmemptrspassw_getpassw_setargroup_getargroup_setmbus_plugin_handle_paramspassw_adduserpassw_deleteuserargroup_addpassw_role_inuseargroup_delargroup_addmemberargroup_delmemberargroup_name2gidarzone_getpointerarzone_getsizearzone_getmaxsizearzone_setsizearzone_is_dirtyarzone_resetdirtypassw_getDefaultUsermbus_creds_initmbus_creds_setsessionidmbus_creds_ipc_setusernamembus_fcapi_invoke_authenticatembus_creds_cleanupmbusd_authorize_allowforctx2mbusd_authorize_allowforctxmbusd_authorize_get_guestgroupidxmbusd_ctx_getgroupidxmbusd_object_getparam_arar_authorize_reqmbusd_authorize_isallowed3mbusd_authorize_isallowed2passw_register_updateDefaultUser_cbmbusd_ctx_isvalidmbusd_ctx_getsessionbyidmbusd_ctx_getdmtreetimestat_starttimembusd_client_ccmdctxstack_pushmbusd_client_haswritelockmbusd_client_cmdstack_depthg_mbusd_ccmd_statsg_mbusd_ccmd_stats_currxt_get_process_idmbus_ccmdgettype_tostringmbus_ccmd_tostringllist_clonembusd_client_writelock_updatelastcmdmbusd_cmddata_update_pathtypembusd_client_handle_writelockmbusd_client_handle_writeunlockmbusd_ccmd_handle_getpathmbusd_ccmd_handle_getmbusd_ccmd_handle_setmbusd_ccmd_handle_addmbusd_ccmd_handle_delmbusd_ccmd_handle_subscribembusd_ccmd_handle_unsubscribembus_fcapi_invoke_prepare_authenticationmbus_fcapi_invoke_terminate_sessionmbusd_client_ccmdctxstack_poptimestat_stoptimetimestat_elapstimembus_fltr_is_meta_datambusd_attr_getbynamembusd_paramtype_getbyindex_or_namembusd_objtype_getdmtreembusd_plugin_convertxrefmbusd_object_getbypathstrlist_remove_atmbusd_objtype_getbynamestrlist_adddynstrmbusd_objtype_getbypathmbus_cmddata_seterrormemm_initpool3mbusd_getxrefpathtype_fromcmddatastrlist_getlengthllist_getandremove_atmbusd_object_getbypathstrmbusd_objtype_getallbysubpathmbusd_objtype_getpathllist_addrefllist_delete_atstrlist_delete_atmbusd_object_enum_privateloc_ccmd_getpointers_no_wilcardloc_ccmd_getpointers_no_wildcard_objtypetreembusd_ctx_registermbusd_objtype_issingletonmbusd_object_count_byobjtypembusd_object_getflags_fromcmddatambusd_object_callocmbusd_ccmd_is_nonpersistentmbusd_dmtree_getnextextidmbusd_object_addobjectmbusd_object_deleteobjectmbus_cmddataerror_fromerrormbusd_ccmdset_addpluginobjectmbusd_ccmd_getpointersmbusd_ccmd_validate_fltrmbusd_apply_filterllist_get_firstmbus_cmddata_clonembusd_getpathtype_fromcmddatambusd_object_getpathstrmbusd_object_deleteobject2mbusd_cmddata_movembusd_client_callbackmbusd_ccmdset_getpointersmbusd_ccmdset_validate_setllist_move_byobjectmbusd_cmddata_move2replymbus_cmddata_callocmbusd_attr_getmbusd_ctx_getrootobjectmbus_fltr_get_meta_fltrmbus_fltr_evalmbusd_object_setdirtyparammbusd_object_isdirtyparammbusd_paramtype_enum_privatembusd_plugin_handlecommandmbusd_attr_getbyidmbusd_objtype_getpathstrmbusd_objtype_enumcbmbusd_object_enumcb_pathmbusd_object_enumcbloc_handle_get_objectmbus_fltr_get_data_fltrmbusd_object_add_and_loadllist_enum_bytypembusd_object_getbytypeandnamembusd_authorize_isallowedloc_handle_get_objectlistmbusd_object_getpath_bytypenamestrmbus_fltr_equalmbusd_plugin_handlecommand_pifmbusd_ccmd_has_subscriptionflagsmbusd_ccmd_getpointers_objtypetreeloc_handle_get_objtypembusd_ccmd_handle_get_paramtype_perobjectargroup_name2bitnrmbusd_mode_isloadingar_consistency_checkmbusd_paramtype_poolidar_compose_reqmbusd_object_setparam_arar_clone_reqmbusd_backup_get_contextdynstr_getlongmbusd_enumtype_containsmbusd_object_getdmtreembusd_plugin_resolve_xrefvaluellist_enum_bytype_nolockllist_insert_atmbusd_object_validate_namembusd_object_applyobjectmbusd_ctx_getnamembusd_ccmd_handle_set_perobjectmbusd_event_fire_perobjectmbusd_ccmdset_getpointers_objtypetreeloc_setattr_objectlistmbus_cmddata_isdelayedmbusd_client_writelockdelaylist_add_cmddatambusd_subscription_poolidmemm_getfirstmemm_getnextmbusd_paramtype_del_subscriptionmbusd_paramtype_add_subscriptionloc_sub_cmddata_clonememm_initpool2ar_get_accesslistmbusd_paramtype_getstrdynstr_setboolllist_unlink_byobjectmbusd_devconf_handlembusd_session_poolidmbus_context_poolidloc_client_handle_referencembus_ctx_ccomm_addskiptotalar_preauthenticate_reqmbusd_session_createar_authenticate_reqmbusd_ctxreadset_removembusd_objtype_poolidmbusd_objtype_deleteobjtypembus_dlinktype2stringmbusd_session_state2stringmbusd_dmtree_getlengthllist_searchobjectmbusd_ctx_getbyidmbusd_backup_load_bytypesllist_remove_atmbusd_dmtree_poolidmbusd_object_poolidmemm_printobjectmbusd_getnamembusd_dmtree_addmbusd_enumtype_poolidllist_free_plistdynstr_isdynstringmbusd_enumtype_enum_privatestrlist_enum_dynstrmbusd_enumtype_listmbusd_ctx_getenumtypesmbusd_enumtype_getbynamembusd_dmtree_addenumtypeloc_enumtype_free_exmbus_event_type2stringloc_event_clonembusd_getpathtype_fromsubmbus_cmddata_clone_selectivembusd_paramtype_getbynamembusd_object_getbysubpathmbusd_objtype_getbysubpathstrstrlist_addrefmbusd_backup_save_nowaitmbusd_client_writelock_saveonunlockmbusd_msg_send_eventmbusd_new_eventmbus_cmddata_error2stringmbusd_event_fire_params_1evmbusd_event_fire_params_1submbus_createconnect2peer_inet_tcpmbus_dynstr_fromaddrserbin_deserialize_registermbus_sererror2mbuserrormbus_socktype2dlinkmbus_register_cleanupmbusd_ctxreadset_addgetpwuidmbus_fcapi_invoke_pluginreg_doneserbin_deserialize_ccmdmbus_fcapi_invoke_ccmd_subscribembus_fcapi_invoke_ccmdserbin_serialize_ccmdserbin_deserialize_pregenumtypesmbusd_plugin_regenumtypesserbin_deserialize_pregobjtypesmbusd_plugin_regobjtypesserbin_deserialize_eventmbusd_event_appendfrompluginserbin_serialize_msgreplymbus_add_msg_headermbus_send_datambus_addr_cleanupmbus_receive_datambus_reconstruct_msg_headermbus_dlink2socktypembus_msgtype2stringmbus_validate_msgreply_headerserbin_deserialize_msgreplymbus_msghdr_cleanupmbus_get_listenserbuffermbus_reconstruct_msg_header_exmbus_get_new_transactionidmbus_getlock_sendserbufferserbin_serialize_pcmdmbus_pcmd_tostringmbus_pcmd_cleanupserbin_deserialize_pcmdmbus_ungetlock_sendserbuffermbus_get_eventsendserbufferserbin_serialize_eventstrlist_addulongllist_unlink_atllist_enumcb_bytypembusd_backup_get_localidxmbusd_backup_save_localidxmbus_bulletllist_search_byobjectmbusd_dmtree_getbyobjectmbusd_client_hijack_writelockmbusd_plugin_invokembusd_client_unhijack_writelockmbusd_backup_object_deletear_fromstringar_addtodynstrar_isequalmbusd_object_calloc2mbusd_objtype_getallbysubpathstrmbusd_object_getallbytypeandnamembusd_object_getallbylocalidxmbusd_object_getbylocalidxmbusd_eventing_disablembusd_object_getpathmbusd_eventing_enablembusd_objtype_enum_privatembusd_objectindex_poolidmbusd_objtype_getmaxobjectsmbusd_paramtype_listmbusd_objtype_getbysubpathloc_delete_nbrofentries_subsmbusd_ctx_getrootobjtypembusd_validate_nameloc_objtype_copy_flagsmbusd_objtype_addparamtypembusd_paramtype_registermbusd_mode_objtypesregisteredmbusd_mode_getmbusd_dmtree_add_newlyregistered_objtypembusd_objvalue_poolidloc_objvalue_free_exmbusd_plugin_invoke_cmdmbusd_xreftype_poolidloc_paramtype_free_exloc_xreftype_free_exmbus_objtype_has_cached_paramtypembusd_eventing_is_disabledmbus_updated_ro_param_eventmbus_object_add_del_eventmbus_object_dirty_eventmbusd_objvalue_getvaluebyparamtypembus_plugin_2_cmddata_errormbusd_objvalue_setbyparamtypembusd_paramtype_xreftype_resolvestrlist_todynstrmbusd_cmddatalist_seterrormbusd_msg_send_pcmdmbusd_ctx_getccmdctxmbusd_ctx_getnamebyidmbusd_plugin_pcmd_initmbus_fltr_poolidllist_get_bytypembusd_objvalue_unsetbyparamtypeandvalueprefixmbusd_objvalue_addbyparamtypembusd_client_writelockdelaylist_getorivaluestrlist_fromdynstrmbus_fltr_uses_meta_datambusd_enumtype_registermbus_strlist_from_ppath_listmbusd_objtype_registermbusd_client_getwritelockownermbus_ctx_create2mbus_ctx_create_name_extended2mbusd_xmldump_filename_ltsqlite3_vmprintfsqlite3_prepare_v2sqlite3_bind_nullsqlite3_bind_intsqlite3_bind_textsqlite3_finalizesqlite3_get_tablesqlite3_free_tablesqlite3_errmsgsqlite3_column_typesqlite3_column_intsqlite3_column_textsqlite3_column_bytessqlite3_column_blobsqlite3_stepsqlite3_resetstrtoldynstr_fromstrlist_escapedmbusd_backup_registry_savesqlite3_last_insert_rowidllist_sortmbusd_imex_export_paramfflushstrlist_fromstring_escapedmbusd_ccmd_handle_get_objectmbusd_imex_export_objectmbusd_devconf_confsaved_setmbusd_devconf_confsaved_unsetmbusd_accessrights_zones_isdirtymbusd_accessrights_zones_getsizembusd_accessrights_zones_getpointersqlite3_bind_blobmbusd_accessrights_zones_resetdirtysched_get_priority_minmbusd_devconf_confloaded_unsetmbusd_accessrights_zones_getmaxsizembusd_accessrights_zones_setsizembusd_devconf_confloaded_setfdopenmbusd_imex_importpopenpclosembus_ctx_setflagsmbusd_backup_checkdbmbusd_devconf_rewindEVP_CIPHER_CTX_initEVP_bf_cbcEVP_CipherInit_exEVP_MD_CTX_initEVP_sha1EVP_DigestInit_exEVP_DigestUpdateEVP_CipherUpdateEVP_CipherFinal_exEVP_DigestFinal_exEVP_CIPHER_CTX_cleanupEVP_MD_CTX_cleanupfsyncERR_load_crypto_stringsERR_get_errorERR_reason_error_stringmbusd_reset_to_factory_defaultsmbusd_backup_save_asyncmbusd_backup_save_ccmdmbus_client_convert_query_stringmbus_ccmd_set_lastrequest_filtermbus_client_filter_parsembus_ccmd_add_setaccessrights_requestmbus_fcapi_ctx_creatembus_fcapi_ctx_create_name_extendedmbus_fcapi_invoke_registermbus_fcapi_invoke_unregistermbus_fcapi_invoke_regenumtypesmbus_fcapi_invoke_regobjtypes_pifmbus_fcapi_invoke_event_updated_ro_parammbus_fcapi_invoke_event_object_add_delmbus_fcapi_invoke_event_object_dirtywaitpidmbus_invoke_event_update_subscr_idmbus_invoke_event_update_proc_idmbus_invoke_event_update_statembus_trigger_lockmbus_trigger_set_statembus_trigger_set_procidmbus_trigger_unlockmbus_ctx_getdatamodelmbus_trigger_state2stringmbus_trigger_getkeystringmbus_trigger_getkeystring2mbus_trigger_set_subscridmbus_trigger_enablembus_trigger_enum_privatellist_insert_list_atforksysconfexeclmbus_trigger_fireactionmbus_trigger_plugin_initmbus_trigger_search_bykeystringmbus_trigger_search_byidmbus_trigger_newmbus_trigger_killactionmbus_trigger_enum_byctxmbus_trigger_getmbusd_basenamembus_ctx_setmbusdaddr_localmbus_trigger_deleteutil_systemupgraded_traceupgraded_lbiconfig_data_read_filetypeupgraded_get_fileinfostr_FAILEDconfig_data_write_filetypestep_definitionupgradedupgraded_scenariostep_definition_SNuNstep_definition_SNuRstep_definition_SRuNstep_definition_SRuRhco_boot_setmodeupgraded_set_errorconfig_data_write_stepimage_config_data_writehttp_config_data_writeconfig_data_read_attemptconfig_data_read_max_attemptconfig_data_write_attemptupgraded_get_trc_levelconfig_data_write_trace_levelconfig_data_read_trace_levelupgraded_set_trc_levelconfig_data_read_expectedmodestr_SUCCESSupgraded_system_rebootupgraded_set_statuspppd2_get_paramsloc_reboot_timer_doloc_reboot_timerconf_set_intconf_get_intconfig_data_read_httphttp_connect_to_serverhttp_download_memory_rangehttp_download_file_fullhttp_close_connectionstr_auth_errorLBI_new_imageLBI_read_imageLBI_verify_imageLBI_get_infoLBI_free_imagefilenohco_upgrade_write_imagemunmapupgraded_client_get_charLBI_get_header_sizeLBI_get_image_typestrcasestrupgraded_plugin_getcontextupgraded_client_exitcreate_lockstr_UPGRADE_PLUGINupgraded_trace_initconfig_data_initupgraded_appl_initupgraded_plugin_initupgraded_client_initplatform_status_changedupgraded_plugin_status_changedutil_handle_ledutil_update_errorcode_modeconfig_data_write_errorloc_set_error_exstr_internal_errorstatemachine_start_workerloc_is_error_setloc_is_init_doneimage_unlock_configupgraded_kickloc_init_doneupgraded_tagp_doneupgraded_client_rebootstr_trc_prefiximage_lock_configupgraded_get_statusstatemachine_stop_workerhttp_resetstr_err_cwmpdynstr_resetplatform_appl_initplatform_statemachine_initconfig_data_read_presentconfig_data_read_errorconfig_data_read_steploc_set_error_firstimage_config_data_readhttp_config_data_readconfig_data_write_imageconfig_data_read_imagestr_mbusd_atomicwait_for_lockhl_closehl_Call_addRangefwritehl_Call_cleanRangeshttp_downloadutil_resolve_ipstr_conn_xfer_errorconfig_data_write_httpstr_infostr_errstr_warnstr_dbgaction_list_startaction_list_stopupgraded_client_get_uintxsm_getcountupgraded_client_checkd_startloc_wait_for_checkupgraded_client_checkd_stopstatemachine_sda_cb_servicechkupgraded_acc_enableupgraded_acc_service_chkupgraded_get_error_codeupgraded_get_error_desc_dynstrupgraded_acc_attemptupgraded_acc_trace_levelimage_acc_urlimage_acc_usernameimage_acc_passwordimage_acc_keystr_Upgradeutil_init_mbus_ctxmbus_invoke_pluginreg_doneloc_client_parse_reply_listloc_client_setvaluestatemachine_servicechk_eventloc_client_unsubscribeloc_client_getvalueloc_client_subscribeloc_set_one_paramstr_UPGRADE_CLIENTupgraded_imageconfig_data_write_expectedmodeconfig_data_write_max_attemptstatemachine_sda_cb_servicechk_noerrhttp_free_xferstatemachine_http_initstatemachine_http_check_connectivityhttp_init_xferstr_err_cwmp_nonestr_err_cwmp_internalstr_err_cwmp_acs_invalid_infostr_err_cwmp_config_data_writestr_err_cwmp_config_data_corruptstr_err_cwmp_connectionstr_err_cwmp_authenticationstr_err_cwmp_boot_modestr_err_cwmp_image_headerstr_err_cwmp_image_sizestr_err_cwmp_image_downloadstr_err_cwmp_image_flashstr_err_cwmp_image_verifystr_err_cwmp_typestr_err_cwmp_max_attemptsstr_ErrorCodestr_upgrade_statusstr_Initstr_Disabledstr_Idlestr_ServiceChkstr_Ongoingstr_Completedstr_Errorstr_Imagestr_URLstr_Usernamestr_Passwordstr_Keystr_Enablestr_Statusstr_ErrorDescstr_Attemptstr_DebugmaxFdsarchfsSmarch_fsclosearch_fsreadarch_fslseekxm_retmemmaxArchsarch_fsunlinkarch_fsopenarch_listarch_initarch_enumfileself_exec_sizecoff_exec_sizeosi2_sizemlap_resetrightsmlap_user_has_rightstagp_param_typestagp_parsegrouptagp_identifygrouptagp_buildprefix_intgrdesctagp_getcmdtagp_getparamENVgetenv_rtagp_complete_additemtagp_complete_trackfoundtagp_complete_processfoundtagp_complete_ingrouptagp_complete_user_commandstagp_complete_incommandvt_update_displaymenu_drawboxvt_update_vtbufvt_set_cursor_relmenu_sheet_updaterl_initctxrl_readlinemenu_sheet_allocvt_open_linesmenu_sheet_runmenu_parseopt_openmenu_sheet_freetagp_makecmd_strtagp_aaa_callback_pmenu_select_help_cbmenu_select_print_cbmenu_sheet_erasetagp_linkgroup_intconfig_writetagp_handle_cmd_mbusmenu_select_cmdhis_addtagp_executealcatel_logohis_get_prevhis_get_nextrl_setcursorrs_shell_prt_controltagp_config_is_loadedmlap_get_systemusertagp_parsestr2tagp_enumparam_exhis_createtagp_mbus_value_parsetagp_mbus_value_printtagp_mbus_enum_mb2tptagp_mbus_value_set_ulongtagp_mbus_value_get_ulongtt_port_numberstp_type_combo_handlertt_proto_numberstagp_mbus_value_set_rangetagp_mbus_value_get_rangeINinet_atontagp_mbus_value_set_iptagp_mbus_value_get_ipinet_ptoninet_ntophw_aton_stricthw_maton_stricttagp_mbus_value_set_macmasktagp_mbus_value_get_macmaskinet_atorrights_str2rightsrights_rights2strtp_type_unknown_nametp_type_unknown_handlertp_type_string_handlertp_type_int_handlertp_type_uint_nametp_type_uint_handlertp_type_range_handlertp_type_bool_handlertp_type_ipaddr_handlertp_type_in6_addr_nametp_type_ipmask_handlertp_type_ipport_handlertp_type_ipproto_nametp_type_ipproto_handlertp_type_combo_nametp_type_enum_handlertp_type_hwaddr_handlertp_type_mask_hwaddr_nametp_type_mask_hwaddr_handlertp_type_user_handlertp_type_qstring_handlertp_type_trstring_nametp_type_trstring_handlertp_type_iprange_handlertp_type_bitmap_nametp_type_bitmap_handlertp_type_ipportrange_handlertp_type_rights_nametp_type_rights_handlertp_type_dscp_handlertp_type_precedence_handlertp_type_date_time_nametp_type_date_time_handlerllist_reversembus_fltr_parsembus_fltr_new_compmbus_fltr_new_boolstrpair_getfirststrpair_getseconddynstr_fromsubstringstrpair_fromstringsstrpair_setsecondstringstrpair_setfirststringtagp_mbus_filtered_typembus_ctx_init_sk_inetmbus_ctx_setmbusdaddr_inetmbus_getnotifylistensocketdynstr_setsubstringdynstr_frommacaddrdynstr_getmacaddrtagp_mbus_add_object_1tagp_mbus_del_object_1tagp_mbus_set_object_1his_add_sthis_get_next_sthis_get_prev_sthis_remove_stpassw_checkmlap_isloginallowedifm_get_type_nextifm_get_ll_nextdll_get_first_elementdll_get_next_elementdll_pop_from_headdll_push_on_headdll_get_element_with_iddll_unlink_elementdll_init_elementdll_push_on_tailservmgr_mbus_generate_event_serv_acl_intf_add_get_id_serv_acl_ip_add_get_idserv_srcip_intf_setserv_log_setserv_type_attributesdll_init_listserv_getserv_getnextserv_reset_serv_getnext_id_serv_map_add_get_idserv_ostate_setserv_acl_ip_getnextserv_acl_intf_getnext_serv_acl_intfgroup_add_get_idserv_acl_intfgroup_deleteservmgr_atom_mbus_initserv_event_intf_newserv_event_intf_delete_serv_getfirst_idserv_unregisterserv_attrib_getserv_inherit_getserv_ostate_getserv_log_getserv_forward_getserv_oforward_setserv_oforward_getserv_aforward_setserv_aforward_getserv_srcip_intf_get_serv_map_getbyid_serv_acl_ip_getbyid_serv_acl_intf_getbyidserv_acl_intfgroup_getfirstserv_acl_intfgroup_getnext_serv_acl_intfgroup_getbyidatm_equalpb_find_addrpb_get_nextctd_find_ctdqosb_get_nextqosb_get_firstnr_tr_excl_listtr_filenametar_listtar_fsopentar_fscloseload_translation_fileset_translation_languageregister_cgi3cgi_charset_encodinglanguage_atom_mbus_initjenkins_hashhttpd_translationlookup_translationtranslatectxtdeftrstrfs_check_gctr_update_trlistget_translation_languagelangconfig_descg_language_configlanguage_chang_selectlanguagelanguage_chang_completeg_language_pack_configlanguage_get_configlanguage_pack_get_configlanguage_pack_deleteg_languageCodeget_language_pack_numlanguage_pack_get_langcodetr_delete_desclangdef_desctr_desctr_excl_descpub_config_tar_fnamegzfs_open_exgzfs_fwdseekconfig_is_factory_template_presenttar_fsunlinktagp_parsestrfile_existsconfig_get_template_descriptionconfig_get_list_of_config_filesconfig_get_list_of_all_templatesconfig_get_gen_template_descriptionfs_force_gcfsutil_check_free_sizefsutil_get_filesizefsutil_get_free_sizefile_appendfile_openfile_closeconfig_save2ENVremAllEnvStartingWithfile_delete_extupnp_enabletar_fsreadenv_save_variableENVgetentrydynstr_setlongexpr_atom_mbus_initexpr_atom_mbc_ioctl_ctxpfm_atom_mbc_ioctl_ctxfwm_genioctlfwm_module_find_idfwm_hook_namepfm_atom_mbc_ioctlfwm_level_getfwm_state_getfwm_level_getactiveserv_getfirstfwm_level_adds_level_selectedfwm_level_unsetactivefwm_level_getnamefwm_level_setactivefwm_level_getfirstfwm_level_getnextfwm_level_deletefwm_level_modifyfwm_level_movefwm_level_set_defaultpolicyfwm_level_get_defaultpolicyfirewall_atom_mbus_initexpr_atom_mbc_ioctlfwm_module_stateservice_trigger_deleteservice_lockservice_trigger_addservice_ip2strfwm_module_enablefwm_module_disableservice_trigger_stats_getservice_getfirstservice_getnextmbus_regenumtype_getvalueservice_addservice_deleteservice_getidservice_renameservice_detachservice_attachservice_map_getfirstservice_map_getnextservice_map_addservice_map_deleteservice_map_getidservice_map_setservice_trigger_getfirstservice_trigger_getnextrule_acc_protorule_acc_inportrule_acc_outportrule_acc_outportendrule_acc_triggerrule_acc_trigprotoapp_acc_modestrdupsgw_status_update_notifysgw_ipobj_add_del_notifynat_portmap_acc_indexnat_portmap_acc_outaddrnat_portmap_acc_outaddrendnat_portmap_acc_inaddrnat_portmap_acc_inaddrendnat_portmap_acc_acclistnat_portmap_acc_acclistendnat_portmap_acc_foreignnat_portmap_acc_foreignendnat_portmap_acc_protonat_portmap_acc_outportnat_portmap_acc_outportendnat_portmap_acc_inportnat_portmap_acc_inportendnat_portmap_acc_weightENVunsetenvdeviceinfo_atom_mbus_initsslapi_get_app_configsslapi_get_app_namesslapi_set_app_configxtm_getgeotimezonextm_settimezonetime_geotimezonesxtm_setgeotimezonextm_getdaylightsavingendxtm_getdaylightsavingstartxtm_setdaylightsavingendxtm_setdaylightsavingstartxtm_set_DST_enabledxtm_get_DST_enabledxtm_set_DST_modextm_get_DST_modextm_set_DST_start_weekdayxtm_get_DST_start_weekdayxtm_set_DST_start_hourxtm_get_DST_start_hourxtm_set_DST_start_weekxtm_get_DST_start_weekxtm_get_DST_start_monthxtm_get_DST_end_monthxtm_set_DST_end_monthxtm_set_DST_start_monthxtm_set_DST_end_weekdayxtm_get_DST_end_weekdayxtm_set_DST_end_hourxtm_get_DST_end_hourxtm_set_DST_end_weekxtm_get_DST_end_weekUpdate_AbsolutTime_Valuextm_install_timechange_eventtime_atom_mbus_initloc_ledssysLedCtrldes_set_keytp_type_encpasswd_global_keytp_type_encpasswd_device_keydes_ecb_encrypttagp_mbus_value_appendpassw_calchashtp_type_passwd_nametp_type_passwd_handlertp_type_cencstring_handlermain_dflagsargroup_delmember_fromgroupsargroup_ismemberlinux_passwd_deluserlinux_passwd_cryptpassw_calchash2linux_passwd_setlinux_passwd_adduserpassw_lockpassw_get_commentpassw_calc_noncehashpassw_calc_digestlinux_passwd_getfirstlinux_passwd_getnextrights_channel_strrights_origin_strfgetpwentlinux_group_getgrgidputpwentargroup_gid2namefseekargroup_addbit2maskarrights_hasbitrightsarrights_hasbitarzone_handle_cmdarzone_getrightsarrights_isAllowExceptBitSetargroup_bitnr2namearzone_getcountarzone_clonearzone_delpassw_check_cryptpassw_check_digestpassw_prepare_cryptpassw_prepare_digestarzone_initargroup_initargroup_members_syncarrights_addbitarzone_updrightslinux_group_delgrouplinux_group_addgrouppassw_name2uidlinux_group_setpassw_uid2nameargroup_getmembernameslinux_group_members_synclinux_group_getfirstlinux_group_getnextarrights_equalrightsarrights_setrightsarrights_addrightsarrights_deleterightsarzone_addfgetgrentputgrentmbus_onephone_initar_mbus_initdevinfo_mbus_initfirewall_mbus_initigdmbus_devconf_initlandev_mbus_initlayer2br_mbus_initlayer3f_mbus_initmanagementserver_mbus_inittime_mbus_inittod_mbus_initwancdev_mbus_initnatapplist_mbus_initdyndns_mbus_initrad_mbus_initvoiceserv_mbus_initigd_custom_mbus_initigd_1to1_event_inithost_mbus_event_initigd_custom_mbus_event_initigd_process_1to1igd_mbus_get_plugin_ctxwan_commintf_mbus_initwandslic_mbus_initwandsllc_mbus_initwanpppconn_mbus_initwanipconn_mbus_initigd_mbus_get_client_ctxloc_get_allobjectloc_get_lowintfloc_wancu_checkethtypeloc_wancom_getvalueloc_process_portmapfilewallwancom_pm_ppplockg_pllstWanPPPPMTimerwancom_pmtimer_comparewancom_add_timerdatawancom_pmfw_ttinitwancom_delete_timerdatawancom_get_timerdataigd_1to1_add_event_mapwlancfg_mbus_initlanhost_mbus_initlanethcfg_igd_mbus_initlanusb_igd_mbus_initmbus_client_add_filter_to_ccmd_dsdynstr_setmacaddrdynstr_setdynstrresolve_key_mappingchange_mac_to_little_letterwlan_add_acl_entryloc_add_dhcp_static_addrbase64_decodedynstr_hexstringfromdataigd_atomic_path_constructdhcpoption_base64_get_option_data_pooliddhcpoption_base64_enterprise_item_add_from_optiondatadhcpoption_base64_get_dyndata_packet_pooliddyndata_callocdhcpoption_base64_enterprise_item_getfirstdhcpoption_base64_enterprise_item_to_packetdyndata_adddatadyndata_getdatasizedyndata_getdatadhcpoption_base64_enterprise_item_getnextdyndata_freedhcpoption_base64_initipintf_mbus_initstrlist_partialtodynstrigd_mbus_get_paramvalueigd_mbus_set_paramvalueigd_mbus_getinstancekeys_create_dummy_objectwlan_add_event_mapperwancom_pm_iplockg_pllstWanIPPMTimermbus_ccmd_set_lastrequest_cookiefreadloc_get_upperbridgeintfloc_get_upperrelayintfg_pcPMFWRuleExprSrcg_pcPMFWRuleExprDstg_pcPMFWRuleExprSerg_pcPMFWRuleExprSifg_pcIPMRuleDescg_pcFPMRuleDescloc_search_firewallrule_exprloc_set_portmapfilewall_exprloc_delete_portmapfilewall_objloc_create_portmapfilewall_exprloc_update_firewallrule_exprloc_set_firewallrule_parameterg_pcIPMChainNameg_pcFPMChainNameg_pcIPMRootChaing_pcFPMRootChainloc_search_portmapfilewall_chainloc_create_portmapfilewall_chainloc_search_portmapfilewall_ruleloc_create_portmapfilewall_ruleloc_update_portmapfilewall_ruleg_ulWanCom_PMFW_TaskIDg_ulPMTO_Eventwancom_pmfw_leasetimetaskg_ulPMTO_Event_maskwancom_pmfw_taskdelpmg_pPMTOIgdMbusCtxg_ulWanCom_TMIDg_pcPMTOIgdCtxNameg_pcWanCom_TaskNamewancom_pmleasetime_taskinitg_pcWanCom_TMNamewancom_pmleasetime_timerinitstr_2_option_valuedyndata_setdatadhcpoption_base64_enterprise_item_finddhcpoption_base64_get_enterprise_item_pooliddyndata_initpoolsgwd_find_fqdnbyidsgwd_get_statussgwd_find_fqdnbynamesgwd_exist_umagwsgwd_add_fqdnsgwd_del_umagwsgwd_find_ipbyididx_umasgwd_find_ipbyaddresssgwd_exist_ipsgwd_add_ipsgwd_del_ipvoiceigd_get_roletypeg_cur_role_typevoiceigd_getvaluevoiceigd_getmultiinstance_countloc_transregionvoiceigd_get_notmappedparams_voip_codec_listvoice_capabilities_protocol_mbus_regg_mbus_role_mapvoiceservcap_mbus_initvoiceservprof_mbus_initvoice_phy_interface_mbus_regvoice_ringtest_mbus_regvoice_x_000E50_sessionlog_mbus_regvoiceigd_setvaluevoice_profile_protocol_mbus_regvoice_line_protocol_mbus_regvoice_line_session_mbus_regvoiceigd_get_objidigd_get_pathloc_convert_bitrateigd_resolve_innerkeysigd_getparammapmbus_client_convert_query_listigd_get_services_pathvoiceprov_initmisc_services_initmaligne_tv_visio_initwificomm_mbus_inituserintf_initupnp_mbus_initusb_mbus_initupnp_mbus_event_initusb_mbus_event_initled_mbus_initregcompregexecregfreeloc_get_mbus_modulation_typeadsl_stop_connectionadsl_set_configurationadsl_start_connectionadsl_get_connection_infos_dev_statsadsl_get_statisticsadsl_open_devadsl_intf_atom_mbus_initadsl_mbus_status_updateswv_handle_osba_for_switchover_andcrcno_pmd_flagdbg_outputdbg_vprintfvsyslogcalc_checksumtrc_vwrite_vtrc_vrewind_trc_vreadtrc_vflushquery_vtracetrc_vmodeskip_svc_tracingboard_resetboard_cfg_watchdogboard_enable_watchdogerr_enable_watchdogboard_disable_watchdogboard_kick_watchdogappbox_startshellxt_show_tasksklogctlserv_find_nameserv_attrib_name_getserv_get_typenameserv_acl_ip_addserv_stats_getserv_stats_objifm_is_default_internet_connectionifm_type_to_name_rifm_get_state_str_rifm_get_isdn_parsifm_filter_matchifm_type_filter_handlerhandle_new_wizard_definitionENVflushenv_type_all_nameenv_type_all_handlerenv_saveprofile_def_descrconfig_save_asconfig_isScriptFileconfig_erase_configconfig_showconfig_dumptp_type_userconf_nametagp_mbus_savemb_accomp_typestagp_mbus_print_xreftagp_mbus_cond_ip_not0tagp_mbus_cond_int_not0tagp_mbus_print_passwordtagp_mbus_cond_boolmacm2strifm_get_state_strmerd_find_dynamicatmi_set_destatmi_set_dynamicatmi_set_retryenv_svcs_enabledpb_type_all_create_nameqb_type_all_namepb_type_all_nameph_atm_port_namesatm2textpb_get_firstpb_get_dynamicpb_type_tot_namepb_type_tot_handlerpb_type_all_handlerpb_type_all_create_handlerctd_convert2cpsctd_max_namectd_convert2kbsctd_inc_usectd_dec_usectd_type_all_namectd_type_all_handlerqb_type_all_handlerbridged_if_set_dynamicbridged_if_get_params_nostatsbridged_flushbridged_br_clear_statisticsmacstrsepethi_set_dynamicethi_set_vidans_get_configans_get_first_serverans_get_next_serverans_set_configans_add_serverans_delete_servergethostbyaddr_ansipmask2cidrdns_client_savehandle_dnss_flushmb_dns_server_route_flags_dynamic_conddyndnsd_srv_get_paramsdyndnsd_host_get_nextdyndnsd_host_find_namedyndnsd_srv_get_messagedyndns_type_clientdyndns_type_servicedyndns_type_groupdyndns_type_hostdyndns_type_extended_groupdyndnsd_set_traceexpr_tagtype_expr_handlerexpm_type_enumexpm_formatexpr_tagtype_intf_nameexpr_tagtype_expr_nameexpr_modify_descexpr_prot_typesexpr_icmp_codespf_cmds2ownerpf_prefix2ownerpf_fill_rule_descpf_params2ownerpf_prefix2cmdstagp_handleparampf_rule_show_prettytagp_buildprefixpf_output_chainpf_get_rule_parampf_handle_rule_createpf_handle_rule_modifypf_copy_cmddescpf_tagtype_chain_namepf_tagtype_chain_handlerpf_tagtype_expr_namepf_tagtype_expr_handlerpf_rule_create_descpf_showmodespf_rule_connstatespf_chain_list_descpf_chain_policyfw_pf_cmdspf_savefwm_module_getfirstfwm_hook_getfwm_module_getnextfwm_hook_getfirstfwm_module_getfwm_hook_getnextpf_destroy_userdefined_chains_and_rulesINinet_ntoa_rpf_addcmds_tptagp_get_param_typefw_savefw_tagtype_level_namefw_level_saveservice_getnameservice_flushservice_stats_getsslapi_app_cert_addsslapi_app_cert_listsslapi_app_cert_delmemm_set_tracememm_get_tracememm_print_statsmemm_print_timestatslock_print_allstatslock_clear_allstatsmemm_clear_timestatsmemm_print_objects2memm_tag_objectslock_gettracelevellock_settracelock_getapplfiltertm_to_stroption_suboption_allowedoption_enterprise_allowedlc_formatDurationoption_gettagp_mbus_exists_object_1tagp_mbus_print2_rpn_calcstr_softwarestr_upgradedhcp_spoof_saveigmp_snooping_savemb_igmp_snooping_intf_mode_enummbus_invoke_register2mbus_getversionmbus_ctx_getidmbus_ctx_getsessionidmbus_ctx_setsessionidmbus_ccmd_add_getpath_requestmbus_creds_setclientipaddrmbus_creds_cleartext_setmbus_creds_md5_setmbus_creds_crypt_setusernamembus_invoke_prepare_authenticationmbus_creds_crypt_setpasswordmbus_invoke_authenticatembus_authmethod2stringmbus_invoke_terminate_sessionmbus_ctx_resetmbusd_set_tracembusd_backup_dropmbusd_backup_exportmbusd_client_writelock_getlastcmdmbusd_client_writelock_getidletimeoutmbusd_client_writelockdelaylist_getlengthmbusd_dmtree_printstatsmbusd_event_printstatsmbusd_event_clearstatsmbusd_ctx_clearstatsmbusd_dmtree_getenumtypesatmbusd_enumtype_list_bynamembusd_dmtree_getrootobjtypeatmbusd_objtype_listmbusd_dmtree_getrootobjectatmbusd_object_listmbusd_ctx_listmbusd_unload_objectsmbus_trigger_listobjectswrls_savewl_bcm_wme_ac_nameswl_bcm_wme_ac_mbusnameswpapsk_encmodes_strxdigitstr2datastrpbrkstr2atm_e164str2atm_e164_fixedstr2atm_aesaatm_e164_stratm_aesa_stratm2strstr2ulstr2macmtime2strsys_time_hrsys_time_diffsys_mdelayspeed2strstr2ulrastrncmpastrcmpscan_nameonoff_stryesno_strheap_reallocmem_allocpool_create_xINTCTL_DISABLEINTCTL_RESTOREpool_allocmem_freevb_copy_offsetfatal_errorvb_buf_to_memvb_check_freevb_make_freevb_insert_freelm_cli_igmp_proxy_dbg_helplm_cli_igmp_proxy_dbg_cmdmb_igmp_proxy_intf_statesni_sendpppoe_pad_initpppoe_tag_appendpppoe_pad_finishpppoe_tag_findeth_ethertype_createeth_cx_flags_seteth_ethertype_deleteni_bindpppoe_relay_prot_receivepppoe_relay_data_receiveni_sbindni_unbindeth_cx_addr_addif_attachntohspppoe_tag_parsepppoe_timertmr_startpppoe_servicename_errorpppoe_servicename_error_acnametmr_stoppppoe_receive_initiationpppoe_receive_requestpppoe_terminate_sessioneth_port_disableeth_port_deleteeth_port_alloceth_vport_initeth_port_enablepppoe_prot_receivepppoe_data_receivepppoe_state_changepppoe_detachpppoe_deletepppoe_scanpppoe_get_ethportpppoe_data_sendexpr_typesizesexpr_get_by_nameexpr_deleteexpr_addexpr_modifyexpr_create_servexpr_add_servexpr_modify_servexpr_get_by_indexexpr_get_by_idexpr_removeatmu_max_vpiatmu_max_vciSSL_get_errorSSL_connectcontext_getFlagsSSL_get_peer_certificateX509_get_subject_nameX509_NAME_ENTRY_get_dataASN1_STRING_to_UTF8STR_SSLAPI_IDSTR_NEWLINECRYPTO_freeOBJ_txt2nidX509_NAME_get_index_by_NIDX509_NAME_get_entryX509_freeSSL_writeSSL_library_initsysdep_seed_PRNGutil_init_storageSSL_get_ex_new_indexsslapi_ssl_ex_data_idxcontext_initSslapiContextssysdep_register_callbackscontext_checkIdcontext_getSslCtxSSL_newSSL_set_fdSSL_set_ex_dataSSL_CTX_flush_sessionsSSL_set_accept_stateSSL_shutdownSSL_freeSSL_readSSLAPI_ERROR_NUMsslapi_errorstringsslapi_unknownerrorcontext_init_upgradecontext_init_cwmpcontext_setFlagcontext_cert_listcontext_cert_delcontext_cert_addsslapi_app_ctx_nameSSLv23_client_methodSSLv23_server_methodSSLv23_methodSSL_CTX_newSTR_CIPHER_LISTSSL_CTX_set_cipher_listSSL_CTX_ctrlSSL_CTX_set_verifySSL_CTX_set_session_id_contextSSL_CTX_set_timeoutsslapi_ctx_ex_data_idxSSL_CTX_set_ex_dataSSL_CTX_get_ex_new_indexcontext_registerutil_verify_cbSSL_CTX_set_verify_depthcert_load_ca_listcert_unload_ca_listcert_list_certificatecert_delete_certificatecert_reload_ca_listcert_add_certificatecert_load_hardco_CertiKeySetSTR_SSL_DATA_PATHBIO_s_fileBIO_newBIO_ctrlPEM_read_bio_X509BIO_freeSTR_ERR_READ_CERTSTR_ERR_MEMORYX509_NAME_onelineSTR_SUBJECTutil_asn1time_to_stringSTR_NOT_BEFORESTR_NOT_AFTERX509_get_issuer_nameSTR_ISSUERX509_get_pubkeyBN_num_bitsEVP_PKEY_freeSTR_KEY_STRENGTHSTR_CERTIFICATEutil_print_raw_fileutil_get_full_nameutil_delete_fileIO_MODE_WRITEBIO_new_filePEM_write_bio_X509STR_ENV_PROD_FRIENDLY_NAMESTR_DEF_CERT_CNSTR_ENV_COMPANY_NAMESTR_DEF_CERT_OSTR_ENV_BOARD_SERIAL_NBRSTR_DEF_CERT_OUSTR_DEF_CERT_NOT_BEFORESTR_DEF_CERT_NOT_AFTERX509_newX509_set_versionsysdep_random16X509_get_serialNumberASN1_INTEGER_setASN1_UTCTIME_newASN1_UTCTIME_set_stringX509_set_notBeforeX509_set_notAfterX509_NAME_newX509_NAME_add_entry_by_txtX509_set_issuer_nameX509_set_subject_nameX509_NAME_freet_setprikey_create_rsa_keypairEVP_PKEY_newEVP_PKEY_set1_RSAcert_create_certificateX509_set_pubkeyX509_signkey_free_rsa_keycert_free_certificateSSL_CTX_use_certificateSSL_CTX_use_RSAPrivateKeySSL_CTX_check_private_keyX509_STORE_newX509_STORE_add_certSSL_CTX_set_cert_storeSTR_TRUSTCERTSutil_rename_fileSTR_SSL_IMPORT_PATHSTR_SSL_IMPORT_GZFSPATHtmpfilePEM_read_X509key_read_hardco_privkeycert_assign_cert_keyPEM_read_bio_RSAPrivateKeyutil_passwd_cbEVP_des_ede3_cbcPEM_write_bio_RSAPrivateKeyRSA_generate_keyRSA_freePEM_read_RSAPrivateKeyhw_passwd_getX509_STORE_CTX_get_errorSSL_get_ex_data_X509_STORE_CTX_idxX509_STORE_CTX_get_ex_dataSSL_get_SSL_CTXSSL_CTX_get_ex_datasysdep_check_data_dirBIO_s_memASN1_TIME_printBIO_readSTR_INV_DATEgettidsrandomRAND_seedRAND_statusCRYPTO_num_locksCRYPTO_set_locking_callbackCRYPTO_set_id_callbackdes_encryptfcrypt_bodydes_fcryptdes_SPtransdes_check_keydes_is_weak_keyMD5_InitMD5_UpdateMD5_FinalSHA1_InitSHA1_UpdateSHA1_Finalcapi_cipher_listcapi_digest_listdes_create_crypto_compatdes_delete_cryptodes_encrypt_blocksdes_decrypt_blocksdes3_create_crypto_compatdes3_delete_cryptodes3_encrypt_blocksdes3_decrypt_blocksaes_create_cryptoaes_delete_cryptoaes_encrypt_blocksaes_decrypt_blocksrc2_create_cryptorc2_delete_cryptorc2_encrypt_cbcrc2_decrypt_cbcarc4_create_cryptoarc4_delete_cryptoarc4_encrypt_blocks_compatarc4_decrypt_blocks_compatmd5_duplicate_ctxmd5_delete_ctxcapi_hmaccapi_hmac_initcapi_hmac_finalcapi_hmac_init_dualcapi_hmac_final_dualmd2_init_ctxmd2_duplicate_ctxmd2_update_ctxmd2_final_gen_digestmd2_delete_ctxsha1_duplicate_ctxsha256_init_ctxsha256_duplicate_ctxsha256_update_ctxsha256_final_gen_digestsha256_delete_ctxsha512_init_ctxsha512_duplicate_ctxsha512_update_ctxsha512_final_gen_digestsha512_delete_ctxsha256_initsha256_updatesha256_finalsha512_initsha512_updatesha512_finalhw_get_seedrandom8des_encrypt2des_encrypt3des_decrypt3rijndaelKeySetupDecrijndaelKeySetupEncblockEncryptblockDecryptdes_cbc_encryptdes_create_cryptodes_ede3_cbc_encryptdes3_create_cryptoMD2_InitMD2_UpdateMD2_FinalRC4_set_keyRC4arc4_encrypt_blocksarc4_decrypt_blocksRC2_set_keyRC2_cbc_encryptrijndaelEncryptrijndaelDecryptxml_register_srcllist_popobjectxml_entitytranslationtabledom_con_element_dynllist_setobject_athl_Call_poolnamehl_Connection_closeNotificationhl_stream_Eventhl_dynstr_poolidhl_UserProfile_setUserNamehl_UserProfile_setPasswordhl_Request_Range_allochl_Request_Range_free_allhl_Call_poolidhl_callochl_cookie_getFirsthl_cookie_deleteCookiehl_Stream_freehl_Request_freehl_Response_freehl_UserProfile_freehl_freememory_maphl_init_llist_poolhl_init_dynstr_poolhl_init_Call_poolhl_init_Cookie_poolhl_init_Authentication_poolhl_init_Request_poolhl_init_HeaderParser_poolhl_init_ChunkDecoder_poolhl_init_Reader_poolhl_init_Status_poolhl_init_HeaderCreator_poolhl_init_ChunkEncoder_poolhl_init_Writer_poolhl_init_Parser_poolhl_init_Request_Range_ll_poolhl_init_Request_Range_od_poolhl_init_parsershl_llist_poolidhl_Cookie_poolidhl_Auth_poolidhl_stream_Request_poolidhl_stream_HeaderParser_poolidhl_stream_ChunkDecoder_poolidhl_stream_Reader_poolidhl_stream_Status_poolidhl_stream_HeaderCreator_poolidhl_stream_ChunkEncoder_poolidhl_stream_Writer_poolidhl_Parser_poolidhl_Request_Range_ll_poolidhl_Request_Range_od_poolidhl_Response_resethl_checkErrorhl_stream_Reader_poolnamehl_Method_getNamehl_util_getPathhl_stream_HeaderCreator_newhl_nextFieldhl_Call_setLocationtolowerhl_Connection_setCloseNotificationhl_Connection_setPersistenthl_Call_getAuthenticationhl_Auth_setNonceCounthl_Call_setAuthenticationhl_Auth_setAuthenticationParamshl_Auth_setUrihl_Auth_createBasicAuthenticationhl_cookie_getCookiehl_Cookie_newhl_cookie_parseAttribshl_cookie_addCookiehl_Parsers_addParserHTMIME_authenticateHTMIME_connectionHTMIME_contentLengthHTMIME_transferEncodingHTMIME_locationhl_nextPairhl_Cookie_freehl_Connection_setVersionhl_Response_setReasonhl_stream_Writer_newhl_stream_Request_newhl_stream_Reader_newhl_stream_HeaderParser_newhl_stream_Status_newhl_Connection_persistenthl_methodshl_Auth_getDigestResponsehl_Auth_getBasicResponsehl_Auth_nonceCountToHexStringhl_Auth_createCnoncehl_dynmallochl_dynfreehl_Call_getUserAgenthl_cookie_getNexthl_Method_hasBodyhl_util_getDomainDynStrhl_Auth_makeCnoncehl_Auth_increaseNonceCountByOnehl_Auth_createNonceCounthl_Auth_createDigestAuthenticationhl_stream_ChunkEncoder_newhl_Tracehl_stream_Writer_poolnamehl_stream_ChunkDecoder_newhl_Parsers_getParserfile_open_exfile_append_exFSfstatgz_sfreegz_smallocinflateInit_zalloczfreeinflateinflateEndtar_fslseekread_libztr_selected_trfiletr_headerhttpd_tar_fnameinit_stackread_raw_filetar_fsfstatenv_lockstrcspnvt_move_cursor_rel2vt_move_cursor_relinflate_blocks_resetinflate_blocks_freezcalloczcfreeadler32inflate_blocks_newinflateResetinflateInit2_inflate_blocksinflate_set_dictionaryinflate_blocks_sync_pointz_errmsginflate_codes_freeinflate_flushinflate_trees_fixedinflate_codes_newinflate_trees_bitsinflate_maskinflate_trees_dynamicinflate_codesinflate_fastcwmp_getServerNamestr2ipcwmp_resolve_name_to_ipdownup_ssl_closecwmp_readAndCheckBuffercwmp_getAuxAuthenticationObjectcwmp_parseHttpPacketHeadercwmp_createBasicAuthenticationcwmp_getContentLengthcwmp_readbuffercwmp_http_readlinecwmp_getDownUploadArgumentWithNamecwmp_getSockAddrsslapi_ioctldownup_ssl_connectdownup_Tracedownup_getTraceBuffercwmp_createNonceCountcwmp_makeCnoncecwmp_createDigestAuthenticationcwmp_sendHttpPacketToSocketsslapi_flushcwmp_handleHttpPacketdownup_ssl_recvdownup_ssl_sendcwmp_writebytescwmp_createCnoncehttpc_attribscwmp_freeCookiecwmp_setDownloadSuccessfulldownup_util_saveallfaultCodecwmp_getConfigLevelcwmp_delete_with_synccwmp_downloadFilecwmp_isSoftwareDownloadcwmpd_isSingleBuildBoardeqm_duplicate_active_swcwmp_uploadFileg_vkapi_mutex_idvkapi_lep_initvkapi_misc_initg_lineCtxset_countryvkapi_udp_startvkapi_lep_startvkapi_rtp_startvkapi_lep_signalvkapi_lep_capsvkapi_rtp_cdcnxvkapi_rtp_mdcnxvkapi_rtp_ddcnxvkapi_lep_dect_configvkapi_udp_openvkapi_udp_res_portsvkapi_udp_bindvkapi_udp_remote_descvkapi_udp_portrangevkapi_udp_closecnx_mode_strvkapi_udp_infovkapi_rtp_update_sockg_rtp_drv_DECTg_rtp_drv_FXSupdate_rtp_sessionget_rtp_countryrtp_constructortrace_codecsvoipRegisterSockvoipUnregisterSockvkapi_rtp_dtmf_networkvkapi_rtp_ep_onhookdecode_cid_messagesysGetButtonStatelibep_FXS_constructorpots_ringtest_timer_cbget_lep_countrypstn_constructorpstnapi_eventpstnapi_servicelibep_DECT_constructordect_ringtest_timer_cbvoipUnregisterSockByCBsignal_strvkapi_rtp_play_messagecreate_cid_messagevkapi_lep_tonecodec_nameshardcoVoip_basehardcoVoip_fsmEpDev_initializehardcoVoip_fsmEpSig_initializehardcoVoip_fsmCnxRtp_initializehardcoVoip_fasBase_initializehardcoVoip_eventConv_dspipc_init_port_donehardcoVoip_eventConv_dspipc_modify_port_codec_donehardcoVoip_eventConv_dspipc_close_port_donehardcoVoip_eventConv_dspipc_gen_tone_donehardcoVoip_eventConv_dspipc_quit_tone_donehardcoVoip_eventConv_dspipc_digit_receivedhardcoVoip_eventConv_dspipc_ring_expiredhardcoVoip_eventConv_dspipc_tone_expiredhardcoVoip_eventConv_dspipc_inter_digit_expiredhardcoVoip_eventConv_slic_offhookhardcoVoip_eventConv_slic_onhookhardcoVoip_eventConv_slic_flashhookhardcoVoip_eventConv_dspipc_callerid_play_donehardcoVoip_eventConv_dect_tone_off_donehardcoVoip_eventConv_dect_remove_handsethardcoVoip_eventConv_dect_add_handsethardcoVoip_eventConv_dect_offhookhardcoVoip_eventConv_dect_onhookhardcoVoip_eventConv_dect_dtmfhardcoVoip_eventConv_dect_dtmf_expiredhardcoVoip_eventConv_dect_tone_expiredhardcoVoip_eventConv_dect_ring_expiredhardcoVoip_eventConv_dect_init_donehardcoVoip_eventConv_dect_codec_update_donehardcoVoip_eventConv_dect_close_donehardcoVoip_eventConv_dect_callerid_donehardcoVoip_eventConv_dect_tone_on_donehardcoVoip_eventConv_ep_cmd_ring_onhardcoVoip_eventConv_ep_cmd_off_hook_msghardcoVoip_eventConv_ep_cmd_releasehardcoVoip_eventConv_ep_cmd_tone_genhardcoVoip_eventConv_ep_cmd_dtmf_reqhardcoVoip_eventConv_ep_cmd_on_hook_msghardcoVoip_eventConv_rtp_cmd_dtmfDirRtphardcoVoip_eventConv_rtp_cmd_updatehardcoVoip_eventConv_rtp_cmd_starthardcoVoip_eventConv_rtp_cmd_stophardcoVoip_base_initializehardcoVoip_libep_inithardcoVoip_libep_generic_destructorhardcoVoip_libep_cmdhardcoVoip_libep_cnfhardcoVoip_libep_dect_on_fd_activityhardcoVoip_libep_on_timerhardcoVoip_libep_fxs_on_fd_activityhardcoVoip_libep_generic_constructorhardcoVoip_pstn_destructorhardcoVoip_pstn_inithardcoVoip_pstn_cmdhardcoVoip_pstn_on_timerhardcoVoip_pstn_on_fd_activityhardcoVoip_rtp_cmdhardcoVoip_rtp_destructorfsmQEvt_registerUserfas_getUserCtxhardcoVoip_ep_cmdhardcoVoip_ep_cnfhardcoVoip_ep_ishardcoVoip_default_ep_dect_audiohardcoVoip_default_ep_fxs_audiohardcoVoip_ep_destructorhardcoVoip_ep_initfsm_modifDebugCtxfas_modifyDebugfsmQEvt_modifDebugfsmQEvt_basehardcoVoip_managedEventfsm_getEventNameWithUserfas_updateUserCtxfsmQEvt_processfas_addEventOnUserCtxfas_unregisterUserCtxOnAllSeqhardcoVoip_dect_supported_codecshardcoVoip_fxs_supported_codecshardcoVoip_rtpInfo_initializefsm_getCtxfsm_addStateNamefsm_addEventNamefsm_addTransitionhardcoVoip_fsmEpDev_process_offhookfsm_addNewStateToTransitionhardcoVoip_fsmEpDev_process_ring_on_cidhardcoVoip_fsmEpDev_process_on_hook_msghardcoVoip_fsmEpDev_process_ring_offhardcoVoip_fsmEpDev_holdhardcoVoip_fsmEpDev_process_onhookhardcoVoip_fsmEpDev_idlehardcoVoip_fsmEpDev_process_tone_reqhardcoVoip_fsmEpDev_process_dtmf_reqhardcoVoip_fsmEpDev_process_port_mod_reqhardcoVoip_fsmEpDev_process_off_hook_msghardcoVoip_fsmEpSig_process_free_with_call_reqhardcoVoip_fsmEpSig_process_free_with_offHook_beginhardcoVoip_fsmEpSig_process_ringProcess_with_call_reqhardcoVoip_fsmEpSig_process_ringProcess_with_release_reqhardcoVoip_fsmEpSig_process_ringProcess_with_offHook_beginhardcoVoip_fsmEpSig_process_incomingCall_with_release_reqhardcoVoip_fsmEpSig_process_incomingCall_with_offHook_endhardcoVoip_fsmEpSig_process_incomingCall_with_onHook_beginhardcoVoip_fsmEpSig_process_outgoingCall_with_offHook_endhardcoVoip_fsmEpSig_process_outgoingCall_with_onHook_beginhardcoVoip_fsmEpSig_process_outgoingCall_with_digit_receivedhardcoVoip_fsmEpSig_process_incomingCallRelease_with_onHook_endhardcoVoip_fsmEpSig_process_incomingCallRelease_with_offHook_beginhardcoVoip_fsmEpSig_process_outgoingCallRelease_with_onHook_endhardcoVoip_fsmEpSig_process_outgoingCallRelease_with_offHook_beginhardcoVoip_fsmEpSig_process_establishedRelease_with_onHook_endhardcoVoip_fsmEpSig_process_establishedRelease_with_offHook_beginhardcoVoip_fsmEpSig_process_established_with_onHook_beginhardcoVoip_fsmEpSig_process_established_with_release_reqhardcoVoip_fsmEpSig_process_established_with_digit_receivedhardcoVoip_fsmEpSig_process_established_with_inter_digit_expiredhardcoVoip_fsmCnxRtp_process_starthardcoVoip_fsmCnxRtp_process_dtmfDirRtphardcoVoip_fsmCnxRtp_process_updatehardcoVoip_fsmCnxRtp_process_stopfas_registerUserCtxOnSeqhardcoVoip_copy_rtpInfoToIoctlhardcoVoip_copy_rtpDtmfToIoctlfas_initializehardcoVoip_fasOffHook_initializehardcoVoip_fasOnHook_initializehardcoVoip_fasPortDevOn_initializehardcoVoip_fasPortDspOn_initializehardcoVoip_fasPortDevOff_initializehardcoVoip_fasPortDspOff_initializehardcoVoip_fasToneOn_initializehardcoVoip_fasToneOff_initializehardcoVoip_fasPortMod_initializehardcoVoip_fasRingOnCid_initializehardcoVoip_fasRingOff_initializehardcoVoip_fasOnHookMsgFxs_initializehardcoVoip_fasOnHookMsgDect_initializehardcoVoip_fasOffHookMsg_initializehardcoVoip_fasPlayDtmf_initializefas_addSequencefas_addActionhardcoVoip_job_sig_offHook_beginhardcoVoip_job_ring_offhardcoVoip_sub_job_port_dev_dsp_onhardcoVoip_job_dev_offHook_endhardcoVoip_job_sig_offHook_endhardcoVoip_job_completedhardcoVoip_job_sig_onHook_beginhardcoVoip_sub_job_tone_offhardcoVoip_sub_job_port_dev_dsp_offhardcoVoip_job_dev_onHook_endhardcoVoip_job_sig_onHook_endhardcoVoip_evt_port_dev_off_donehardcoVoip_evt_port_dev_on_donehardcoVoip_job_port_dev_onhardcoVoip_job_port_dev_offhardcoVoip_evt_port_dsp_off_donehardcoVoip_evt_port_dsp_on_donehardcoVoip_job_port_dsp_onhardcoVoip_job_port_dsp_offhardcoVoip_job_tone_onhardcoVoip_evt_tone_on_donehardcoVoip_evt_tone_off_donehardcoVoip_job_tone_offhardcoVoip_sub_job_port_ring_onhardcoVoip_job_cid_and_ringhardcoVoip_evt_caller_id_play_donehardcoVoip_job_off_hook_msghardcoVoip_job_play_dtmfhardcoVoip_get_ep_audio_confhardcoVoip_default_ep_common_audiohardcoVoip_retrieveCallerIdfas_addSubJobOnUserCtxhardcoVoip_job_on_hook_msghardcoVoip_sub_job_port_onHookMsg_onfas_basefas_initializeBaseCtxfas_addEventOnJobCtxfas_waitEventBaseCtxfas_updateBaseCtxfas_unregisterJobCtxOnSeqAndUserCtxfas_releaseActionfas_releaseSequencefas_releasefsm_basefsm_initializefsm_releaseCtxfsm_processTransitionfsm_registerUserfsmQEvt_initializefsm_unregisterUserparse_dhcpclientiddhcs_pool_savedhcs_savehandle_flushhandle_option_flushhandle_pool_rt_deletemb_dhcs_stats_param_overflow_condmb_dhcs_enterprise_condmb_dhcs_suboption_condmb_dhcs_no_offset_condmb_dhcs_no_leasetime_condmb_dhcs_notbroadcast_condmb_dhcs_no_infinite_condmb_dhcs_not_voidpool_condmb_dhcs_renewtime_condmb_dhcs_rebindtime_condhandle_rule_flush_DYNAMIC_LINKING__RLD_MAPlibgenio.so_gp_disp_DYNAMIC_GLOBAL_OFFSET_TABLE_libnetlink.solibminitime.solibmbus.soerr_disable_watchdogerr_intdbg_InitSaveStackAreaerr_last_resetdbg_scandraw_lineuninstall_rst_hdlrerr_attachresolve_stackFrametrc_vattachload_initerr_config_watchdogtrc_write_event_ntrc_v_dealloc_eventerr_statisticserr_escal_cfgeint_inittrc_vcreateerr_recov_cfgerr_filter_leveltrc_allocate_eventtrc_printferr_fully_initializederr_report_ctrlerr_get_pmdload_resetdump_raw_stack_frametrc_viniterr_get_errortrc_v_alloc_eventtrc_vwrite_nload_valuestrc_initprocessor_exceptions_initvtrace_PRNT_rewinderr_initdbg_scanhexdebug_handle_eventtrc_registererr_get_policydbgos_initerr_kick_watchdogswwdtrc_stateerr_set_policydasm_initerr_init_earlyprt_set_initial_levellibdhcpcommon.solibssl.solibcrypto.soRC4_optionslibadsl.solibasync.solibunseal.sototalmemliblibbzip2.solibliblzma.solibcryptoapi.soaes128_create_cryptorandom_get_statsDES_versionrandomxdes_set_odd_parityaes192_create_cryptodes_key_schedsha384_initrandom32libdes_versiondes_ncbc_encryptdes_optionsaes256_create_cryptocapi_get_cipher_by_idlibmbusclient.soENVgetenvstrcwmpd_setAcsURLlibipkg.soliblbi.solibsqlite.solibrelay_api.solibhard.solocaltimefnreadlineline_find_valuereplace_valueunescapedelete_valuentp_deltatzsetumasklibrip.solibupgrade_api.solibboot_api.solibpthread.so.0libc.so.0librt.so.0libdl.so.0__clz_tablibgcc_s.so.1_ftext_fdata_gp_edata__bss_start_fbssGCC_3.0, y&Pe<'vx!'௼<'vT!$'90 <'v$!('9 ' !<'u!!'$$'\ <'up!'௿$B0B@ "$!  "$B BY $B@ $ $  $$!0"' <'t!'௿ $ $4@  $B ،B@ | $ @| ' <'s!ˈHFЏG! !C8(! C8I <'s!DE$<'s`!B$cTĒPC(D$B]b$’Ph| hd $48T<@LdPhѴl$ppt@x8\h $<'q!$$$$b$b`l`p`tfx`|```$c $$Cl@\b@`@d@e@h<'q!'د$ (+!@ !$ $'(0$ˈY $8Y @8! !$Cbh$G( bl@$c 0!$B@ !$Clb$( @ $c $ $ $X$$C$hD$$cl$t\`dep$$$"8  !0D!Y  !$XB0$Џ$ Y$ '(<'o!'௿ $@$' <'n!'௿ $@$' <'n!'௿ $@!' <'n@!'د ̯(!0! 8! '(<'m! $@<'m!'௿ $@$' <'m! $@<'mp!'X ldh(!'d ' '$,p'8' $X'`<'l!'X ldh(!'d ' '$,|'8 'X'`<'l\!'د !@!$ `(b!@$i $@(C!`E$$@(!`$(b!@ i $$@(C!`G%X#0!  !0!$ '(<'kL!'௿(Ԍb@$؈`($b$ؤ $' <'j!'tplh!BBD  !'$$'9t $Q'(@)$ $(\@$ȎBBP!  !(! 0!(@$ ,' $X(ԏ@$܎B(ԌB$ԌE tplh$'x<'i!'请䯶௵ܯدԯЯ̯ȯx!!$ !! ! ! '@!@!D  !y$$/v !C&d&s0 $ @\' 4 $O@T '  !' P @! !P '  ! '@!0B@  !$p8!(!0!'9"P ,@!$ 0!@@! ! $@@!  !(! $@0! !@(!D  !D  !h ' $C' 䏤 @!菷䏶܏؏ԏЏ̏'<'f!'쯲诱䯰௼$'@@(!$Qt$ ! !@(@ ! $@ !@(! ! $@'($ ! $($$ i'$ ! @@ ! ' $0B@@ ! ' ! @!@8!'$@ !(! 0!'9"P B$ 0!A@!($L' $A@!( $lD @ !! '@ !(! $(!@0!@ !D @ !D  !| $쏲菱䏰'<'dL!'8į$'$$Qt ! !'h !$@@(!($ ! @(!4( !@ $$`! '$(C$ٌ ď$'<'cl!'8į$'$$Qt ! !'h !$@@(!($ ! @(!8( !@ $$`! '$(C$٬ ď$'<'b!'h$''9t $x( !@ $`! '$(C$ h$'p<'b!'8į$'$$Rt@! !@'h( $ !(!@! $@($$ #4' (!@!$b$b$  !(!4 '@!$b($ 'ď$'<'`!'TPLHD@$'$$Rt$@!T !@,' $O@l'` !'@! $@$($4' $A@!(' $X8!'8 !@(! $@$8b:$ b(b @$ $bb (& $x$ 8@(!$ $8!bh$ 8&$'8 $8 !&*`àh0! ! 'h!80! ! 'h1$ 0!A@!(/$L'h` !(!@! $@(!( $|@   ! $ `h !(! $!@ !D  !0$N TPLHD@$'X$$<']t!'쯰诼| !0!@8!`(' !A $ڀ`! '($ڤ 쏰$'<'\!'tplh$'$$Qt ! !'( !@$ڼ($4`! @ !'@2$ ! '(! !@$($ $`! @ !'$ ! @!'(! !@$($`! (!@0! !'(!0! tplh$'x<'[L!'plh$'$$Pt! !'( !@$ڼ($4`!  !'t@$! '$ !@(!($ `! @(!t@ !'(! plh$'x<'Z !'쯰诼$'$'9t (!$$ 0!C'! @!4@ ! @@!0 $H'4 @!0 $H@!!(`'h 0!$  !  !쏰$'<'X!'௿X $' <'X!'@<8$'$'9t !$4 (!C'! 'h 0!(`@8!$ڀA !  !($4 @<8$'H<'W!'@<8$'$'9t !$'x 0!C$! 'h 0!(`@8!$ڀA !  !($T @<8$'H<'W!'@<8$'$'9t !$< (!C'! 'h 0!(`@8!$ڀA !  !($t @<8$'H<'V0!'<8$'$'9t (!$$, 0!C(!( $۔, !@ $`! @0!(` $ۜ($! @0!(`$A ' ' <8$'@<'U!'<8$''9t $@'& !( $@'$( $|@'$( $4@$($8 A 'h(` !$\ @0! !($ܐ <8$'@<'S!'h$''9t $ԏ( (!l@$4!  'h$'p<'SX!'௿ $0 $N$' <'S!'<8$''9t $$ (!C'! 'h@8!(` !$ܨA'  !($4 <8$'@<'R8!'Я,($ !$!!$!$R!'b!`(! !'9t 0!$CO$B0B,B @& !' 0!@!`8$$.b5&qC1$+b$(! 0!%@!$(! 0!S#8 $*@ !$( $؏@ ! $( $܏@&R$*B@&!!@(!h`0! 8! !$B `0!h 8!' ( $䏼$,($ '0<'O!'௿' $'( $ԏ$' <'O!'쯲诱䯰௼!!!!  !, $O!!'h ! (! $@K$ h0b(b @$ $b !+Db$b!%D;9&( $x+!1@0 $N)ࣰh ' @!h'(!$F0#h$B0B,B_@*N@& (!$$ @?@$`^$''p$Rt !`(!@! 0!@!$"`(!( $܏@ !'`(!@! $Q<@! !`(!@! $P`(!($@! ! $!!`(!$Bt"!&R &1 @ `(! @ .CB@($<`(! !($`( $|B@D!!(`$Bt!f?'@$ݜ<ff4BfgBC<ff4BfgBfCG#b!C# @ ! !  !<ff4BfgBÏ&E'& CC#b!e &R 0 $N.B@/!<ff4cfgC'Ï(`$Btb!F'$ݜ&s Cd#!P# @ ! ! $ !$&R  ! 0 $N.B@<ff '0 $N(!($ݨ! E!!`(!$Bt"!&R &1 @ `(! @ .CB@  !&`(`(! $ݴ@ !(! 0!! (!@k΀` ! (!($ݼ ]@Z쏲菱䏰'<'Hd!'|xtp$!!' '9t $' $ !@0!($4`! @! 0!$(! !8!($L  @! D  !|xtp$'<'G`!'`$'0!$Rt@! !@!$"x$(' $܏@ '( $Џ(O$( $@O''8` !(!@! $QBh  !@0!$%,%@ 4$ `, a@ $ $ F+@$K4<4B'h(`'h$  !  !Y $d(` ! $L ! ($t, $0@!| $`!'<'E!'h ' !! @@!"@'P (!  !  !(ͨ $㠏 ( $޸ /  !ͨ '(  ! ' (ԗ $䏼 $@00c'(b$d('($ $ h'( ' $ !PC'䏤 @)$P' ! '  !0ͨ $  !| 'ȏ ʗ̏(ԗF(#$  Зҏ(ԗԯ$D (# $`!'<'B!'௿ !<'Bh!'د Pe!8/D, e(!C `$D0$D  "@$$ `!'(<'A!'௿!t$@@ !@ $E P@$ $`!' <'A8!'௿ @@ ! $' <'@!X@ Ccp`!   @ !<'@!$b BBt@   ` ! <'@4!'د Pe!8/D, e(!C`$P0$P $  & ! @(! @ ! '(<'?|!'௿ @ ! ' <'?8!'د Pe!8/D, e(!C`$D0$D %  @ ! '(<'>!'XPe!8/D, e(!'CP`$E0$E  #ePD8/, e(!'Cx`$E0$E   @ !'<'=!'௿Pe8/D, e(!CD`$D0$D  @ ! ' <'= !'8Pe"!8/D, e(!"C`$D0$D  ' @ !@!$b^`!$$/b$`N$/B !(\$߄ $@  !0\$  $@ !4&(\$߈ $@  !4\$O $@B$Cq+@&&1$/&1#+@"D&1@ $/$/&"C&1@$/"&1@BQ`!'<':!'@Pe!8/D, e(!'b@$d0$D  @@ ! !#P,bXdb`bbhb0b4b8b<b Fb $'<'9!'௿!`E @!$b B#`!' $$<'9!'HΠ! '@@ ! !P,bXdb`bbhb0b4b8b<b Fb $'<'8(!'hd`Pe!8/D, e(!'b@$d0$D  @@ ! ,0#, #b$eb( #db4`fb ` $hd`'p<'7 !'d`! '@@ ! ,0, #b$eb( #db4`fb ` $d`'h$$<'6X!'د Pe!8/D, e(!C`$D0$D %  @ ! '(<'5!'௿Pe8/D, e(!CH`$D0$D  @ ! ' $$<'5 !4$ce f|gpetd<'4!'௿X8$$b$b$@$<CBCxF$BY|  XB' $<'4!'௿$/b XC!@B@ $$ $$' $$$$<'3L!'௿8!$H0D$@$8F!a0D0$(@%$Y$C$C@$W4 @' b@<'2l!YD <'2@!'௿ !(!@0!$ ' <'1!'௿ $BFYt ' ' <'1!(!#$B$h0cb8!$b $BGYp $$(<'1(!'د$ $B$C0P$(!BGYp &$@ !#P&"!CCC$$ `!'(<'0h!'د !!$'9Z4 $@@ !B@!"$b&.@ $ $B(C`⬢ $$#b$b$Wb! '(<'/|!'௿&.&. X!i0$$a`!$b#E$$·0C+@$ !6 ,$÷B@0eD0b÷ !$d#C! ķD)$ 0!C$c(d  C$$ CP@ !b!' <'-!'௿0P&@$cC!B2$0&$$ $'9Y &@0P$ !'9Y ' <'-H!'0̯ȯį$!!'9X !$ ! 0!@8! G(`$B@ !$ߌ0! TT$'9Y X$CPQP$('$YY $ďY $2$$Y[h  !@&$Wb$@C#BC#(B@_$$Y[h '@@!$$b$b$$􏙀$'9Z4 $CB$,@$ .$.'9\T  !@#B$c@D0b÷ !$d#C! ķ0eD)$ 0!#BC#B@' @$' %'9X` $,b@$c"$B"D $@r@!@(B@` !$!$(@e$$$QY ! $ ! $' !$ &] !@(! ! '2 ! @(!' !p!D&] ! @(!&0P.@p!@(! ! "2 ! @(!Y $$B$$RZ4@! !@!$"" !b@!$$@! !Q !b.,C.` $'9\T @$$$YY$` ! `$'9[h '@ $b$b$bY $2DD $'9Yd ̏ȏď'<'&!'x|xtplhd`$'9X !@$@ ! $@8!G(`'@ !$ TT$'9Y $bP($'9Y $ďy $2$P@P@!@$'9Y &$'9Z4 $X$D C$b$b$bPPb$B$b(B@$(B@$C$b!$b$ $x$v$t!r$!C!XB!b!$$SZ`! $@!$$#b `! $ȏPS$"$B"BPP.B@($cנC!B\!@#$b$$b$b$3$$ǯT"T'0BbBC$X$#!&C#C&@$cC!CC&0V$$"$"X!0W$` `!$&$` !'9Y `W!$7$$"&$G$b0c$ +'B@$e'9X` 0!#C! eD 0!@&@! !C$cC$C$(b@&C$0cBP@!@ "L(`F'$ DTBP@$bLCL$b !$$E!$,@f$ !'9Y FB@ $eD'9X` eD  $$CL'9Y$BTb!d  DD $'9Yd |xtplhd`'<'0!'௿!L(0bďԍ'$H@$e$$+@g(# !` !'@ 0!@($BH@@($Bt$,$ܯ$#܏x$ܯ,$0'`$ $0CB84$$,,$ܯ$#䯢0|(x$B笏P$ ' @l (!'D $@@!<4b"4b"  <($BĮ <($B<($B<\4QlD$ $D'00 @(!ظD $q$D ` !D@50 @(!<$PC%$$ ' @($B<$b<$PC%$$  ' @ ($B,<($B\<4Q!(,$B|< 4QP$ '  !\XTPLH'`<'h!'x|xtpx!!!' (! $'P ! (!$$ $ 0!@ !T`(! @!@!  !!@($B谏`' @ !'( @!@@(}$B؏($(!$hD'h 8!@@m(i$B0( ,B@@`(\$B<h0B@( '0@@N(J$BhDhB0B@Џ( 'P@@9(5$B餗Z\hB0B@t( '`@@!($BbP$  ' @$@($BP$ ' @  !@($B8B<4Bl $!|xtp'<' !'HD@<8x' !!!@ !(! $  (!P 'P $ @(!@?(;$B谏` '@ !'( @!@(!,(($B؏D('0 8!@$ ($BP @(!@($BhP@(! $@ ($B8<4Bl ! $!HD@<8'P<'<!'840,(x'!!!@ !(! $(!P 'P$ @(!@ :(6$B谏` '@ !'  @!@ '(#$Bؗ$ l  (!,  !@(!P $@ ! <($Bꈮ"<4C840,(`!'@<'!'د$ !!b$p@<  (!@&&!B4C$ `!'(<'!'௿0!b$c@<bD $c$cPe !!b4B' <'|!'د$ !!C(!`$P#!C*@$P !B"$B"&@<4C$ `!'(<'!8 B<'!'ȯ0,($ !(0B$ %#"('6$/0 %&2(0$4 +B& ' (%, $@$ < @(! &̏$< &̏ @(!*b@ &s,E$ &R*b0 $N"# 0B" !$b $(*2(!0!$Tb(*2(!0!$0,($  '80,($ '8<'\!'tplh!!0@!0b !(@'` 'd`  #@d#C#dD!e#C!<$H< @0! (!( $'`@!$F$0 $ % $bG DcB1I-%PTXp\( $cC!B\!@(5$<, @K!(E$L($`( $x,@K!(E8$($ ($ @'9D &7($ 0($؏($@($E($E($($4($\($h($|($($($(1E $؏0$N <b4BMBC #tplh!'x<'!'840,($ <!! !@0!(`(! $'*@J!$@@!Q*@*!(F&$ '*@*`!*@ 0#4'$ &S*@@!Q*@!C,$b0B,B`&$@'$. `0!*@*`!0' $N&R' &1S*@840,($ !'@<'!'hx'!$p ! (!<0$<4C<P (!$ <@4c!`!'<'X!'Я($ !@!B@ (@$  @@C` C( $,@b < d@(!( $ ,@ "(@(($$$($, ( $4( $@Q($P "$Bb0 $N1@X!"b"$BbN!!( $T !' $@ !$ b$( $d&'$ $$yb $Yb $nb$Nb&* @0 $N$ $nb$Nb $( $$C!($ '0+@!+@ # !`0!!(!`8! #@d#C#D!#C!<'!'د$ (!$q(@$r( $( $,B@( $( $0,B@4( $P((!(! $p$ȏb,(  $ ` (0@0!00!0(` 0 $ ( $( $$b $0  (!( $  0@ !  (!$ !'(<'d!'௿ DD0 (!!' <'!'840' !x$(!' ! $ P  (!`@' @ !D(!0! '(@ $($B0B@0c` !840!'@<'!'d`\XTP,!!!x|@< !($cDC!B\!@ !'8 0!@ !F0B@80b0B8@(&($4'< '@$C ( $<$F0B@< b0B<@  !"0B@D 0B@' 0!@  !4(!$K' @ !F0B@G 0B@, !(!$Ɛ$D($EH0$EHP  !`''8'D 8!@3$  !' @!!&P+@  !$b 8ͨ $M$$ͨ '$b<$E4,$E菙ͨ  !8'bD#$O  !"!x!($ꨐe fghijklmn ꨐc E DFGHIJKLMNC < ! !'8 0!@ !F0B@8B'C&80B($4'H '@$C !F0B@HB C&H0B@G&G&,B@ !d`\XTP!'h<'!'ȯ40,($ x'!!@ !(!$H !$N*@$ !/$D!X' (! $ $P@(! $@ (!( $L ! $@  !($p c$b CbP@(!B$ @Q$P ! '  !D@!$ #!($bHBcH"# @(!ͨ@ ! &s<$E4$,$E菙ͨ  !P' $'0! !@@(!$`(!  !"!(!H$\c\CD!40,($ `!'8<'!'ȯ40,($ x'!!@ !(!$H !$\*@$ !=$R!X' ! (! $ $P@(! $@($L0B@ (!((! $  ! $@  !($ i$b CbP@(!B$ @W$P ! '  !J@!$ )!($bHBcH"!#0B@ @(!ͨ@ ! &s<$E4$,$E菙ͨ  !P' $'0! !@@(!$`(!  !"!(!H$\c\CD!40,($ `!'8<'!'د ,8@o!($cXC!B\!@8 ! $M'@$ !  '(B@ 8$CMdBMc ($bEDcB !  '((X!$bDEFGHIJcB  ($ $bDEFGHcB $ @4BX! `!'(<'!'쯰诼x'$!! !!(!$H௠䏶 !'  !x(! $p'('$',$'௢'䯱ܯ` !(!0! @8!@@!x' !(! $$(!P $@(q$h$ @( $40B@$@( $|@( $$ ( ,@( $䏼0B@4 @4( $(40䏣84@<4BPb%8$ ' @$P ' @ !<@'<<$EH($\  !쏰'<'ب!'tplhx'$4@ ! (!$$ $ 'C$@( $ ̏@<Pb%@$P ' @!@($( $ $.@$$ ( $ ($ 0($ P($ x $ԏЏ̏ȏď`!'<'!'Xx'X!!! !(!$0 !'  !x(! $4'$l'4x'D$`` !(!0! @8!@F@!t@ @(7$ P$ ' @<(,$ @C$< b < b< b< b< b( $ @0B@( $ P$ ' @!($ T !'<'!'80x'8!!! !(!$  !0'@؏$ !@(!`0! 8!0@('Hx !(! $40$<(84,?l( $ t0( $ 0( $ 00 $N0&q$ (&D$B 询 (($B $8&# p$BT(($ &eB$B 0,& $ (l $0&D(&q&# p$ 8&eB& $ lP '0@THL 0@ ! @!!C$/0b($D T($D \ (!h0\0B@ < 0@(!($ d(,$ l $菙< 0@(!($ l 0'b  !,B0@$.mon($ $ t 0!0p( $ |0h0B@ 0b@L $E菂( $E8@($EX($E`( $@0><d `@8!$0b !($D0!($  $ 0' !x$ $.0h !$$#Fb$@(!D!BP$(@#0c$BT(b!f$  (!00 $N0$P (!0@6$$'<'!'8įx'!!! !(!$$ !'  !x(! $T'x$',$X`0!@8!(! ! @'@!h  @( $4xP$|,c#($hl$ ' @!( $ !ď'<'!'8x'!! !!(!$$ !'  !x(! $T'x',$X؏$ !(!`0!@8! @!(!P@$$lx$| (@ !( $  !'<'T!'Xx' @ !(! $T,(<(($B\$$ $q$  $ Q Px 'x@@!(xB$p'$ 'x@8!('Z $X!#+@$b(+!$&e @$:$  X+', '@ $lb($E( $E(h@($E0($E8($ $P ' @$$'<'T!'840,($ Dx!&4 !(!D $($ &\x$!$$(4 ! (!\2@@D$4 2@@8 $@@D $܏@@ $&M $(($@ $0$H $؏&M(!P $̏0 CDEFG H( $L$Cb$!!D(c$4$B(!$E(! !0! 8!&10$ &R\."@840,($ !'@<'!DB<'!'ȯ0,($!B0(٬ $X<$$ 4P@ !!DKD< (!$ $@ ((80$l$$Ɲ $N24 ' @@!("$ ' @@!($ ' @@!( $䏙$ ' @!@ !($(0$ $N!0,(`!'8<'!'௿  !l ' <'!'௿$b 0!D$P$b$ @0!!' <'@!'Я,($ x'!!$ ! (!(!P $+@ !P '!,($ '0<'!'Я($ $,!@@!(D$cpC!B\!@D$&'()*P$bD$f$GHIJ$"P$$z$B$@D+@ ((0$ $ $N<k4HDP$|a$"D@$P$Y$P!'$ $ $@H%EPA$"D@<$C<d%C$4Bb$DP$ -$$'$ $ $h !  ! @!(!' @0!$$ P'"P$p$ @@!($ !'0<'!'د $, @]!($cC!B\!@D$bDEFGcBDDB?DB:DBx5D<B/C$ !D$D` &$$C"(&$ $H@&% ! DB 0BD` $0 @ ! !'(<'!'Я,($ 0!( !!$N$(@!$L '(!x$ !@ @ !((0$|$$N <4B`! $h ! @(!' $ @(!P $@@!`!,($ '0<'!'Я,($ x'! !!$@ ! (!((0$$ $N<4B@! @(!$P  !@' ,($ '0<'!'௿$@'9,@$ '9 ' <'!'PLHD@'! !$x !((!@ !@! 8@ !h @!@ !'8 0!@!'8@$8S@'9, @!  !!$  <'<@'9 $@! (!@0!< @!@ !(4 8!@$F  !PLHD@'X<'!'௿$@'9,@$'9 ' <'!'௿$@'9,@$'9 ' <'l!'௿$@'9,@$'9 ' <'!' ` \ X T P L H D @!<m4BD€@#$$ $@@!x' !(! $$ $ '    @ !4@ 0!A @! @ !<B4B$:@6!x' !(! $xP!Bxx'$ !(! @' $(!    0!4 0 @ !@0!@ (!ǀ'$*$`&*@ @ !! ` \ X T P L H D @' h<'!'௿<$4B@'9 ' <'!'௿<$4B@'9 ' <'P!'௿$  !@'9, @!DB0B`!' <'!'௿$ !<4P@'9 !' <'!'௿$ @'9,@$'9 ' <'0!'ȯ0,($  !! !@/'x(!$  ! @ !@ !h @!0!@(!  '$D'%"#$% &1 '$"% cc$b@ !D $0,($ !'8<'}!'د $Q!Dx(!$ $DP$ &%D($@$ @&" '(<'}4!'௿$ !(!@ !$  ' <'|!'ȯ0,($$B@! < 4P@ !$, $ $((0 !$ď$@$N 0`! < (!@ !$ $ @!' ø(00 !$$$N($@! @!!(((0$$$($N !0,('8<'{`!'d`\XD!P$CdBc$D$' D  $@5 @ !( $@@'@! 4 (DЏ$@ ! $H@!$ !  !  @! @ !`(! 0! @8!d`\X'h<'z!'د$ D$ !4&C8! @@8!Dx&Q (! !@ $ &BP (!B  $@8!$ !'(<'yD!'د D!!B$D0B@ !$c$b$b@ D#$ b$$b$b! #@!$b ! !@'9p ! '(!<'xX!Dbb!<'x !D $B BD0B@$c` b$B B0B@DB$!<'w!D $B BD0B@$c$bb $B B0B@DB$!<'w!DB!<'v!'د$  !! !! !t@@(!C$d !b`(! @! !$ '(<'vP!'Я($  $! $@ ! '@$"' 8!$ !P!'$`! @!`$"@!($ `!'0<'ux!'ȯ40,($ ! !D $&Q (!x$ ! @!$ !hB  !@(!$ D $ (!P $@_@!Dx(!&Ё ! $pD <qb%4 60(,b@,($cC!B\!@t(! 6&ŁD$  Dt$ȏD $<C%1b0B@6D !0!40,($ $ '8((0$T$ $N!40,($ '8<'r!'௿@!'9p $ !Џ ' <'r!'௿$ !(!@ !$& ' <'r@!'Я,($$BP! <(!@ !$&$ @!!(((0$|$$($N !,('0<'q!'௿ !D$$0b0! @0!!' <'q(!'௿ !D$h$0b0!$b @0!!' !<'p!D!cP0c<'p!Db0b0!<'pX!D$B0C$B0B!<'p!D$B0C$B0B!<'o!'ȯ0,(%!  !@<74B  !@ !'  @!@@!<4P DCT  !x' !(! $(!$DPBT @ @!(4F  !$ '!0,('8!<'n!D$B0C($B0B(!<'nX!'840,($ Dx!&0! !(! $4 <b%$b$$ (!@HQ#(,b@>($cC!B\!@t$(!6D$ $0D$$4D$$D $ $@!D$S0t$D ! $T@t$  !"<C%"R0B@6D !0!840,($ $0 '@<'lH!  <'l,!'د$  !! !! !t@@(!C$d !b`(! @! !$ '(<'k!'د$ |$ 8!!' 0!$b!'$! @!`$$ '(<'k !'௿$ !(!@ !$' ' <'j!'ȯ0,($$B`! < 4Q@ !$, $ $((0 !$$$@$N `! <@ !(!$' $!(((0$L$$@$N  !0,(`!'8<'i!'LHD@<8x'!<` !!!(!$  4R !`(! 0! @! !@`(! @!@!LHD@<8'P<'h!'LHD@<8x'!< !!!(!$  4R(!` ! 0! @@!@!LHD@<8'P<'h!'plhd` !X! !'!x !(!@$  h @ ! !@(!X $  !'X 0!@@!Xbc'8$ (!0!b ` ! X@!@ !@ (! !plhd`'x<'f!'HD@x' !!$ (! 8" !D$8$ƃp'8P8!D@p @8"0"HD@'P<'f$!'௿$ !(!@ !$  ' <'e!'Я,($$Bp! <@ !(!$  $!((80$$$@$N <4C,(`!'0<'e!'௿$P!$D$ $!((0$$@ $N <4C$ $@!`!' <'dh!'௿D$P&$b 0! @0!&P@$ D$P$b$$b @0!!' <'c!D$DL$b(!H@$!<'cx!'د (!  @ !@ !@!DE h@ !  !@8!(4f  $  ! !'(<'b!DB!<'bh!D@!%"C$EFGHD@%"CDEF'B!<'a!D $DL$b$H@$!<'a!'h! .!08 $< !@'x`! ( $ď@  @!<C%1 @'p(7$x(!$  !@ !h $@(!$  'R @ !p(!P $@($t0B@($@x@ '($d(0$ $N<(4Dx !(!D $Tpxx&P$$T `d ! (!'h"#$% &1 &&"&C !!'<'^!'xtp!'$P     ' 'P$'d $xtp'<']!'x|xtpx'!@ !(!! $T  !@V !( $|@ ((0$$ $N<]4Bh  !@ @! @!@8! !8 0! $L@ !'0! @!$ !  @(!@0!'hD% $ $% ! cf$@8!$P $ $(4 ! $!|xtp'<'[x!'Я($ $P!Dx(!$ $T 0 @& "DP$ &$P@'"($ '0<'Z!'௿$ !(!@ !$ , ' <'Zp!'ȯ0,($$B! < 4Q@ !$, $ $((0 !$$$@$N `! <@ !(!$ , $!(((0$$$@$N  !0,(`!'8<'Y@!'Я($ ! $@!(((($$$x@ $0$BN  !40,8 !($ '0'د$ !!! ! @(! ! @!$ '(4`bEc`!<'W!'ȯ0,($  ! ! !F! @!(((( !$$$戏4@ $ 0`!$BN < 4B  `(! @0!!0,($ '8<'V!'<840,($ T!!2!!`#! @'93 @0(((($BN$$$ $ )C",b+@$b",04 P (!@>(!  $@H@!   !@4 ! !:`B0B@<"0C%$B"0",@!$B",C<@ C%B (! 0!"8@04@0!B'93  !<@C%"8P080(((($BN$$$ $ !<840,($ '@<'T@!'௿4E!@4@8P@8@`b@C4 4  !!' <'Sl!'<840,($ !($$!! !(! !P!!@ 0!@$4%T'93@ @#@!P$@ `(!@!@` !9X #P&L@+@ !`(!8!'94 @!<@4B @Bl ! $!<840,($ '@<'Q!'@<840,($ ($!! !(!!& ! !@'93 !@@!0((($BN$$& $D<84RX@ @%T'93@ 0!@B% &L ` !$@P `(!@@!9X ` !#P&L@+@ !`(!8!'94 @<4Bl ! $@!@<840,($ 'H<'P !'840,($ ($!<!(! !!&& 4R(!@'93 ` !@!&&((($$@$ BP0B@!d< @@!<4cC$fL   !0$BN l ! $@!840,($ '@<'N!'<840,($ ($!!!&& !(! !d<(!P !` !(!@8!@&&0((P$BN$ $<4TbP@fL'94 @@ !<4TB<C%l ! $!<840,($ '@<'MT!'Я($ ($!!$` ! (!(!@ !@'93 !P@@!DHE @!@ !@(!@'97 l` ! $ !($ '0<'L`!'<840,($ ($!! !(!! &&@ !@'93 (!@@!0((($BN$$&& $ <G4SB@PDH PDD (!@5@!<4cC$PD< (!@<4Bb$@FL !'93 (!P4@!!YP (!@@ !V!  (!@'97 !l ! $`!<840,($ '@<'JD!'د @!'9; !@ !9X  '( !'(0!b !C&,D!E&,B0B@+0!b8!b  B0c0BC0b $$b8!((C&,G! 0B<'H!'Xx' !!! !(! $p$@(! 0!@8!'98d $\'<'H@!'h@8!'99'  $\'<'G!!@0!'9;$\ @(!<'G!'د !!@(!(@$B`8!$\'9=, `0! '(<'Gh!(!@'9>| $\<'GD!!@0!'9?p$\ @(!<'G!'p@(!''9A $\'<'F!'d`\Xx' !! !(! $4$@(! 0!D$'98d 8!d`\X'h<'F@!'X!@' $@(!'99 8!X'`<'E!!@0!'9;$ @(!<'E!'د !!@(!(@$B48!$'9=, `0! '(<'E`!(!@'9>| $<'E<!!@0!'9?p$ @(!<'E!'P@(!''9A $P'X<'D!'௿@$P2! $\@! $' '$b$` $0!$!'$$@ $,`!<($ << $<<$$`!<<!4BC+@! @,`!<'C!'د P! ! !$@!$! `!'(<'C,!ٜ <'C!'Я($ x'!! !(!! $ !  (!@,$  !` !(!x@0! @!$0C!CP*!BC&&F*@$ ` !'@ $ ` ! (!0! !($ `!'0<'A!'௿0!(! $!' !<'A!'P|' !$T !D $ƅ( $' ! $TP'X<'@!'د !! S$DL@ b+@$be   @(!$ b$ $b$D8DD @b $Dt$DDC b$ b&&D !$ƅ $T $&1 '(<'?l!'د$ !! $IF10 !L@ (!$hb+@8!i @8!&1&R!$ '(<'>!'ȯ0@'$BJد@$BLd 0'8<'>T!'د  $  $ $$F$$2$F$2 $  $,  T  L      ! X ¬  !'(<'!'د !0  (! 4  ! '(<'>!'د D!C!0!D !@!,B@$b$$$b$$$.ɰ@  !  ! D '( '(<'=8!'௿D!C!(GD`3C!4C*@ ! A" E$  $$$$  E($*ԏ(T$*쏿 ' ' <'< !'௿X# A@! C$ b $b $<b( $*  ! C$b ! !!' <';X!'Я,($ x'!! !(! $P!PC!B (! $,($ '0$<':!'د D!C!D<4tK ' ''(<':P!'Я($ x'!(! ! $P!$'E(! $ $P (! $($ ,B'0<'9!'Я($ x'!(! ! $P!$'E(! $  (!P $($ ,B'0<'9!'H̯$0!! $ '0@!x !(!$ @]! $ S!$E(! ! $ ! 0!43 '$x@ !(!@<$ @ !(!x$ 'P@0!  !$@4, ( !(!x@$H  !(!x $ď$XȏP\@ 0! ! 4 @$ ! !'<'7!'d`\XTP̯lp$0!t! $ '@!x !(!$ @>! S!$E(! ! $ ! 0!43 '8@ !(!x@$ @ !(!x $$8l@0!@p !D(46L$  H@$ ! !d`\XTP'h<'5t!'D@<8$0!! $ @!$('$$(!  !4' 'A ! ! *+,-./4B"$"#$%2&'$D@<8'H<'4\!'د D!C!BP$ '@! `!'($$$$<'3!'<840(!5! (< @< pl4@@4pp%(!&0!  !!(4$B$ !$0!8! (菙X$B (8 !!R!@4< ($B$ !8!$0! (< @< p4@@4pp%(!&0!  !(  !( !t (<840!'@<'1!'X̬<!!$0!!$ 4S'@!x !(!@%$l R!$E(!'8 !$ ( ! 0! 4@ !D!X `!'<'0!'Я,($ !<@4tZ!' ! !<$'4tYP 'Q$R% P!$,($ `!'0$<'/!'`\XTPLHD@!!&d!(&b!$Q$+q $@}@!@ ! $Q4F ! $Q<84t> ! '8@@!P8b  !Y'x@ !(! $ !(!`f$+ @ !&!'((! $$$ 0!@8@!@0!@ !4# $ A(!  ! E(< $+  ! ! bďD $  !V!C! ! $!`\XTPLHD@'h<',!'௿D!C!Ԏ<4Bb$ ! $ď$D$ $' <',T!'\XTPLHD@D!!"$!3@c!$<@4t7 '8SM$( $+@!"@C"@ !$ $< !6t8 '8A (<8 $+H, ! $S4F ! $&0! ! 6t:@؎$ @(! @ ! @ !$!"̄ @ !D @ !<4C\XTPLHD@`!'`<'*@!'840,($ !U!0!D !@!$b$b$b<!U!@<4B ` !@!$b$b0 $B,B@ '@(0 $B,B@Ў 'Џ@$$ 0!@!A!<~4R'@(! ! $ !0! 43A<4V ! !d'8x !(! $!U!Bԏ0B@$$ȏ!&`(!'C$@ !"@& (!' $@"$ç@<B>:$ (!@2@!×8$`"$ (!@&@!8!#Bu!,@0!b0B0?PP@ !$M `0!$ȏ(! $@ @!S!C!B@̄ ` !D ` !1@! ` !$CS!C!b@,d `(!!!` !(! $ ! $ďD $!840,($ '@<'%!'8įD!T!!$@ @ !    !$CQ!@@ ! $S ' $@' Q!T!ď$'C<'$P!'XTPLHD@<8U!C!$$0!!$ '@!x !(!@J$ $<d$N CDEFGHIJKL M O RP Q&'()*+,-./016H$(!` !2345  $` !, !@(!`!  ` !ƀ  !D  !XTPLHD@<8'`<'"@!'௿D!C!@@ !  < 4t9 0! $@ @ ! ď ' ' <4B<'!L!'د  # D#C!#P!E!$ ! "p !ɰ@ ! <4B`!   !$ (!! '(<' X!'د D!C!P!(!'9[< $ȏ$(! !P $Yj '( $Dj !(! $ ! $ !'(<'\!'د !D!T! (!  ! $P'9[< 0!$ !'(<'!'@'!<!x$(!4C2@ ! Q!C!F$@(!b!$  !'#$@@@! &@'c $@B0c`4$$!`!'<'l! 0<'P!'د P󴯠$Bg ' !'(<'!'840,($ !!."@!<4BҬ ,b@ ($c' C!B\!@  !@!<4Crc <4Bp `!(@@   !@ 0   !@S&RPQ!C!0 $CAď@ !;P !2(!Q!C!0 @<%4BQ!C!0 @<4Bɰ  !ȏ0 $C $񜌅 ! b ?b @0.Q! d!B@&!P!$K&`BCDEFG H I%Jbcdefg h iL%kB CDEFGH b cdefg h l`(!D$n$ 8!840,($ '@<'@!'Я(p  '$('0<'!'Я,($ $!x2!(!$! ! Q!$@<b%<b%($ $xȮԮ !&  !0@0!0H!#@!<4B<b$4 $e$<b%<4B $ $P<40!g$<b% $$2,($ #$ '0$<'H!'Я,($ !!$R!!C$ !b &R$ %(!@&*@&1`*p@!<4C,($ `!'0<'|!'ȯ40,(D!` !@!' D@ !(!'$ 8!@4<$B8B0B@B @BQ! !BR$(!($+lB0B@$0B@$0B@$(Q!$E(!$+ <C4B$@q!D!$q!D!$ܤC@Q!C!C<d%C$ Q!C!$C$C !!l̎ ȏ$ @ ! @ ! @ !Į!40,('8<'!'د D!& P!!D ! $я !'(<'!'௿D!$ D ! $@!' <'X!'௿D!$`D ! $@!' <'!'௿D!$ D ! $!' <'!'Я , ( $     !($$+' 'h@!(' $,(!@!( $,@!!$x'p` !(! $$ `(! ' @ @'(!0! . T!C!C$bw!$x$d ! (!`(! !ͨ'  ' p` !(!x $$' `(! ! `(! !ͨ ' 菼 !(ͨ $,4$@ !x (!$`   !  !@0! !| (!@(!  !` !(!x $ !`(! $@(!' ꏙ $+(!0! . T!C(!$b$  < 4B<4B$ ( '( 'h@!( '@! , ( $     ' 0<'!'\XTPLHD@<8!!0! (!`b@!$ `(!( $,L$&ȌbV$c&R.B@.B@$ `(!( $,|<g4CP@ !'r !!&Ȯ6̮  !`(! $0@$ $ `(!( $,$& ! `(!$ȏl $$ P'9y @ !@ !(!P'9r 0!@!(!d0! $!U!ȏ'r؏, 'r @ !d$ ȏ<4C\XTPLHD@<8`!'`<' !'د$ !$(! 0!P!$.C!@ (!C$b $! <@ 4B<4B$ !$ '(<' !'\XTPLHD@<8!!0! (!@B@.$ @(!( $,L@$ @(!( $,|<4C!w!0$x !P$Yr '0̮  @ !@!(B@$P ! @(!!($,E,GHB&Ƞefghbd !(! $ @$ $ @(!( $,&d ! @(!$ȏl $$  !(!P'9r 0!@#!(! 0!!W!$, P$Yr  !ȏ$D <4C\XTPLHD@<8`!'`<'!'ȯ40,($ !d(!0! .0 !!C$b $d .<Q4B$d  !$P$Pr! 0!@ !$! 0!@(!d 0!Dȏ0 ,B@ $d <$4B& ! р!@ р!!lȎ ȏ, d$$ ȏ!40,($ '8<'!'Я($ !D!0! (!Q!$.0C! (!C$0b ` !D! <4B<4B@! D$ @!<4C$ !`0! $P($ '9r '0($ `!'0<'!$ (!<'t!P$'9r 0!<'T!'Я($ 0 !,B@3!(! 0!'!$DȌQ$$c(b@(b@!<4C$ `!<4C @@!H @!($ `!'0<'4!H !@! <'!'Я($ !D!0! (!Q!$.0C! (!C$0b ` !D! <4B<4B@! D$ @!<4C$ !`0! $P($ '9r '0($ `!'0<'!D (!<'!'Я($ !$!0! (!P!$.C!@ (!C$b  !$! <@4B< 4B $$ b!($ '0<'!'Я($ !D!0! (!P!.$ C !$b D < 4B<4BďP` !@@(! $D !($ '0<'!'Я,($ !d!0! (!!"$C "̏C !% @&*@&1@*P@!<4Pd$ !,($ '0<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< ,B !$@`(!D <4BP'9uT D$ @!!($ '0<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < &4B< ,Bh !$@` !D <4B`!  !P'9uT @(!D$ @!!($ '0<'<!'Я($ !$0!! (!P!$.C!@ 0!C$H !b `(!$! <@4B< 4B $$ !($ '0<'D!'௿P'9y !!' <'!'Я($ !$0!! (!P!$.E!@ 0!c$E(!$Pb ` !$! <@4B< 4B $$ !($ '0<'!'د$ !$(! 0!!$$CȌbD$c&*@$$ @*P@!<4C$ `!'(<'8!'د$ !D$P!0! (!*@p!$Bb!$bD$c&*@$D  *0@!<4C$ `!'(<'\!'د$ !D!0! (! !P'9t (!D$ @!!$ '(<'!'د$ !D0!! (!h  ! (!P'9t @ !D$ @!!$ '(<'!'Я($ !d(! 0!Q!$.2C!@ (!$0b ` !d! <@34B< ,Bl !$@d < 4BȎ`! P'9r  !d$  !(P$ $0!'9r '0($ '0<'!'Я($ !d(!0! .Q R!C!$ $d  <,4B0 ,Bd$@ <4B$ @ !$P'9r 0!@ @!d(! 0!d$  !($ '0<',!'د$ P$0!'9r !$(!0! @!P!$$C! @@!$ '(<'!'8į!$!!(!0! !P!$C!B$ b$' @!@ !P@ 'c b !P '#!ď'<'!'8į!$!!(!0! !P!$C!B$ b$' @!@ !P@ 'c b !P '#!ď'<'!'Я($ !D!0! (!P!$.C!  (!$0b ` !D! < 4B< 2c,BD$@- < 4B<4Bb$e% ԏ!($ '0<'\!'Я($ !$!0! (!P!.$@C!C$ !b `(!$ <@4B<4BP'9x( $$ @!!($ '0<'d!'Я($ !D!0! (!P!$.C!  (!C$hb ` !D! < 4B<4B  !P'9x( @(!D$ @!!($ '0<'T!'Я($ !$!0! (!P!.$@C!C$ !b `(!$ <@4B<4BP'9xx $$ @!!($ '0<'\!'Я($ !D!0! (!P!$.C!  (!C$hb ` !D! < 4B<4B  !P'9xx @(!D$ @!!($ '0<'L!'د$ !D(! 0!P!$.C!  (!C$0b ` !D! < "4B< @p!,Bd0!鼏$d(!<D@4g < 4BG$g$ !$ '(<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< @p!,Bd0!2cD$@- < 4B<4Bb$e% !($ '0<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < &4B< @p!,Bd8!鼏$d0!<4h2cD@- < 4BH$h$e%E% !($ '0<'!'Я($ !D!0! (!P!$.C!  (!$0b ` !D! < 4B< 2c,BD$@/ < 4B<4Bb$e% ԏ!($ '0<'\!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < &4B< @p!,Bd8!鼏$d0!<4h2cD@- < 4BH$h$e%E% !($ '0<'!'Я($ !$!0! (!P!$.C!@ (!$0b ` !$! <@4B < ,B$$@ <4B  !($ '0<'!'Я($ !$!0! (!P!$.C!@ (!$0b ` !$! <@4B < ,B$$@ <4B ҏ!($ '0<'!'Я($ !D!0!(! . P!C!D$ $D  <+4B0 ,B@ $D <4B` @P!D!SC<d% CP!D!D<4c $D$D !($ '0<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< @p!,Bd0!2cD$@/ < 4B<4Bb$e% !($ '0<'H!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< @p!,Bd0!D$@/ < 4B<4Bb$e% !($ '0<'!'Я($ !D!0!(! . P!C!D$ $D  <$4B0 ,B@ $D <4B`@P!D!$P!D!$C$D !($ '0<'!'Я($ !d!0!(! . P!C!D$ $d  <b4B0 ,B@ $d <R4B$B*B@$@ @CB, @?鼏 ! 8! !<4Bb$<<4Bf%(%($b$*(@鼏(!(8!(!<4<4Bd$b$0$<0%b% ! 8! !<b%<4B<40$e$<0$b%$d !($ '0<'܈!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< @p!,Bd0!2cD$@/@ < 4B<4Bb$e% !($ '0<'L!'Я($ !$0!0 (!P!$.C(!@ 0!$b $! <@ 4B<4B$ ̏!($ '0<'p!'ȯ0,($ !d!0!(! .P R!C!$$ $d <94B0 ,Bd$@2 <)4B%<4T$C%" @ !$P0!'9r 2d@!(! 0!@$x"T$C%"Ԯ"$d @!0,($ '8<'!'ȯ0,($ !d!0!(! .Q R!C!$ $d  <-4B0 ,Bd$@ <4B @ !$P'9r 0!d@!(! 0! $d  !0,($ '8<'H!'Я($ !$0!! (!P!$.C0!@ 8!2b.$b $! <@4B< 4B<4B$b$e% ԏ!($ '0<'P!'Я($ !D!0!(! . P!C !$b$D  <4B<4B`($D !($ '0<'T!'Я($ !D!0!(! . P!!D$$D  <-4B<*4B`$qظ $`  !@ ! $`  !@ !ظ $@D$ !($ '0<'!'Я($ !D!0!(! .0 Q!C!D$ $D <,4B0 ,B@ 0$D <4B#D(!`  @#<C%#d!e<D$4B($ e!($ '0<'Ҁ!'Я($ !D!0!(! .0 Q!C!D$ $D <,4B0 ,B@ 0$D <4B#D(!@ `#<C%#d!e<D$4B($ e!($ '0<'!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< p#,Bd!$D@ <4B s!($ '0<'!'Я($ !D!0!(! . P!C!D$ $D  <84B0 ,B@ $D <(4B$bP#C!@00#0@!0!:c<ߌ4B+($@<4B(%.cD8$($$8%(% !($ '0<'\!'<840,($ !!0!(! . !!!d$ $  <G4B0 ,B@ $ <74B&!@  !@ @!(x !b(! $!@!5!є  !@ @!8&$ !(! $!$ @!<840,($ '@<'\!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< p#,Bd(!$d!D@ <4B s!($ '0<',!'Я($ !D!0! (!P!$.C!  (!C$0b ` !D! < 4B< p#,Bd(!$d!D@ <4B s!($ '0<'!'Я($ !$!0! (!P!$.C!@ (!$0b ` !$! <@4B < ,B$$@ <4B !($ '0<'!'Я($ !D!0!(! . P!C!D$ $D  <"4B0 ,B@ $D <4BP@P!C!CS``(!c($D E!($ '0<'Ǭ!'Я($ !d!0!(! . P!C!D$ $d  <%4B0 ,B@ $d <4BP@P!C!RC@r@ $d C!($ '0<'`!'Я($ !D!0!(! . P!C!D$ $D  <%4B0 ,B@ $D <4BP@P!C!CS``(!c` ($D E!($ '0<'!'Я($ !$0!! (!P!$.C0!@ 8!2b/@$b $! <@4B< 4B<4B$b$e% ԏ!($ '0<'!'tp' !''h@ $ '( @!!tp'x<'à!'Px!$ 'h! (! !' !@:!''`(! $@!'h$  0! !(!b&R$ ͨb!  !(!x@$  $ `(! 'h$( '$@!*B@!$!'<' !'<840,($ !!dC!! (!0! .$"RdV$0d d(!(̏( &,'+菙 @!@@!@+2!$, ! $@@ !, $%@!&, @(!@! $, ! $/@!@ !@'+ (!@!$/2!(B@$(!d 0!!C!C$b  !$$ <+4BP'9x (!$@!<4Bd 0!"ȏR  !$d <4BP'9x (!d@!$ !<840,($ '@<',!'D@<840,($ (!$D, !@!/(̏ $d+菼(!0! @! ^!C!"$Ve$0 y(!`@CS!"$h  !@ !, $@@ !h !@ !, $%@(@(! $d,@!@$h ! !@ !, $/@@!h ! @@(!( $d+菼@!$/S!(B@-(! 0! ~!C!C$b $$ #<74Bh  ! !P'9x @(!$"@!<%4B 0!"ȏV $ <4Bh  ! !P'9x @(!@!$ !D@<840,($ 'H<'!'Я,($ !$!!(! 0!P!.$@C!C$ !`(!b 0!$ <@4B<4BP'9w $$ !,($ '0<'!'Я,($ !D!!(! 0!P!$.C!  (!C$hb ` !D! < 4B<4B  !@(!P'9w 0!D$ !,($ '0<'x!'Я($ !D!0! (!P!$.C(!` 8!$b D! <`4B<4BD"#"" ""B0B "!($ '0<'P!'Я,($ !0!! (!S!$.rC!@ 0!$` !b $! <@(4B<%4B "#Ԯ"&" 0c耮%<4B $"@ %Ԧ` !(! $ !,($ '0<'!'Я,($ !d!0!(! .2@ Q!C!$b$d @<#4B< 4BB0B  !<b% (!  $<4Bb$ԏ$d !,($ '0<'!'Я($ !D!0! (!P!$.C!  (!$0b ` !D! < 4B< +,BD$@/ < 4B<4Bb$e% ԏ!($ '0<'t!'Я($ !$!0! (!P!$.C!@ (!$0b ` !$! <@4B < ,B$$@ <4B ܏!($ '0<'d!'Я($ !$!0! (!P!$.C!@ (!$0b ` !$! <@4B < ,B$$@ <4B !($ '0<'T!'Я($ !$0!! (!P!$.C(!@ 0!$b $! <@ 4B<4B$ !($ '0<'x!'lhd`\XTPLH!$b,H Gc,Bx(,04! (!0! .p !U!C$b'8$ <L4B<I4B '< !(!x$ ' (@# !!T!CS#C!b&&Rb$@bb  b4@&Pe0 T!B@T!!&(!&$$  !ď&$ $P&E(!$  &$p&"` !ܯD &>"D&E`(! $@&E (! ! $@0@!(P!CDB#$@"܎"4B" !A"4B"A"4B"0B@"4B"@A"4B"A@"4B "@A"4B@"$b"4B"A"4B"""@A !!B@! g!BA $b!B@A$$"@!b!B@@ b!B@A!"4B"!U!B0B@"4B"0B@"4B@"0B@"4B"A"<C%"0B@<"C%"0B@<"C%"$@` ! '@@@<"C%"`@` ! '@@@<"C%"ЎԎ؎ܮ"#$%@#$%` !&% "&%Џ ` !0#H!CA$$E# %!bA "4B"b"b  "D!C#!B "#8!C!#U(!""B0B@"4B "#""""" "#خ$Į""x@ #$bD!#H!C#ȌB"!U!!#ЏC!bA"c4B"#쏙0 (c8c#"8B,B"#@` !8C #!& $(!&$ $@& (!&$9$P !Bђ#$t"&  !(! $@D&`(! $@DD(!0!'   $0B ""T !P` !&&'9r $@!lhd`\XTPLH`!'p<'0! 0!<'!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B ! !$@`(!$ < 4B`! $$ !($ '0<'!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B ! !$@`(!$ < 4B`! $$ !($ '0<'!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B ! !$@`(!$ < 4B`! $$ !($ '0<'`!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B !` !$@`(!$ < 4B`! $$ !($ '0<'$!'Я,($ !!0! (!Q!$.3C!` (!$0b ` !! <`'4B< ,B !8 @!$@@(! <4BCFGB !ЮԮ ܏$ !,($ '0<'!'Я($ !D!0! (!P!$.C!` (!$0b ` !D! <`4B < ,B$@D < 4B܎ЎԎ؎D" #% &!($ '0<'!'Я,($ !!0! (!Q!$.3C!` (!$0b ` !! <`'4B< ,B ! @!$@@(! <4BCFGB ! 쏼$ !,($ '0<'4!'Я($ !D!0! (!P!$.C!` (!$0b ` !D! <`4B < ,B$@D < 4BD" #% &!($ '0<'!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B !@ !$@`(!$ < 4B`! $$ !($ '0<'!'Я($ !$!0! (!P!$.C!@ (!C$0b ` !$! <@ 4B< ,B ! !$@`(!$ < 4B`! $$ !($ '0<'!'Я,($ (!!!@7!$b$b$$ܒ#&1"20%&1&R!F$cp` !(,! $,  !@(!0! `8!B#"!(` !! $,@ ` !(&! $-&R&1,($ '0<'!'د  40' '0D 'T@!Pb!D$c$BTC+@'D$BTTT T Q!T'(<'\!'Я($ DP!!&T (!&TD &TP!"TTd@ !`(!$ 8!"T(!(P$ԏ($  '0($ '0<'!'ȯ0,($ 4!!& !!! !`?@ !&,B_@&$\$"(@ ! ! $-,0!@ !"$$  * @$ $ @ !@ !(@ !$- ($- !  ($-(0!@ !$- ! &s& !0,($  '8<'!'`\XTPLHD@!!!`(!($((! $-   !  !!!BB0B@!(`$$-@0! ' !`(! '*b@$(&(!?$-H#b$#b&1&s#&1"&1B%4!B0&s T#C!$ b'$!B!w!B0B@&(e(! $-p ! (!$d(T!$E(!$- VP;@!R0B@(@ @   !@ !0BB$@(@@   !@ &$ ! (! `0!&B@ (!(&((!$- @0!  !&% &f`\XTPLHD@'h<'@!'د$ P!@!4@&1(@@ @ ! @4 @ !@0$$ '(<'t!'د$ P!@!8@&1(@@ @ ! @8 @ !@0$$ '(<'!'P!@!(@&1@ @ ! @ 4L@ !@$ 00R!C!TD' $ޏ@'<'!'P!@!(@&1@ @ ! @ 4L@ !@$ 00R!C!TD' $ޏ@'<'!'د$ P!@!(@&1@ @ ! @ 4L@ !@0! 00$ '($$ $ $(4 <'!'௿$C,b@0!($c'@C!B\!@$,$y$  ' DD$T(!$  ' ,Y  $ $' <'!'Я,($ Џ@C!B!0$Cq+@0`! & @ !(! 0! B&#"B&t&&&D&&,($  '0<'!'ȯ0,(!$B,B@ !,Y  $ $B,y $Qb@  ! d!c$cb+@ ,Y  (! ! '  , 8! ! $T$B(! $ 0,('8<'X!'௿!`$$b 0B@(!$ $' <'!'௿,b @7!($c'`C!B\!@,$y$ & ' 0B@$ (!$$ B0B@ Ѭ  ! !l ' ' <'!'د$ (@Y!(@( @T%@ 8,+y($B H040,$B0F $(!T $ $B.,@(e8 $.0 $8B0B@,Y(  !$  '(y0   ! $$b$$ '(<'$!'د$ $C,b@L!($c'C!B\!@(!TD $ , $(!TD $ ,$y( + !$  '(,Y    4,0$B0F$ ! (!T $ $$B$ '(<'!'<840,(,!@!S#%."@&T*@,@&1$,b@($c'C!B\!@$,b@# ($c'C!B\!@,Y    ! (! (!$,Y  !$((!8*8 ' @! @$$ ,`0!8! !  (!$"$b$TD(! $ ,$ y   !;$8$b$$"2$$B-$b)@%,Y  (!  0!@ $$C,b@($c'C!B\!@$TD(! $ ,Y$ b@$,  0!(!  !@@!$$C,b@($c(C!B\!@TD(! $  $TD(! $   !,Y    ! ! (!$(@@( @$$ 97, *8((!($B(!$.d 8! *8((!($B(! $.݈ $,Y    !TԎ$$  (!, !`0!$8![$(@$$ (!T4$ NTD $ , $(!TD $ ,$y( 8  !3,Y    ! (!#."@!$$,b4@ `0!y4 8!@,&"$ !@8!0$ <840,('@<'~!'د$ !0 !! 4$,b @@($c($C!B\!@5$$0$ (!TD $  ,Y    ! 4,0$B0F$ ! (!T $ $$B$ '(<'} !'د$  d#b!4!b@$B-⌬b,!!!` !r !#<4Bb$<4Bb$< b%< %b%$ܮ#"$@#<4B $b$<4Bb$< %<4Bb$< %< %b%<<@ %b%<4B %e% $b$d<4x@B! $e$$#(! "@ ! $ <`B $ '(<'{p!@D!C!E d#b!<@X` !0$` $b b 4Bb  <'z!'ȯ40,($ d@!@(!! D! ! $$ 8!!!S!gԏt@0Bb%: !?$ 0!Џ$b!B!$ܮDb  ! # l 40,($ ! '8<'y!D# Ѭ D !<'y!D#  D !<'y\!D# h D !<'y4!'د  D#C!C,$$c$8!C@ !0f $ '(<'x!'د$ !@ !C! @C!Q!@C$@C!Q!$%&'( )C!DEFGH IBЏ$C!$ܬCD  '(<'w!@C!C0!<$@ !$b$ !<$@<$b<$$@!$<` !$<C< $$@!$<$@<$c$@<$c$@<@$c$@$c`!<'v!'د @C!C !<b$`8!$b $$$$$$<C$@$b$$$$$$$$<C$@$$$$$ $$#$$<C$<C $$$$$$$#$< C$@$$$$$$$%$$$$$<C$@ $ $$$$$<C$@$$$ $ $ $ $$<C$@$$$$<@C$@$$$$#C$>((($B/ <4$#$/, $ '(<'s!@C!CP!H<$@<G$<$!$$b$$!$" %$<$@!<I$"<$!$$b$$!$$:8%$:8%:8%$<$@<$!$$b$$!$" %4#$BC$<$<C< $!$$b$$!$" %4#~$< $@&<$x!$$bq$$o!$" %4%f$$$:8%$:8%C:8%V$<$@<$P!$$bI$$ G!$bB$<$@<$<!$$b5$$3!$$:8%$:8%C :8%"$<$@<@$!$$b$$!<@$@ $ !$b!$!$!<'o!'ȯ0,($ $ !HAH!( @$ $ !c$ !-B@$#%P@!Q&R(@@ d @ d gPd݈ $\Ea$ 菙,@C!H!B @C!H!B @C!H!B @C!H!B  0)B@ (H!$E(!$/4 @0! @H!C8!2$0%2#0%2A0%  (H!$E(! $/l$@PH!C!@ $0,($ '8<'l!`!'@C!CP!KHCDG I<b$ @!@(@$b$b$%D*(%$(%<4Bb$I<"$@$<(@!<$b<$b<%%%:8%%:8%C:8%$%<4Bb$<"$@%<(@"<$b<$b<%%*%(%4#$%BC!<4cC$<4cC$<"$@ < <"$@< (@< $b< $b< %%*$(%4#%<4Bb$< "$@.<(@+<$b'<$b#<%%%%%:8%%:8%*:(%4%8%$%B!<4Bb$<"$@<(@<$b<$ b <%$$bo%<4Bb$<"$@$<(@!<$b<$b<%%%:8%%:8%C :8%$I%<4Bb$<"$@<@(@<@$b <@$b <@<4Bb$$%<@"$@(@$b $b<4Bb$$$ bB BBBB B$!' <'g\!'LHD@<840,(x@b!Pb!XTb!@ !(!b!$\ T$D!$P`i*$@ ."@!*@&!$!7  ! $c,b#@.!($c(PC!B\!@b<E$@$"" %,@ $&&$&BE%BDb<G$@$"$$*(%*(%*d(%'$@%$&&&&&ɢBEG%*"@<e$@$" %4#$D<$@$"<$@$$&,%4#,<G<$@$"< $@ $$&&$&$#PPC@C!C!B$& &%D$$&@ &$`!$¢&$#b&$`!b< C$@q$"o" %4%i$&$&&$%c&$&&&Q&b<G$@$bG$@D$"B$*$(%*b(%*G$@(%b  @(!$&&&&&&$B< E b<b<@C$@$"BC%B$$$$\@$ $b$$$$^$ @(! ! 0!!$*@$$!!T#DX $E`T0# f!T#Xb!LHD@<840,('P<'`L!<4H0-$F$$cD$H$E%a$<'_! <'_! <'_!'௿ d#F!D!̎C!$ C$ @! !! 0B@   !T'9, ' `(!! ' <'^!'\XTPLHx!@b!'b!!!(!$ b!HBCD EF<  8$48<@D0!P!C$b*"@$b$b&&"c %d+&1I%`&,@2G<$@%<E$ *"@<$b<$b<&&&20%&20%20%%8H%&1&<$@R*"@P$bL,@G%*@E<4H<$h$b%<4Bb$<$b%&&"4# %%# &$ 4#<$@x!0H$"04#<$<$@&BC<04B0<4Bb$ 0$0@<<4Bb$0!$PG< $@/<*"@-$$b)$$b%$&&&&&20%20%&H%"2 %4%0%&1&0<4Bb$0D<$@<*"@$$b$$ b $0<4B %b$0&1&<$@*"@$b$b &1D% <&$ E<$@*"@$b$b <04B %b$0&1&<@$@*"*"@*"$b*"$b *"0<4B %b$0&1&*"@x&(@&&# $d!,`g$G($c(pC!B\!@B<D$@$ܖCb!D$@$!" %,@GE2B<D$@C$bD$E<$@z!d$@t<$@qd$@o*"!B<C$@i!C$@c$B<B<@C$@Z!C$@T$ B< C$@N!C$@H$F*"! A$ b;@&XC@$B@C*@(C!$E(! $/( $/ԏ݈ $@0B4BDB8B<B @B$!\XTPLH'`<'Vh!'840,($ ,!!@>!$&&!c%.b@&*@&B,!,B @ ($c-TC!F$O !( !@0!$/! &s 0! !(! $/.B @$B00@*b0`@0@*b@&*"@&q*@!( ! $0&F, q#@!($c(C!B\!@$"+&&(f0%$0$"+&&&" %&"( %"0%$0  !&! s*"@r+(& !! $0&b%4#b&4#b1( !U$0$( !Q$0(*"@S+(& !! $00&b%4%b&( !;$0<*"@=+(& !! $0@$b&( !)$0L(`0! !$/$"&+&&&" %&"( %"0%$0T$"+( !&$0`$" +( !&$0h! +@ !(&@0!$-,! $O9*b`:#,b @(,b@&!, ! $菼 !`(!0! 8!$!@!&&" %&(" %"0%$0p  !&&&s`  !(@0!! $-&s&#840,($ `!'@<'P!'ȯ40,(P!@G!R!d4f +$@.f #$ b#$*((!&($0| (!"(*(!((! $0$݈ $$( $0܏#@C!R!@ "$ P#,@C!R@!C!C >0F$B$*$ !"# !$  ' "P("P@b!p!b dD+@$Tf$@  (!fcT (!$@0f0# "@b!p!$b40,('8<'N! d#b!d@D!PD!E` !@ @@T'9: <'N,!'ȯ0,($ !<@C!HC!%C@! $C!C!B<4cC$B0,($ $'8<$@ $@ D<$@0"b*(b@0<$@$ܖ&<$@0b*(b@0<$@$ܖ*d@(!<C$@$ @: ?Î&<$d@$ܖB#@(!b+@<`(!<$@0!&'t@: ?Î<C$@bЖC!Dd d04,($  '8<'K!@C!PC!b@T'9: `<'K`!'د  D#C!PT@C!Q!BD$@@ (! @C!Q!@ '(<'J!'Я($ !菙@D! C!$ $$܏ $ 8!$<0$D!t$@!C!B0!@0Bb%: ?Ï"(Џ$ C!'0$C<'I!'د$ D(`00B<6$&@ 0&@$ '(<'I4!'د$ #(! !D$$Bb!4!r⌏$B.,! ! !(!x $ !(!x $#<<4D%d%<F$<@g%<G%4e%E%d$<D$E%e%2$f$$-$#$ '(<'G!D#X D !<'G!D# D !<'G!D#l D !<'Gd!D#Ѭ D !<'G<!D# D !<'G!D#Ѭ D !<'F!X!0!C#CH!$C(!A<$<4c" $@ %@$<%"$ <"C%""@"@ <#4Bb$<4Bb$<b%<@b%#@< C%c*$C#D%&' ()C!JDEFG HIcD$Bb!`<'Ep!b#b!FDb(! bH!<b$@<<b%<@C%<$@< $@D$cC!B@% "G$G%"<d%a(!<@b$@$ $<b$@ !<b$@$$<b$@<@$b$@(!$< b$@ !<b$@$$!<'C!b#Db !a7<<@b$@$ $ *@*<<@b$@!$@$$$$$$<@C$@$ $$$$8#4Bb$<b$@%<b$@$$*@<$$$<$C$@$$$8#4Bb$<b$@<@(@<$$$$$$$$$4Bb$<@b$@(@<$$$$$$$$$4Bb$< b$@)<b$@$$*@<$$<b$` $!!$B@`0B 8#$$8#4Bb$G#<'@!b#DbH!(<<<@$@$ $0#!$g$<@$@$$!$$:8%$:8%#:8%g$<@$@$$:8%$:8%# :8%g$(<$@'<$@$$0#!$g$$!$$C%$<$@ "Cv$"Cq$(<$@<@$j!$$bc$$a!$$C%$D%$C8%P$<@$@< $J!$$bC$$A!$$C%$D%$C8%0$< $@*<$@$$0#&!$g $$!<$@$#$ b8`(!c0$C%D%C8%"G!$!<'<!'hd`\Xx!C#D'C!!!(! $("#$ %&'<@DHLPC8<@$@$ $0dD*@:D6<@%$@$$b.<@&&&20%&20%2$D#(%&@ !&&20%2&0%2G% %&<C%@D(<$@C<$$>$D*@:<$b7$&&*(%D#F%$&$-&8 &#<4B$+`8<<=<4B$8$-$7<8<C%8:84Bb$8<$@-$)*B@'$b#&&&20%&20%20%E%&R&<$@"@<@8<4Bb$L8<@$@/< $+< *B@(< $b$< &&&20%&20%20%E%&R&<$@"@< 8<4Bb$P8< $@8*B<$@$$0*BD*@-*B$b)*B<&$D#@&#$b !0$2&0%20%2 %&< C% <$@"@*BH*B@<4L$ << &D#@&!$I$b (b@$$b*B{bN*Bw"<E$@!e$@!ie%$e%e%<$C<@$@{$ z!8H%C%8&&20%&20%20%&$@@&&20%20%20%<@<$@D<@*%%G<$@C!A8L$8&&20%20%20%$@@@@%8H%8%*B@r !@$ cb8"<"P"@"D" H"L"$!hd`\X'p<'4!'<8Dh! K#C!  H!`! $(,0AA<@B$@$ $0h*@8"H4<@ #B$@$$b,%)"%)#%):$8%%)":8%:(%0#%)<@B$@"%)#%):$8%%)":8% :(%%)<4Bb$<$@1<$<$@0$$b%0*@"$#b%)"%)#C%0#%)<$@ #C%)#C%)<4Bb$<$@!<@#$b<@#$b<@%)"%)#%)*$(%%)"*(%*(%$%)<4Bb$<@$@!< #$b< #$b< %)"%)#%)*$(%%)"*(%*(%$t%)<4Bb$< $@-$#b)<$$@0$$b <0%)$0#"`%$#$ b($0B$C%#D%C(%E!<4Bb$=$ b7<@d$@D$@<$ <d$@D$@$ a<C$@$ ݈` ! (!0 $ (,$!<8'@<'/!'D@<840,($ D@@#$Bb!@x!$bDPL! !(!!$! !L$*@ $ ,@2*@!2$ !$!Ű#bs%(b@$$bjj<$ b8b(b@$$b8b$ b< $ A$ %*(%*(% *(%8!H!<C$@ $ (!0!"Y$$*$(%*(%*(%$8!<C$@ $ $$$"<) C%<@C%"B'A=$;*(%*(% *(%H!<C$@ $ (!"_<"<) C%"$@ <$@$$b<$@ $0`0!@H!#$bH`0!c0$*(%$*(%*H%$ %)<C$@$<$@$$<$@(!! (@$B0B$$$ Š"<C$@<ߎ4Bb$$ %<B8B40B@($(%B8B0B@d$b%<$%@ !!<$#@ !!,G<@<b$@$H$$*(%$*0!(%D*(%$<C$@ $$$ $f0!B@ $ <<4Bb$ #<@<b%"T!Q!eE<<4Bb$CC$@=$$9$" %$-$$7.$,"<C%"$$0bD+@$$ $$` $@$ $ #"<C%"$"$"$ $C$1B $$ )$L$BL$H(! @ ! `0!S!$&"@"< b$@$$<4Bb$L$$B&R$B &RB&RB&RB&RE&RLD@C#P84b0!,<($ 'H<'&h!'X!PD#C!$!C!D C!@ $"(*(!&($0 (!$݈ $ $(T'9D $1,"(20!00!&$1TB$@&*(!(&($1 (!$݈ $ $(T'9D $1"(20!00!$1 $  @Ď  #@0!(*(!(&c(! $2$݈ $ $(U$2X$D!S!C<$@C<<$@D < <$@HC**(!X&b(L(!'  $!'G!S!FCDEBH!PTX\`Id!CG!S!Y h ! '@ ($$2xT'9D L$$! 0!$D!S!B0B@, (!LD'xx  (!@8!"(20!0&b0!$2 $L!`&@0PďD #@8!&dC!D(!($F2<$F( $2(!( $20 $N!`&@0PďH #@8!&dC!D(!($F2<$F( $2(!( $20 $N'<' \!'X!D#C!$!C!D C!dD!T!C<$@#<<$@DC < <$@H#*C*(!X&(L(!'  $!cC!T!FCDEB@!PTX\`(d!"LhD'xx  (!@8!b(20!0&0!$ $3dD!T!BԏL0B@$!$$ cC!T!Y $ 'dD!C!B0B@, $'<'!| $!<'x!'840,($ ,!!@S!$&&!c%.b@&*@&BA!,B@ ($c.C!F$O !( !@0!$/! &s 0! !(! $/@*B@*b*B@@&*"@&q*@ !(! $0$q#Bu!*B@$$B$BB+B*B@$$B+Bz+$ "+&&&*(%&*(%* %@0! !(&! $3&&*(%&*(%* % !@0!(&'$O*"@+&(&$3( !! #%$-"&$7" 0!  !( !$38( !$34! h($/! `$"_+&&&*(%&*(%* % !@0!(&$3<$" $(&$3D!  !&9&"8+&&&*(%&*(%* % !@0!(&$3L*"@+&&&*(%&*(%* %:F0+($@8!$3T !! &+@ !(&@0!$-,! $O*b`##,b @,b@ !,! $菼 !`(!0! 8! !`  !(@0!! $-&s&#840,($ `!'@<'!'௿ $,B' <'x!'௿ (!,B' <'<!D $B !<'!D !$c !<'!D !$c !<'!'<80DE@DCDABFG (@$(& $3` $ & 0<8'@<' !'௿|  $@0!D(`&D $3&D' <'!'د$ (! # !DD0$c$B!$0!4W`@!$B.⌬,(!! ! !(!x $4 !(!x $42$ '(<'!D#X D !<'!D# D !<'d!D#l D !<'<!D#Ѭ D !<'!D# D !<'!D#Ѭ D !<'!'د (!@C!C! !<` !(!B@$ @  $$(0c$$b%`0! 8!&0 $ $  , 0'(<'!@C!C!<C!b@$ !b@!$`!<'0!h!@C!C!<CX!b@P!) @$$$ Bb$c%d&e'f(g)h*i+%JBCDEFGHI%%J`b@)` $B%J$Bb %J%Bb B`L#<'!'8!@C!C!<CH!"@%@!$;$$ b6$$4! &$  $#( b!"@%$$b $$ !$ C%!$!'<'!'Px!@C!C!<!!' $4(! C!'X 0!8!&(0 $ $#`S*B @P$ CL$ bH& * &R@2&d%@ ",b""0  @!0B%@","0b|"@*B$b*B*B@ *B$b*B$<&R&t*B@p&,b@&C#@~!$$S$^*B"@u!<@p$bnQ<"@i! @d$ bc!X ) 2d%@ ",b""0  @!0B%@","0b|$ *B`!@$ b0! 8!' $ $$!'<' ,!''@b!b!<P!bH!`!8! 0!@!%+0 $ %#`()B @%$ b!$b$ &$  %JF5$#( C1!"@$b)B@ $b $$ C%%J,@$ b0! 8!'@ $ $$!'H<' @!'TPLHD@<840x@C!C!`C! ` !<\$4C!(!dC!($C! $\(*(@ $,@2*@!2$!($!#b&t$$$b@$  %@& B$C(C%@j,k0K%@B,C0C%@&$J,PK0d%@ B$bOB(KB,C0C%@$b,c0d%@ B$b"B(  @!0B%@B$B(bB,&B0  $bb, b0$b@$$$$$$3 $d@$$)$\$\$5(!  ! 0!6!$* b@$b@ d@$$\`$"&1$ "i3b,c-d.e/f0g1h2&1"#$%&'()&1\TL##`HDb@!<P840'X<'!'د P@D!(D!C!!!@  @!@ @@  &$@$  @/@$(C%@ Q#C!B$@($ $(C%@  $$(0c$$b%`@@,0C%@ Q#C!B ,@0$Q! !B0B@$$(C%@0,C%@ $(!( $3!$ `!'(<'d!'Я,($ @D!D!! C!@ !ڬ@6!"0%$&(', $@ !L$W@)! ʸ@"!$$%( !@0!($c!$3 (!%0$,ʸ (!@0!( $4,$,($ `!'0<'!'د$ @D!D!C!C0F(G,E$ !  ! !$WL $$ $'(<'p!'Я,($ !@C!C!C!<$C!C!b0c,"0#,B@/%,&0%@ ( $4hD(5$4$(d%@ ( $4ȏD(%$5e  ( $5(D($5dD D@ "0ڬ',$( D@ 0!($2xT,($ '9wD '0L $W($ʸ C@0!*((!&((! $5%0$,ʸ C@0!*((!((! $5DP $WC,D($ $Bb!'0$b<'!'ȯ40D!$cC!b@$W` $WG!C!B$L0B@ ! $ @D!<D!G8!C!F(0E$,௣ $( , 40'8<'!| $W<'t!'@<840,($ ,!!@!$0&1"&1#!c%.b@&1*@&B!,B@ ($c.C!F$O !( !@0!$/! &s0! !(! $/@*B@*b*B@za@v2&10*@o&1p*@l !(! $0$p#B0!$B:6+*@76+&10(&1"$3( !! % !0!(&1 $/$ "6+&1$%&"#'()ʸ &1 !@0!($3<! 6+@ !2(&1@0!$-,! $O*b`#7##,b @,b@ !,! $菼 !`(!0! 8! 3!`  !2(@0!! $-&s&17#@<840,($ `!'H$(($@8!$,b(<$b$$(8! 0B@ $B($!<'!D $B !<'t!D !$c !<'L!D !$c !<' !@D!D!C !@ @  @ ($ $ $(!<'!'د @!!x!! !$ (!($# $ !'(<'!@D!D!C !@ @  @0, $,0!<'p!'د @!!x!! !$ (!0,# $ !'(<'!'د @!<!x!! !$ (!($# $ !'(<'p!'د @!!x!! !$ (!0,# $ !'(<'!@D!D!C!E!<'!@D!D!C!C!<'!@D!D!C!E!<'P!@D!D!C!C!<'!l <'!'د !Q!$eC!(E(!@$5 |  !ԏ0B@ '(<'P!'د$ P+!@!(@"&R@  ! @4!b 4  ! 4C+@  !( $6  Pq!b!DD($ $B0$ !'((!$ b<'!'د$ D!C!E$!C@ ! $P+@!4C+@"&R(@@  ! @  ! D$B0b!4b$BbP$ '(<'!'ȯ0,($ @D!C!!C!!4!b&R(@@  ! @  ! PQ!S!E$C@ ! $<b$@ !< ! $ <b$@ !8 $<b$@ <ńQ(!&b ((!  !6b$@ Q!8&f &e F0!E(!  !6D$Bb! pX !0,($ '9 '80,($ '8<'!@D!C !<4Bb($<b$`<4cC($<C$@<'0!'௿(! $6 !݈$ ' <'!D$cC0!4#4#$$'C$@X'9 <'|!݈ $<'`!8#,GD$Bb0!4#$'C$@X'9 $<'!'د DD!(!&#!D8!b@&#@鼌 E!C!BXA$h0B@&# &#!b $B'(b<'!Dd!$B(! !b!$B@Xb D@$h <'!D($B0b!b$60$B@b <'h!'د$ '' !:8!8@!$e((!$ H!$6P0!C$C CC  !  !( $6 X $h(! $ '(<'(!'د ! !P!XC!B ($h(!@  0! @ ! <4B '(<'`!`@D!C!$C,$C $ DC(@@@ @@@@<'!`@D!C8!`$b$$,X$@(!@0!@ <'!'௿$!b4# $' <'4!'د @`D!C!X$D$Q(! Q X,D$@@(!  '(<'!'Я($ d!!$Bb!@`P!C!(B$$7S (!  0!$#( $7ԏ !$ 4#p!(F$Bb!$8  (!  0!$#( $7ԏ ! 4#X !($ '9 '0<',!'Я($ $!&$#&$C!&C$B&&&& &!  !"#P! % & &$&Ft `(!$&( $8L&  (!X $"$$$B#"$($ '0<'!'د $b/!($Q$C*@(*(!((! $8p$&(20!00! $8$$ 4# '(X '9 '( '(<'!'௿`@D!C!`$$ b !X'9 `$$b $,X(!$@@@0! ' ' <'!'د `@D!C! !% !" ! 0 #"` $$b !$" '(X '9 '(<'@!'د 쏱8$C$B$#C$BE&%$BF$BC$BE$BQ$B! (! 0!@ ! t&&  '(<'!'ȯ40,($ @`D!,C!:8%,@*@$[$(@$$o#(b@$t$0 !@0!$H$b  !0@0!$H$X'9 #$B@$! !F*@$x (!8!@0!X !$'9 $%`0!(4 $6$`0!8! 4#",@a (!XDU$@#$bYW$C*@R$(!$6 @$"($& $6䏼5"D;9$C*@4$(!$6 @"(*(!&$($7(! ""$#(20!00! $70$&( $7T$$4#40,($  '840,($ '8<'!'ȯ40,($ ,!!@!$3&1"&1#!C%.B@&1*@&x!,B@ ($c/8C!F$O !( !0!$/! &R`0! !(! $/$L*@J.@S6#3&bB*@@3!Bb!$bB*@9C#( !#!$8!$R&0 $q0!8! ! `(! !!( $8䏼$0!(8!$8@&6#3&bB*@3!,S#$ !!&0$R $q !`(!0!8! @  !0(0!! $-&R&16#40,($ `!'8<'p!'د @!#x!!(! ! $$ \$X '(<'!@D!D#C!def$$$b<'ِ!'௿@D!D#C!X$D$b (!$b$b XT@$ X$D$<C(! ' <'!'د @D!D#C!"(!,B$9@ $&  ! 4#"(,B$&@ $9P  !$ 4#X ! '9@ '(<'!'ȯ0,($ !2 !@!$¢$#&&$"T!&c&&& && !&%h @0!%P !  0!$(!t &f&X$XԮ" (! $<"d0$B"d,($ '8<'֔!$bX'9 <'\!'ȯ0,($ !P2L !@!$¢$#&&$"MT!&c&&& && !&%  @0!%PP !  0!$(!t &f&M$'( $9&X (!X $܎"`0$B"`,($ '8<'!'௿$b!$b!`\C*@(C!$$9 E(!$4# ' X'9t ' ' <',!'د$ (!($!`$g9菆$:"' b9  $(,0 '@!$& $$#$BM$'$$0! $Dt &<$F+$"($F:($' $:$ '(<'Ҭ!'쯰诼@D!D#!(XC!%*@O$*@L$&(@$$ B$<"$B,B@6*@4#$P.$.!@(!$ '@ !0! '!@@ $#bP @ !(@0!$:@ $'t!$B b!  !@!(B@$X(!' @0!#$b (!XD $<#$6b d' ! $\ !&% $ !@0! '`0! ! (! ! 'xx !"h|x(!"l$"p"t$ "X'9  !#$b,B@"M$b$ !$s * !$X'9 @$#$PC!XD (! $.@$ 0!@(! '!$x'(! @ !X'9 $"(*(!&($:h (!"$#(20!00! $:$O3"DNXD (! $<P!(@$6 @(!"(*(!&($:h (!"$#(20!00! $:$ #$s bXD (! $< P!(@$6 @(!(3$: $&漎$ 4#쏰'<'!'د$ ! $ O!@$ $cM`L@ O@! &1#B &R$ '(<'(!'௿$b!X'9  X'9t  !$' <'˰!'௿@D!D#C!`$$b$`$$b !X'9  X'9t  !$' <'!'௿@D!D#C!P`N$b !$X'9  X'9t  !$' <'H!'ȯ0,($ (@!!!@o(!$5&1"&1#C%*B@c&1*@`&,B@ ($c/C!F$O !( !0!$/`! &R0! !(`! $/7*@*@3 !$`!@<&E0&B*@6P#( !$0`! $U&1 `!,& ! $k,&&1( ! $:菼 !(!, $菼 !@(!`0! 8!&E@ @!(& !$-`! &&1&E0,($ !'8<'!'<8<!ʜ4B '  !@' <8'@<'Ǥ!'XTPLHx' !!(!@ !! $ ` ! !|@(!@!  !@(!L @! ! @!)  !@!@ !`@#@@! $@ !D'@8!(!C@! @` !(B0B4$@d@0!@0c(4` !`$@p  @!XTPLH!'`<'(!'௿( 8! !! !D`!$ ' <'!'௿ !D`!F  !D $]' <'T! !D$4 <4B<' ! !D$ <4B<'!!<4CDB`!<'İ!'د !D !!$@ !`! @ !h @! !T @(! ! @! ! @ !@! ! '(<'!'௿, 8! !! !D`!$t ' <'À!'௿d 8! !! !D`!$4 ' <'!'௿, 8! !! !D`!$ ' <'¸!'௿d 8! !! !D`!$ ' <'T!'௿8!H$ 0!b! @8!DB!' <'!'௿! @!DB0B`!' <'x!'௿p! @!DB0B`!' <'!'௿@! @!DBB0B`!' <'!'௿! @!DBB0B`!' <'@!'௿! @!DB0B`!' <'!'௿Ѐ! @!DB0B`!' <'p!'௿! @!DB0B`!' <'!'௿! @!DB0B`!' <'!'د !$! $@ @! !(!$@(!!@$ @! !$  %DC0B@$0D! '(<'!'௿! @!DB0B`!' <'@!'௿! @!DB`!' <'!!<4CDBB0B`!<'!!<4CDB0B`!<'X!!<4CDB0B`!<'!!<4CDB0B`!<'!!<4CDB0B`!<'!!<4CDBB0B`!<'H!!<4CDBB0B`!<'!!<4CDB0B`!<'!'௿<4B ' <'|!<4CD!B`!<'H!<4CD!B`!<'!'௿ ! @!DB`!' <'!'௿! @!DB`!' <'T!'௿! @!DB`!' <'!'௿! @!DB`!' <'!'௿! @!DB`!' <'4!'௿!<4P !' <'!'௿!<4P !' <'!D !$B$<4DCBC#!<'H!!<4CDB|`!<' !'௿! @!DB`!' <'!'௿T! @!DB`!' <'L!<4CD!B`!<'!<4BDB@ $DB]@$DB!<'!'௿! @!DB`!' <'H!'௿t! @!DB`!' <'!'௿! @!DB`!' <'!<4CD!B$`!<'T!<4CD!Bt`!<' !'௿(! @!DB`!' <'!'௿! @!DB`!' <'`!<4CD!B`!<',!<4CD!B`!<'!'௿! @!DB`!' <'!'௿T! @!DB`!' <'8!'௿t! @!DB`!' <'!'@<8x!!'(! $ ` p(@c@(!(8!$@|' $  !' &@!<4Bbh @(!' $ <C%֮ ! '@!@<8`!'H<'!'௿ !@ ! ' <',!'@<8 !! ! !<@ (!#$ʜ'b` !  !'@@! @!<4C@<8`!'H<'x!'௿($ 8!!pb !!  ` !@$`!' <'! !D0B$$@$0! <'!D$C$bB0B@ !b@$!<'t!'د D!(B!$<`@ !  !D@$ @<8 ! $x !D@$] @<! `!'(<'!'௿D!B@ ! @!H@ ! @!`!' <'(!D(!D  $0<'!'Я( D%0̌J  e#H!C0!@ !(!  8! @!<4C(`!'0<'|!'840,($ 0ȏ! !!SL@! &(0<$$$ @ ! @! (!&9`ތ @! ! @(! @!&9``(!ތ @! ! @(!@!@@ !  0!@8!@$X'9 `(!l @!!   !  !<4B840,($ '@<'!'840,($ 픏!3X! &(0<$$$ @ ! @! (!&9ތ @! ! @(! @!&9`(!ތ @! ! @(!@!@@ !  0!@8!@ $X'9    !  !<4B840,($ '@<'!'ȯ0,($ !!!J! &(0<$$$ @ ! @! (!  @ ! @!@ !  `(!@!@@ !  0!@8!@ $X'9    !  !<4B0,($ '8<'0!'TPLHD@<840 ! !t`! @ !h CEFGHIJKLM N O X_P Q RSTUVW Y!C"Y#C$Y%C&Y'C(DC'-$-$DEFGHIJKLM N O P Q RSTUVWX_ C!C"C#C$C%C&C'C(C  '-$TPLHD@<840'X<'!$B- C$$B- B$!<'!'Я,($ 5!$!b3- ' $-$@+@!ď @$@!&- B$(!@ # !  (h$@E(!F0! '@􌏤 $B- -  !,($ '0<'\!D(!D  $0<'4!!(!$@(!@ ! <4B<'!!(!(!@ ! <4B<'!'د$  !! !! !t@@(!C$d !b`(! @! !$ '(<'$!$b$d !(C!B@ $C!$C(@$cb@$(@$$@!`!<'!D(!D  $/<'x!DB <'X!'D@<840٬D$b-HD0c-H$($T' <$@(,$0! 4PB @n!,@ !$9 $ @ @!((0$@$@ $NZ!D <$9(! $@ ((($l$@A$D $0`(! $@0!(($l0$@D `(!$0 $@ '(((($l$@$;䏙 ` !@@!(D $B;䯢(`(!$/ $@ !((($l$@$;0 $N!D@<840`!'H !!!!!!<'!'د$ ! ! !!@$$  @ !D $,@!D$BB!$ '(<'X!DDD, $<'4!'௿DL$B,B$@!DD, @!`!' <'!'௿X !(!@ !$: ' <'|!'د$ X !<@ !(!$: $!((80$l$@$Ƨ@$N <4C$ `!'(<'!'0̯ȯįT#C0#!!d$ b<,B@q6B\"!D  '@ B("!E  $@x'$ ! (!B"!PE   !$(!<:8 $@!B6"!E ($FA<($FAT( $Ad.("!E  $AB"(!$$0` ' $@!b bb!  !!/`!B#(!E  $AЎB!FE ( $AB$X!FC$ (! `!( $B0$TB!C`!̏ȏď'<'!'௿TD#c!C!(E  $B` !X'9 ' <'L!'H  ! @$į !(! ' DC<CP  !f$$ 0! A@!(($<4$B$@ $ x'( !(! $n '+@ !(` 0! $B $(P ! (! $n A$((<4$B$@ $ x !(! $n @ ! 0!(` $B $n !(!$8!(   !䨯(!$ 8!   ! '<'!'H!X  (! $'$xT ! (!cQ#C!PE   !$ (!(!$@@! @@!`bQ#b!$b'<'!'௿X'9 !' <'!'X'$n' ' $8! $' P((! 8!C $B<4G;$3($B$ ! ' D$D48! '<'!'X D !$Ƙ< (! $$̏D 0! AB4(($F<4$B$@ $ x'( !(! $n D4(P$QBBB%&#'()*+, - . +$-.,/0123456((! $n A$L(<4 0!$@ $ XD4$  0! x$D   @  @ !  @!  !􏅟 @0! !'<'X!'LHD@<8(0T0#$!0&B $@@!<G;$n(4&B$B&௢ $k!($$B '00ظT $ 04̬'  0l $"Dx00#0 (!#*@`!D$$B @$(x$B(! 0!쏐D @8<*4Bx@ !(! $ 8&BX$ $8X $B @!(!x 0!$  ` !LHD@<8'P<'!'Я($ B+@!<4BO ` $b4FTP#c(C!e  $BbB !<4B" $b ($B䏙Ӝ  !@b(B!E $C($  '0 TP#c(C!E  $C@ !(܏$  '0($ '0<'8!'Я(Я  '$('0<'!'د T#$x !(! $" !$ $ '(<'p!'Я,($ !!b@!!T !B"(!$b&1  @b&*@@PB*@!<4C,($ `!'0<'|!'ȯ0,($ !!@(!( $Ctx 0! !X'9` (!@$ (!( $C<o4B!T$B$CbE$c&sd*@b*@$ (!( $C$X'9 ` !`  !@!(` $B !$ @(!@ $ <#4BT#Q`!$ ! "C"! $  ` !(!X'9 0!!0,($ '8<'!'Я,($ x!$(!T 0!P#b$+@ (!B!C$b$! b<+@4c<4C0`!$  !$X'9 0!$0! (!(` $BC!ld @(!X'9  !$$ !,($ '0<'!'Я($ x!$0!! (!P#B$+@  0!TPBb(!$b` !$! B<+@4c<4C `!  $$ !($ '0<'!'Я($ !!<F4B!&x(!d 0!%$B@@ !T$B$CbF$c&*@D*@TP#c$C!$CbE$c&*@$d B0*@!<4C`!($ '0<'!x$ <4B<'h!'د$ x!D!0! (! !X'9` (!D$ @!!$ '(<'!'ȯ0,($ x!d0!!T (!Q#$"+@ 0!PB(!$b !d! <"+@-4c<*4C  &,C!b$ b$b(d  (!,BP !@!  (!0Џ,($ $ '80,($ `!'8<'8!'ȯ0,($ x!D!0!T (!Q#$"+@ (!b@!$bD! <"+@%4c<"4CD  !b!B,B@ !0,($  '80,($ `!'8<'!'ȯ40,((! $B@!` @ !@!@ !'  @@!D @(!'$ 8! !@' $$b!40,('8<'!'XTP(! $B`@0 ! 'HD8!@ !(! @!@<H$ !b'  '((!D'H@ 8!  @<H$P !b(!<4B !XTP'`<'~!'د$ X'9  ! !@' $ '(<'~l!'د$ X'9  ! !$@ ' @ $ '(<'}!'8įx'(!(!@ ! $"@4 !( $B@,`  !@ !D(!'8! @!@.$b+< ! ' @$<D @(!' 8!@<$b<(4D"$L$ @(!@ <X'9  @ !@@8!<4D 0!' $ $ !ď!'<'|!'Px'(!$!  !$ (!@ <X'9   !@8!<4D 0!' $ $ !!'<'{,!'P'!0! 8!$ $ $Ь$ '@ <X'9  '@ 0!<4D8!' $ $ !!'<'z!(! $<'y!(! $<'y!'(ԯЯ<!4B '  !@' ԏ'<'yd!'(ԯЯ<!4B ' @@!8,B8B`!ԏ'<'x!'௱ܯد!| 6@! '@/@!@@ ԇ>b<b =>?@A<8,B@ !mnopqlx(! $ !܏'<'w!'LHD@!8!` p(@c' '8 @!  !<4Cp @ !h @!@(!' $ <C%ڮ8!BLHD@`!'P<'v! <'v!'D@<8 !! !!h@ ! @(!' $ @(!$'C$ 'b ` ! @! !@' @!!D@<8'H<'u!'د$ x$ 0!!'b! @$@!$ `!'(<'u!D(!D@ $ ?@<0! ! 6@60!  !@ V u  !  !|xtplhd`\X'<'g!'௿ !B@@ ! B@@ ! ' ' <'gt!'د X'h  !'(<'g !D0cD!b!$$ܬfD!e<'f!'د !$  (!"$B DCD"!P0d0C D@ !  '( !" !", $ (!  '(!!!!!<'e!'LHD@<80!!!$ $'@!x !(!$ A!<#4R  ! 0!4 ( 0! !@4' A<4R,.*bdc  !@!LHD@<8'P<'d!'د$ D!@   ! DcE!$b! !@PC,`"2@$b;p0B@ !$$D;p$$b$c(b;pB;rB;tp@` !0b@ $!$$b$c bbb"@&0@&# 2"@ $b$$c$" ""  ڐ$ @@ !"& d"$EF 8!@ !$  '(<'a!D0cD!b!$d 0@$0@ $$$ $b bb$b!<'aT!'|xtplhd`D$$询X!!0`\<4ED4dSR4d<z4EBU @ !@0!$ $A@!<f4P$ !4$  'X@U' x !(! $ 0 !4 0!@F0! ! 4!@?0(B@:'@x(!$  !$@ ! @BDP(! ! $@# !pl`(! '\菙x(! !$$ 菼쏂D(!C<84B9#b\ < ! 4P(!|xtplhd`!'<'^!'د D0b$q@#bDbEb`!04d<4Eb   "D(!C$#菿 !'(!<']h!'ȯ0,($ D!( $B௢$$$* $@$<:4BB(D00!0&dEx &'䏼@@!<G=p$(4&fEx$B&௢ $!B$D !'!$$$c`@8!!C!DcC!@DC菂D@!0,($ '8<'[!'ȯ0,( !(! 0!(! 8! $E ( $菼   ! 0B$(( !$$E| $ 0,('8<'[!'௿! !@ ! @' <'Z!@ 0<'Z! <'Z!'Я($ D0!DD$܌C(! b!@!$܏X(8! !$E($  '0$@!  !A(!($  '0$9 $($  '0<'Y!'௿DX!XH<D4B$1D`!DF 0#1B  ' <'Y!'௿D!ȌBD! DC` $DP@ !B@@BDbp' <'XP!'ȯ0,($ (DD!D$&dEx1 &G@@!<G=t$쯢(4&fEx$B&௢ $ !&% !G !$$@8! !DC !C!@DC􏂀D@0,($ !'8<'W0!'د$ 4D!CD!!b ,Ad B$! $'(C@0b( (!@0!@/$Fte B!0D @!$l"$B!D D (!, !E򬏄4(!$ 1@0#00!0 '(d! @!B(!E $FB!lD $D (!, !$  '(<'UL!'PLHD@<84!#D!!!(e$F $"!0D @!,B@'"!D "2!lD0., '"$!ELBCX! !C8!0$b@'C$H$H!FbCH$bI "!U!"!!lD $$`(!, !tD $l @ !PLHD@<8'X<'S0!'HD@<840 ̏$$ 0! A(($<4$F$Fl $ x'( !(! $n $(P($bFEFJGHIcFB,-+./012(! $n A$((<4$F$Fl $ ̏ $$ 0! Ab(($<4$F$Fl $ x !(! $n d((P$bFEFKGHIJcFB,-+./0123(! $n A$((<4$F$Fl $   @  @ ! Ab(($ <4$F$Fl $ 菙$D $!$c@a$B$$$B`A$cL$Bd!d0Q %0!d0!eBr!d0Q %*@d(!  @EBr!d0Q %*@d(!(!D 0!)4("b#!E<L4Bb $G" !0D $ C @ !"(!E $G Џ4 @@!'(8!$ $ $$'8!$ $ $ld 菄4 ' 0!L'(D8! $ d@!(! 0!  G=$<($BGHBT!B0b0B@1$n䨯 ' ' ' (!$ 8!$ C&(G=$J(<4$B$$F(!  !  (!$8!D  x @:"Bt!c0BC0c`+ld &  $ @(! @ @ ! @0!((0$GX$G $N (!D 0! 86!$@W!40b"!D @!$ bP$b"!DB!B0b0B@3$$'$4$ '( @ &G=$($BG(c@&#!(E $GȎb "!G$LBH$ !$0@F'b$$B܍F(!"!C *h%C(!ȔyE(E$Gbu$b"!DB!B(0b0B@$$'$4$ '( @&G=v$(c@B#!D$䨯 '' ' $ 8! c@-#!(E $Hb "X!g܏LBH$ !$0@F'b$$B$F(!"!C *h%C(!dlE $ d,{$(E$H,(E$HL  @ ! y@ !bzb"!DB!B0b0B@l$$'$4$ '( @&G=$ͯ($BHh(<4$H (! HD@<840'P(c@1#!(E $Hb "X!g$LBH$ !$0@F'b$$B܍F(!"!C *h%C(!dlE $ d$, !(E$H  @ ! @ ! &R&1B+@G=$($BH菆(<4$F (!<'E<!'D@<8 0$(40!ď400!$$C0&DF $ @@!$(($B&<4&FF$Fl $ Y!"4x00!00!0 (!" @$$B@$(8& (! &0! (! (̀t $I &=&DF䏙$2$8!  ='(X$ $8 (! 0! $  t !D@<8'H<'C!'H  ! @$į !(! ' C=C  !f$$ 0! A@!(($Q<4$F$Fl $ x'( !(! $n '+@ !(` 0! $I $(P ! (! $n A$[((<4$F$Fl $ x !(! $n @ ! 0!(` $F쏼 $n !(!$8!(   !䨯(!$ 8!   ! '<'@!'ȯ0,($ 4D!b!!!(E $Ib'! ! @#Q!0 ,B !@' Q!dq!d!e@0$BH(@0! $F 3cQ!!d0 @!$b,b@,b$b8@64􏄟4E (!Q!b!!lD $d$, !  !Q!cQ!!b A d, b$!C0,($ '8<'>T!'௿4D!cD!!C!(E $I4 !菰 ' <'=!'Я,($ $B+@!<4B $t@ `$bTj4P!cP!#!(e $IPb"!0D<4B B cT#!(EV$Ix#!b:@(eL$I  !@b("!E>$ID@ 4P!cP!(C!E $J !,($  '04P!cP!(C!E $J0 !, ($  '04P!cP!C!(E$JT,($  '0,($ '0<';P!'Я(,  '$('0<';!'د 4!"!x !(! $"$!$  '(<':!'Я,($ $!!b@!!4B" !$b &1 !@@(! @b&*@@P$B*@!<4C,($ `!'0<'9!'Я,($ !$!0! (! !X'9QL (!@l$ (!( $Jt<4B$!4$B$CbE$c&RD*@B*@l$ ( $J<|4B`rX4'9P @ !@ ! !dr! !(!$ @0!@@!l$ <6"6" !( $J܏I6"( $KA!p2!0! c#!0d @!b"!lD $d(!, !d$(X !$ $*b"!@9d ! $* @ !lD !,($ '0<'6,!'D@<840,($!Ԏd! $(! 0!B+@ 4!#R!!c$b ld B+@'<4Bld @ !$X'9P 0!d(! 0!"!0D ,B@ (!ld <q4B"D!D' 0! 8! #@!(E $KTdl <T4B͐p ! $:t @ !$͐ ! $:'$@ !(!0! 8!$@ $͐ ! $:< @ !!$! ! $*8 @ !"!,D X'9P @ !"dl!$ !D@<840,('H<'2!t (!<'2!X(!'9P 0!<'2!X$'9P 0!<'2!'Я($ !Ԏ$0!!$ (!P!P!Bl+@  0!4PBb(!$b` !$! B<+@4c<4C `! $l !($ '0<'1d!'<840,($ $!Ԏ!0! (!"+@ 4!cQ!C!c$b !l "+@<74B<44BX'9QL '@"!l b0!(B!E $K<4B!b!!XD(! $ b!l@ !<840,($ '@<'/!'د$ !D!0! (! !X'9QL (!Dl @!!$ '(<'/!'ȯ0,($ $!!0! (!B@!!4 !E$%(!&1b$: @B&*@`p$B*@!<4Ql  !0,($ '8<'-!'`\XTPLHD@ $!Ԏ!!<(! 0! "+@ 4q!CQ!C!D$ l "+@<4B0 ,B @ l <4B͐  ! P$'( !$P $ A '8l <n4B|$#䯢(!'( 8! @@!l [!͐  ! 4 @ ! q!DQ!͐ ! $: t @ ! D͐ ! $: '<@ !(!0! 8!< @ D͐ ! $: < @ ! q!D!X !$:(! $PB !@B(!$K &: l !`\XTPLHD@'h<'*! 0!<'*p!'ȯ0,($ $!ԎD!0! (!"+@ 4Q!cQ!!d$ lD "+@<'4B0 ,B@ lD <4Bb!Dظ!D $Dl !0,($ '8<'(!'ȯ40,($ $!Ԏd!0! (!"+@ !4Q!Q!!d$ ld "+@<#4B0 ,B@ ld <4B!@`&B,B@<r4Vld !40,($ '8<''t!'ȯ0,($ !ԎD!0!$4 (!P!P!bl+@ (!0"!C$b` !D! b<+@4c<4C`! ,BDl@ < 4B"!B !0,($ '8<'& !'ȯ0,($ !Ԏd!0!$4 (!Q!Q!l"+@  (!B!C$D*$bd! <"+@84c<54C 8 @ !D(!X !$ $*B!@9D ! $* @ !dl  !0X,($ $0!'9P '80,($ `!'8<'$P!'ȯ0,($ !ԎD!0!$4 (!P!P!bl+@ (!0"!C$b` !D! b<+@4c<4C`! ,Bl@D < 4B"!U!D !0,($ '8<'"!'ȯ0,($ !ԎD!0!$4 (!P!P!bl+@ (!0"!C$b` !D! b<+@4c<4C`! ,Bl@D < 4B"!U"D !0,($ '8<'!!'ȯ0,($ !Ԏd!0!$4 (!Q!Q!l"+@ (!B0!C$b` !d! <"+@4c<4C&`! ,B !l@ !d <4BB`!! U$C!d @(!dl !0,($ '8<' !'Я($ !Ԏ$0!!$ (!P!P!Bl+@  0!4Bb(!$b$! B<+@4c<4C`!$ !($ '0<' !'@<840,($!Ԏ! (! 0!B+@ 4R!cR!#!c$b !l B+@<[4B<X4Bx(! $b(!"!DD0! ' b"!EP &(eP&H(! $:e&P(! $*c#!b d$00B b B0Bb!b"b (Bb 0Bd c #!fcl0  $!@<840,('H<'!'쯰诼D!!(!''  !@H(D$BL0B@=(9$BL 0B@ ! '܏@+('$BL<@(! 0!&@! ܏@ !d '@( $BLh '(@ !<($BL<4CDB쏰`!'<' !$(!4$B$CbG$c$*@*@!<4C`!<'!$$+@4D!cD!C!$C$bG$c$+@+@!<4C`!<'!'د$ !Ԏ$!0! (!P!4P!d͐ ! $:$l B$ !'(<'0!'ȯ40,(!"h$ @ !0 $D@h$ @(!"<C%"@x'(! $ !(8!$MX' $ @ !' &@!<4Bb @ !@!40,(`!'8<'! <'!' دԯЯ̯ȯx'!!! !(! $@<A4B ( ! @ !@ ` !0| $H/@! @ !@ !h @!` !| @(! ! @!x(! $` ! (!@ @!@ !@ ! ' !؏ԏЏ̏'<'8!' دԯЯ̯ȯx'!!! !$ (!<4Bh ! !`  (!@! @ !@(! @ ! !@'@ ؏ԏЏ̏'<'`!'(ԯЯ̯ȯ'!!x !(! $ ! (!@BԏЏ̏!'<'!' دԯЯ̯ȯx'!!!` !(! $ <4B@ $#b  !@! ! `(!@ @!,B@$ "`!؏ԏЏ̏'<'!'(ԯЯ̯ȯ<!4B!!x'(! !`$ @!@!  !@ !  (!@@!0`!ԏЏ̏'<'!' x' !! !(!! $!` ! ! (!  !h@G ! ` !@(! $:@! ''@!x !(!@0$ (!$x  !͐ 'h$@ ! 0!(!C8! $(` !C$M`֏  !@(! @!@! '<'H!' دԯЯ̯ȯx'!!!@ !$ (!<4B< ! !`@(!@!  @!  !@@!4`!؏ԏЏ̏'<'x!' دԯЯ̯ȯx'!!!@ !$ (!<4B ! !`@(!@!  @!  !@@!<`!؏ԏЏ̏'<'!' دԯЯ̯ȯx'!!!@ !$ (!<4B ! !`@(!@!  @!  !@@!,`!؏ԏЏ̏'<'!'D@<8<!4B!"! !  !h 0!@ '! @ !d  (!$ @! !' @!D@<8'H<'!'@<8!$$"$B*@ $ '@!$@<8'H<' t!(!$=DD <4B<' 4!DB<' !'@<840,( 0! ! !P@! #@ !(0<$$ $  @! (!&?$ތ @!  ! @(!  @! &?$`(!ތ @!  ! @(! @!@ !@ 0! @8!$C=`(!Df D$  @!<4C`!!!   !   ! <4B@<840,('H<' !'840,((٬$b=Bc=D$ <&dMh$0! 4P"@z!,@ !$? $@ <  !(-$Mt$$?x(! $@@! @ !0((($cN$M$G$4@ ' @@! @ !($M̏(0@0!$G $N$$='  $(0@@! @ !&#N(0$M&EG$ @8!!(($N$&EG &'N&EG&fMh(&'N $N4!840,(`!'@<'!'௿ !(!@ !$? ' <'<!'Я,($  !! !hD (!@+ !! CEFGHIJKLM N O P Q RD&b\Cd\EFGHIJKLM N O P Q RD$BP &e\,($ !'0<'!'HD@X!DDD$ @!D$l$\$pC''(''8! '<D@#$\$&$Pb \b b("P,08< &&P @&&PHD@'P<'!'\XTPLHx!!'0(! $ $0B04@!$x' (! $@cQ0$ $Dh !@$`! @(!' X $@($ $Nl !@$`! @ !h @! @ !0($ $Nt@$ @ !h @! @ !4  !"<C%"R @!(8!$O'  $'  &$C804'@ ' @@!Dx(!&0P ! $(0' "P@DX4$\$8 $@!\XTPLH'`<'!DDl <'!'د D式D $\&P0!DP@ !$p (!@!Dʈ $t ! '(<'!'Я($ D$&0P! @!DD$l@$\$&PDDD$%P$l $\$P @!($ `!'0<'!'د DʈDl ' '(<'!'௿ !D$\ !' <'!DBp!<'X!'840,(D! !!! @ !$1bP @ !h @! @ !bP  !cP'$x !(!b$ dP(!0! 8!@! !@(! @!840,('@<'!'840,(D!$RP !"! D@ !$3B &P@ !h @! @ !  !C'$x !(!b$ D(!0! 8!@ @! !@(! `!840,('@<'!'௿ !D$8 !' <'p!"$D0@$ D(E$ D$bD e$ D$CE` DC`$b $ b$ b$ b!<'|!D$BC$BB!<'<!D$BC $BB !<'!D$BC$BB!<'!D$BC$BB!<'|!D$BC$BB!<'<!D$BC$BB!<'!D$BC$$BB$!<'!'د D꼌DH ' '(<'t!'د DD$8 $Q@ !"8(! 0! 8!@@!D$8 $L! '(<'!'௿`! b+@( $O(`b+@ ($O\(0$O $N<-4Bp @!C+@ @C+@ @C+@!d+@ ! CC!$b!' <'!'쯰诼D\!'9 &@]@!D$M$&ꀎ8 @ @!DD<0!$H $8@!!@ ! '''@!x(!$@' !   !@ !(!P' 8!(!0! 8! !$D\ $8(!|@@ ! <4Bb&R !  !DD&<$H $8@! !쏰'<'!DꀌDH <'|!'x|xtplh!!0B@!$x'8` !(! $('(!x$ '(@ !(!x $  00 $D@ h @(!'X$( $N@h @ !@(!X$  U( $N@tG'<( $N@t;'D( $N@t/'H( $N@t#'L( $N@t'P( $N̏@t 'T( $N؏@ '\Ѥ <C%1{@!(8!$O' $' &$C(@!$cAC!'( &1@*#8`\'9 ` !@/@!'`'`0! 8!@&@!Dx$@&P(!  !<``0!8'X $ &DX$8' $&B !|xtplh'<' !'Я,($  !! !hD (!@+ !! CEFGHIJKLM N O P Q RD&b8Cd8EFGHIJKLM N O P Q RD$B &e8,($ !'0<'!'`\X$C0!'('P'0! 'T@30!D$D$8b %'8'Hb b $ $%$PDCH$DDD`$H$8& 'T@&""`\X'h<'!'௿ !(!@ !$@x ' <'D!'840,((夯$$SO <! 4P@ !$, $B(@  !@0!((0$O$O $Nd <@ !@(!$A $@@! @ !`0!0(($cN$O$OC @ !' $@x $@@! @ !0((($cN$P$O$N" @ !' $? $@!!  !0((($cN$P$O$M @8!!840,('@<'!4D!cD!C!D$$$$$`!<'|!'XTP x!! !(! $d $` 0!'(&(  $ $(,b@@!($cEC!B\!@$$$$$%$$$'& ( (! $P, &00!8! $ $XTP'`<'!'쯰诼84$!D!!C !$$ $b($P($'0@ ,8< !4a '(8A@! D$8 X 8(C!e$Pt$ !4$ '܏8A@! 8DX 3!8s!d!(e$P3!S! ! $*8'` 0!L8!(! @ !8'͐ ! $:8@ !(! '8 !(!\'9T 0!8B!B4@ܯ $d<B4d8! ! $8A@! 8DX 8#(C!eJ$P̎&(F0!$P $:8$͐ ! $:8&@ !0!$(! 8!8#@ C!(E $Q$8+F(E $Q@8%H !(!$ $ 8A#@! 8DX 8#(C!e$Q| @0!8  ` !8 ` !*4!S!#!d$$$2Pe$X$'` \pt"!xB 8<8B0B !4a'X|b!@E< !4a' 8@!! 8DX !8s!d!(e$Pt @0!tS!#!\b l'@0BDb 4B0B@b!Hb"LbPd T8"X!g$LBH$ !$0@F'b$$B܍F(!"!C *h%C(!0d E@!B8"!lD $8D(!, !8 $B8"!C$$br'( $8''('ď ''د('̯0$,@ !$Q 0!$ 8C(0!(!'@!$,b$x'$ ! (!!8S!C!PE 'Џ8(!ėԏP$$ 84!B!! D$ 0!8'$x ! (!B8!P '8'0!( $08 (!P $8쏰'<'!'Я($ 4D!CD!#!!(e$Q< 4PB$"!C$$$bK8! @(!B$0CH!0$ P!Lb@0! DX C@0!(#!e $Q&8!g"C *H%#!"e0!d@! f@!B"!lD $D(!, !Ȕ ` !8!($ !'0<'!'쯰诼4D!#D!!0d'x ',B@M!$ ! $*8!' L(! @ !$͐ ! $:@ ! @(!@(!' \'9T `0!"<B!ԌD$d4d`8! $A DX '@0!8!$:($R  $*<4B!쏰'!<'0!'x|xtpDD!!@ !(!<'h8! 4Rh0b@HD ' @ <` !(!' 8!0B@<D'H  (!@<\@ < 8!` !(!0! @!<4BB3P( $FtLl $(!1@0#򬏄00! 0( $F` !T (!Ll $Leȏl |xtp'<'<!'د !(!P $R| !T (!Ll $%ȎLl <@b$`$ D '( '(<'h!'<840,($  ̏p$$ 0! A(($'<4$R$Rp $ x'( !(! $n (P$bREFM GHIJKLB cR,4$-+./01235((! $n A$-((<4$R$Rp $   @D  @ ! A@!(($7<4$R$Rp $ $D &Ù$$B`A$cD$'š$c@a$B&әDBs!d0$Q %d(!  @Bs!d2BQ %E*d@@!!(! 0!(P $G L0 $ C\T'9 (!(P $G Џ @@!&ƙ'(8!$ $ $'ƚ'8!$ $ $$ 菄 ' 0!D'(D8! $ @!(! 0! BU!B0b0B@1$n䨯''' (!$ 8!$ C&(GBP$j(<4$B$$R(!t  !  (!$p8!D  @0BU!B2Cb0B@($ & D @ ! @(! @ @ ! @(!( $R (!D 0! J<(GBP$(4$BH询$R (!9<'!'@<840x!!(!$!'  !Q$hPCQ R  D ` !@e@!04 $`@@!<&4B @ !@@!($R菙  !@@!( $S",`<@$C% ", !3@!(􏇐0!$S< (!(̀ $SD&B0$2($$R8! B0' \$ $ưh(! 0!$ !@<840`!'H<'X!'H  ! @$į !(! ' CB0Ct  !f$$ 0! A@!(($<4$R$Rp $ x'( !(! $n '+@ !(` 0! $ST $(P ! (! $n A$ ((<4$F$Rp $ x !(! $n @ ! 0!(` $R $n !(!$8!(   !䨯(!$ 8!   ! '<'!'د !(!P $SdL0 @!,F$b (!,b$b @ \ !(! '9 '( '(<'!'lhd`\X!(!P $SDH` @ !D(!'P8! @!@(EPFH$SH` ! '(P0b@ (,B @!$ 0B@Q $ (EPFH$S LDL ' +@ 4 e!c$B`Q + q*P0@ (,B @4b!$40B,Bd!$Bb SDC 4b!$bDL '  !@(!\'9(EP $T 4C!@\ !@(!'9 lhd`\X!'p<'p!'ȯ0,($ !X<6 4@g@!Ў$B+@`@D!C0&D#$b!7 $-C(P $IPL0 S6(P4$T(H`"(P+$TX @ ! (!@(P$T& A 4(P $J@ !(!0,($  '8(P$JT0,($  '80,($ '8<'\!'ȯ0௤ $ '(0'8<'!'د$ x!!(! !  $X$ $$DL!p!C2$c(b@p!  x !B(!0@0! 0T$ '(<'D!'ȯ0,($ !!b!@!!0Q !L$b &1XP !@@(! @b&*@@PB*@!<4C0,($ `!'8<'D!'௿(!D 0!' Db$Bb<'!D$d$B <'!'د$ !!!( $T@(!($T \'9Œ 0!@  (!( $Jt<h4B 0!B0$$CLbE$cX$*@*@ ( $U<I4B@F!C0F#Tb!@ ! (! (!&L$@ <@!6B"6B" ( $UD#6B( $U !L L$l P ! $P( $U!$ '(<'P!'Я,($ !!!@ ( $T<H4B\$SÌ`! X  !@+@!\'9 <" <04 $`@@!<%4BB,< C%,  !@@!( $U`! ɼ !(! @0!\'9 @! !,($ '0<'ä!'<840,(\$8! '9t! !@@!\'9Ì X  !@ @!\'9 <j4CbB+@ @R!#0R#C!L$\'9 bB+@<4B4BJ@!0 ,B@ ' \'9 <94CLD(!0! 8! @\'9 P( $U菼<4CDlL ,L  !T (!\'9 !<840,(`!'@<'(!\0!'9t 8!<'!\$'9t 8!<'!'د \!'9Ì !X  !@!\ $Y <4B!$ C` !0`(!$$CLbF$cX$*@<4B '(<'!'د$ \!!'9Ì !X  !@!\ $Y <!4B!Q &1D$+@@Q!0Q#C!$CL$bE$cX&1$+@<4B$ '(<'!'د$ !!!<@4B\$'9Ì X @ !@ @!\'9 <B+@ @P!c0P#C !L$b\'9 B+@< 4B< 4B\(B'9 "!$ '(<'!'Я($ \!'9Ì! !X  !@ @ !\'9 <-4B@Q!Q#B"+@0Pb(!L$b` !\'9 B<"+@4c<4C `!P \'9 !($ '0<',!'ȯ0,($ \!!'9Ì !X  !@ @ !\'9 <b"+@ @Q!0Q#C!L$b@(!\'9 b"+@</4B<,4B\'9Œ '@"\'9 P 0!(@8! $K<4BXP@(! $P\'9 @!0,($ '8<'\!'Я($ \!!'9Ì !X\  !@ !&y (!@@0! < 4B\'9Œ &y @!!($ '0<'!'ȯ0,($ !!!<@<H4B\'9Ì X  !@ @!\'9 <14B@!!B0Q !L$b &1XH` !@@(! @&*@B*@!<4Q\'9  !0,($ '8<'!'D@<840!!!\'9Ì X  !@"@!bB+@ @R!c0R#C!L$ \'9 bB+@ <A \'9 <y4B0 ,B@ \'9 <h4B@ DYlL DQH`  !@!' D !(!'$ 8!@ D"< @$$b !'( 0!@ ($b(P$V4 0!\'9 <4BD$lL $L  !  !DH\'9 !D@<840'H<'!'Я($ \!!'9Ì !X  !@"@!B"+@ @Q!c0Q#C!L$ \'9 B"+@ <A \'9 <#4B0 ,B@ \'9 <4BLظ` $\'9 !($ '0<' !'د$ !!!<E4B\'9Ì X  !@ @!\'9 <"+@ @P!c0P#C !L$b\'9 "+@<4B<4BPH @ !\'9 !$ '(<'!'Я($ \!'9Ì! !X  !@ @ !\'9 <-4B@Q!Q#B"+@ 0b!CL@ !$b`(!\'9 B<"+@4c<4C `! \'9 !($ '0<'`!'د$ \!!'9Ì !X  !@@!\#'9䏐"+@ @Q!c0Q#C !L$b\'9 "+@ <4B\A$y <4B !$ '(<',!'Я,($ !!!!</4B$b$p$!\'9Ì X ` !@ @ !\'9 <4Bڰ@0! (!@<4T0\'9 !,($ '0<'!$ <4B<'!'Я($ <!4B!!3!\'9Ì X  !@ !@(!ڰ@ 0!\'9 <4B @@8!<4S \'9 `!($ '0<'!'Я($ <!4B!!*!\'9Ì X  !@ ! (!ڰ@ 0!\'9 <4B @@!<4Rb\'9 b@!($ '0<'!'840x! !!(!$ ($L(!D0! '("P&P@@(! "HP&)@@(! $<4B(b$'d%$<4Bb$<@ $d%" $L ' $$L0 ($0c840!'@<'X!'Я($ \!'9Ì! !X  !@ @ !\'9 <04B@Q!Q#B"+@ 0b!CL@(!$b`0!\'9 B<"+@4c<4C`!\'9$ \'9 !($ '0<'!'Я($ \!'9Ì! !X  !@ @ !\'9 </4B@Q!Q#B"+@ 0b!CL@(!$b`0!\'9 B<"+@4p<4P\'9$ \'9 @!!($ '0<'!'Я($ !0!b@!!B0Q !L$b &1X4@(!D @0!b&+@($ !'0<'!'د \D'9Ì !\@$$y ( $V|<4C $y X  !<@ !@4c @! `!'(<'!'Я,($ d !@!W\D$TÌ! B\@$s$y ( $V<>4B $`! BX  !@@!<4B-@B,<@C$@ (@ $Vď<4B  !@ @!(@ $V䏼!! @  !`! @!,($ '0<'$!'د$ !(!@$V <.4E\'9Ì 4  !\'9 @!<4E,<@b$ !`(! @@!( $UЏ (!(!B$ !'(<'!'Я($ \'9Ì !X  !@ @!\'9 < 4Bb@!!B0&10P!CL$&Xb` ! b"+@\'9 !($ '0<'!'د <!4B!\$'9Ì X  !\@$y < 4BB,0B ! '(<'$!'د <$4cB6b+<!4B` !\'9Ì  !X\ &@ !@ (!`! <4B & ! '(<'P!'د$ \!'9Ì !X\  !@!@ !&"@! <4B  ! B&9 B!$ '(<'!'ȯ0,($ D!c` !<GBT$(4$BW0@<GBT$(4$BWH((! $R!`!Dc&1@ !C!P& @!b"+@!0,($ '8<'@!'840,($ (<!D$R(!`6GBT$@($BWX =6ďD< @!@0!&$(@6$&R(!GBT$G($BWx "6"! &R<@!4&R !x@$`!GBT$O($B&  !@0! (!!840,($ '@<'!'د DB@0!(GBT$s(<4$BW0$R (!%!@"8!@H!D< < E$@+`$bD`! b,J$@ `0!!!`!! '(<'!'௿X @!$C`!' <'H!'Я($ (! !<$R(!@!BX@6$`!GBT$ï($BW 6" (!(@$W <4B( $Wԏ<4B($ '0<'X!'Я($ (<$R!@ 6(!GBT$($BW ($R6GBT$($BX 6\'9P @!<`4Db !"($ !'0<'T!'د$ !(GBT$(<4$BX $R(!ze0 @<(GBT$&(4$BX<$R (!80 @<(GBT$-(4$BX<$R (!48 @<(GBT$4(4$BX<$R (!D4B@0!@8!DC` !b$(+@$cBH$  !@<(GBT$(4$BX<$R$ $ '(<'!'<840,( D@ !<GBT$(4$BW0@<GBT$(4$BWH((! $R\'9P @<(GBT$¯($BXT4$R (!~ !DCb@$c&1$+@DE%+@( $X|`D(ĎG&R8!$ $܏ @(!( $XMBx!P$  ! &X`(! $ ! <#,<@C$@{ !Џ$C&R"0@0!00#0$ &'0 @$F&R0 &'4 @ @$&R0@0!0$ &'8 @(`(! $X @  ! C !x$80@0!0 (!  8Bx$00@0!00#0 (!B @!0! $@!$0#4%8C! !LD@ @#@C!! B$T*@%X$$ "<#Ȯ#@#D# !<840,(!'@<'!'௿X @@0!<4DDC``<4GD` !E$`$b,G$b,,< !C%,!' <'!'د$ DB@<(GBT$ǯ(6$BW0$R (!'6(GBT$ͯ(6$BY0$R (!6B!@ 0!@8!DCb$(+@$c<4P!$ '(<'!'د$ D@!"@8!(GBT$(<$R$BW06 (!,6<(GBT$($R$BY0 66@0!DE@ C!d$"$+@$<4B$ '(<'!'Я($ D"@ !(GBT$%(<$R$BW06 (!6@!DߔcC!B@&D @ !"+@!!($ '0<'!<'x!'௿ !@!!`!' <'(!'௿!(!0B@$  $(!\@ !'9X ' !' <'!'௿! ! @(!P@ ! !' <',!'௿<$D(!4BpDD @!(((0$Y$Z,$Z<@$N !' <'!'@<8!7!6< !@h  !\'9@ @! !\'9X @(!"@!<% <\'98 '@< 4C ! '@!<4C@<8`!'H<'l!'د !$$`!b`(!\'9@ "@ ! @!d @$! `!'(<'!'ȯ40,(!J!<K4Bh @!<C% (@\'9@  @!"@ (!x'(! $ !(` 0!$ZX ''(! &1@ !' ! @<4BP!40,('8<'<!ߔ <4B<' !'د 8'! @$ `!'(<'!'<8!<\(!'98 '@<h  !@(! '@!<4C<4C\(!'98 '@<4C ! '@!<8`!'@<'!'ȯ40<!4B !'@!  @! @@!(`!40'8<'!'௿<$C(!4BpDD @!(((0$Y$Z,$Zd@$N !' <'!'HD@<8!!L!K< !@%h  !\'9@ @!` !\'9 @(!@!@ !$B@!!\$  !$' '98 @-@8!!$B"D0@P!$  (!' 0!LP@H$0@H!$ LK $b$$H$*@$X%JG*%@$  !#@C#@C!"!$BH,($ '0<'s!'Я($ !L! 'P'$L ($ !'0!<'sl!'`x'$!` !(!$H '`&%X ! $'$$0! p@!0!@ !@4 @  ! H<Q4BbB!'<'rh!'TPLH!0!$! $@!&X'@$ @R!R!$ <'88 !4' (  !TPLH'X<'q!'`\XTP ' !!@<$H $@X` !@(!$DH L$'@`0!4 0'@0!( !A$[P L`!  #4C!@ 'C!@L$ $ `\XTP'h<'pD!'tplhd`x'8!(!` ! $ $'(̯8<$$ 0!A "̏<GEP$䯢,>$BX&2 !@(! $'H$x ! (!$'*P@(! H$P (!@(!P$ $4A `0!$$8`0! 4AA'P<GEP$($B[(6$R ${6x !(! $$&$ȏ @(!$ȏظ $R$ȏl $$ȏ̬ (!& <OB(` ! $[Џ4BC(ɼ0! ! &%$@@!(GEP$(<4$B[د$R $6!\ !$0!8!'98 A DX @!@(!(@8! $[쏼<4B#$$0@C!C# !< b%<@b%($BȬH!tplhd`'x<'l!'D@<8l!$ '0C$P0@C!C#!lL $LEȏ$ L  (!C4$0bLb  (!Lظ $C&D$  0!@@ !B,< !C%B,D@<8!'H<'kH!'tplhd`\X!H!! !@!$@DH@L(%P$\48&,@  !x(!0! 8!X&' (! $'@04 ' A DX @!&P((!$\t $@4'  x<@"C%"<#4Bb$#$"$B&3$`@'Xx !(! $ !$\0!$'98 @U !!R$$c(b@<e4B%c$b!'Px$ ! (!%HP '2$PP(! $@ (&P$\ (!<?4B"<@C$@" !\&$$$'98 A DX @!&P($\ (!<4Bl$L $"<@C$@D $$$L !tplhd`\X'x<'g`!'د x(!0! 8! '(<'g!'tplhd`\Xx'H!(! ! $ C$P0@C!C#$'8&S0!` !$HL !L'0  (!$0 C4C!@ C!@L  (!LEȏl Ll $L $<4Bb$4DE$ @@!(GEP$(<4$B]D$R (!<!,D  !`(!X $D̯H0! 4AA<(GEP$(4$B[$R (!D A!(GEP$(<4$B]d$R (!!tplhd`\X'x<'d@!'쯴诳䯲௱ܯد ! ! ! @!$  !    @ ! bEl؏D ( $􏂀D򬏄 $Eď &û$$B`A$cD&Ȼ̌eG$ Bh!d0I %*0!@d0!TFBh!d0I %*8!@d8!DGBh!d0I %*@d(! EBElBh!d0BI %dDEld*@!؏ԮCD(! 0!D$b Ŕ (!򬏄 $ ϠB(@( $^ Џ @@!؏l '( &ƻ`8!$ $ $菄 ' D'($0!8!  @!(! 0!  DBS!B0b0B@p$ D䨯''ȯ&$  8!@! &1@$((($B^8<4$^P$^\ (! L$ b&$((($B^l<4$^P$^\ (! &į̏''' 0!@!,B @($c]C!B\!@|  !  !$ׯ((($B^<4$^P$^\ (! @ SBs!c0BC0c` &1  ABs!c0BC0c` &1 . -ElBs!c0BC0c`! El @(! @@ !ϠB(@  @(!( $^ď &1 $H((($BH<4$^P$^\ (!쏴菳䏲܏'<']!Ϡ$}$C$ C $C$C$DC @(@D@$<'\!'LHD@<840x' 00 !(!0$bf 0  !@! !@(!`a`0!ؼ @! !p`S(!( @!`K &^8 $@!&^(!0!`;8! @!&^$d$`08!$b @!8!\$`"$'$ @!` @!(!`0!   $   !LHD@<840'P<'Zh!'௿<Ϡ 4B <<d+`4B !' <'Z!<Ϡ4C<+@4c !`!<'Y!<4BϠD!<'Y!'௿<4C,Ü@Ϡ D!`!' <'YD!'௿$<,B@4cϠ D!`!' <'X!<4BϠD!<'X!<4BϠD !<'X!'ȯ40,(Ϡd! DC(.0$ `& ($E_($E_ ( $_T0!D$(! ' @B(@ ($E_($E_ ( $_P40,(!'8<'Wl!'Я( `"$b$$\Ϡ"@-b$B b"(@"(($_| '0D$bd( '0( '0((($B_<4$^P$^\ (! ('0<'Vd!'hx'!$p !! (!# 0!TDD $@Ϡ(B($_@ (! <4B`!Ϡ(B($`@ (! <4BC'<'U\!'0̯ȯįx!(!' $p @Ϡ(B(@$`T B(B0B@ B $b$d,$R(TD'$ $΄@'x !(! $4$D0! $@$0B@ $@$̏ȏď'$0$1h,2348<@DHLPTX\`d<'Sh!Ϡt@b#b!<b4BMbPLB<$B H$1H8<<'R!'௿ !Ϡ@d#d!<b4MdBC` X`d h' hX\`d<'R!'௿8 !8  ! !\'99 ' <'Q!'د (0B@!0B@, @ϠB@"@#DC$p2 !`$bj"D  !#Dp$< ! 6 ! 6"T@\'98  !\ ! '98h '(b,@< 6 !@ 6"T@  !\'98  !|  !"@ !p "D#D$b\  !  !| !y !@  !҈  !"@P"D< ! 6 ! 6\'98h  !  ! |  !  ! ! p '("D@@|  !#D$b$@< ! 6 !@ 6"T@  !\'98  ! b @  !҈  !p ! D !  '( '(<'MT!'د$ 0 D #D !!  &%X@@8!&H*@0!%XF#F!$E!0f *$CtCpDF#cXF!C!D@pr\$ !'(<'Ll!DCT` !e *@`!!cp<'L!'840,( ΄! @?@!"| !&%$  $ ,  ! $,@(  ! @ϠB(@(!($`(  ! @ϠB(@(!($` L !840,( '@DpXv$DCT$RT`e $*@$}((($B`<4$^P$` $ W$$rpcpϠB(@&%⏄( $` p !bXB&%$ p P"  ! "|\$"'98 ( l.$ C*@,  ! @ϠB(@((! $` L  ! D 8Y\40,((! '@((($Ba <4$^P$` $ 840,('@<'H!'Я,($ DQT  $0@#(0B@0B@ ,  !@"1@*"<@T$B@R"!'௿(<4g0B0c@0`TE$DbT\'98  8!!' <'>!'د DPT"(0B@0c`$Db1Ϡ@("($c0@0!% "Lp '(<'=@!'د DPT"(0B@0c`$Db1Ϡ@("($c`@0!% "Pp '(<'(3012$f`1<4B\ϠB(@*(3012$f  !$B  " @<<4B3ϠB(@ 3(012$g ($$Bz$<$<CϠB(@ (3012 $g\($$B_$#0c$b,B@CLϠBBL0@r$B1@/L@ ! &E4(@&C40C+@ ϠB(@@(!( $g(( @ !(@1p @ !(bX$BbXB1@>$0B4b+@$C4b @ !A!0c04B$cbCPBP@ϠBBPCLBPϠb (Bb!((!$g @0!(@P#P!<b4cMCBB8$b<C$@L@ ! 0!(@ & 8!@(! @ !(C0$b0(b@$$bzbLvc<ffD4Bfg`CC#b!#$``ϠB(@:e(2301(+$h,$2N$b<ffD4BfgdCC#b!#$`}dϠB(@w3(012$ht ich"@d<ffD4BfghCC#b!#$`UhϠB(@O:b32(01+$2(#$h =ϠB(@8@(!( $i 0\'9T  !(@ ϠB(@@(!($iL #4$b,$B,0$B0$<ϠB(@Y67(45$i (!I%<$b4b$ϠB(@>(7456$i0CϠB(@*(7456$jT4#  C (CϠB(@7(456$j (b@$Bb@%$<$C<Ϡb$@ <b(@45674B<4BgϠB(@)%&'4567ٯD @ !(@s@!B2@!4 & !80+ $(@!&@ !80+(! $(@ !`(!ׯ\'9T  !(@ ϠB(@@(!($k܎ c<8$cc$mԯu  C (CϠB(@h(?<=>$n4[7&1$H+! + P!$<$<b4bϠB(@I(?<=>$n<3 !$H*@ϠB(@1(?<=>$o$`.8!Q!E$  <$<C<$<bf$ϠB(@ ?(<=>$o\ (8$BЮ80G+@&0V+$!`$Q@! !%$<$C!Ϡb$@<b(@'&(?<=>$lدۯ<4B<4BgϠB(@&=%&'"<>?( $ $m((3%,b@($c]C!B\!@`@ !D @ !L 0!(@@!B2@< ` !$ 0! (@!&"D @ !(@@!B2@ < ! $(@!&"(!0!@ ! `8!`@ !D @ !L 0!(@@!B2@< ` !$ 0! (@!&"D @ !(@|@!B2@ < ! $(@!X&"`D @ !(@b@!B2@ < ! $(@!&"ϠB(@L&?(<=>$o =`@ !L 0!(@5@!B2@ < !  0!(@!Дu&"ϠB(@&(?<=>$pӯϠB(@&>?(<=$p (!(&0V"!+`$Q\'9T  !(@ϠB(@@(!($p (b$Bib BT@d@D$BD$<ϠB(@>BC(@A$q( (!/4BbϠB(@'(C@AB$q  C (CϠB(@ C(@AB$q (H$BH @ ! ϠB(@0($rH @0!(hd`\XTPLH'p<'!'Я,($ !$f!0 @G!$(@$$4! $0!$-,@$$&\$$RT&$@! @<4Bb$<4B +b$&<d%4B2$b$&d%H& $$@! $$ ,($ '00`(b@$b ( $D! g $$B !<'T!'ȯ0,($ !!!<;4BL ! $4@!`3#0$b(b@$$b<(4Bb <$4B$PL$PP$PT\@ !'9T `(!CB'4`<4C@ !`(!  0!@@!$B`!0,($ '8<' !'<8 O8!!0PX'(@C#C!<b4cMCBH+  0!'(` @(! <8'@<'T!'<8 ϠP0F OX!'( 8! 0!'(` @(! <8'@<'!'ȯ40L'( !@!' @($P0`$0 $$!$L&\'9T "(<4Bj' 0! $@@!\$B\40`!'8<'!'ȯ40L'( !@!' @$\$2 '9T "(<4Bj' 0! $@@!`$B`40`!'8<' !Dbtdt<'!'Я($ D0!Pp!$Qp$'00(!@$ @!S!a&@Q`!!($ '0<' !Dbxdx<'!'د ,!$,',(!@$ @!Q !a`!! '(<'P!'<808!!(!b $f(((($Br <$4$^P$r $0!&$<8'@  <'!'ȯ40,($ 00 @D !P# D !'! !@:@@!D&`pDG*0!@ dt(!F#$E!0f *$CCDf#DtP#8!Dd!&%`Gx 0!@F!$G!0f *$CCD@F!cxC!D@s|Dt40,($ !'8<'!'HD@<840(\00!(!'9v P(@@!DPt Et@$EtEt#&@ !$BEt$t$"    t !DPp$Sp,(!'P $(@!@# !\'9v <(S$گ(QR(P$($Brԯ 6$^P$r $(^6&Ϡ(@ (SPQR $s(b !"q (@ @!% @ !( !(@$"&'X(E"$sP ($"DY| $ (!($(((<$Bs6$^P$r $(6r!b !$Bb !HD@<840'P<' d!'ȯ0,( \00!(!'9v 8@!'0B(< !14Bb @$FXf ((!ϠB(@ $sܓ9:;8  p(!X (b!Ϡ$ B(@ $t8e9:;8  !0,('8<' 0!'Я,( \00(!'9v 0!(< !@4c @$FX ((!ϠB(@ $sܓ1230  !,(`!'0<' h!'XTPLHD@8\d0(!0!'9v `8@@!<4B\d@ !'9w 0!8@@!Ddx Ep@$EpEp#&@ !$BEp$x$"   ^ !&4(!'d $8@)@+ !\'9w <8g`$e(efdabc$((($Bt ,04$^P$r6 $8`6&ϠB(@ag`bc(def  $t܏8DCY# Q$ 0!80$(((<$Bu8$^P$r6 $8%60!b $KϠk B(@!X`e!Eafgbc(d $($ud `0!8!XTPLHD@'`<'!'<80\D@0(!'9v 0!<0@ !0!@-4c\D'9w (<0 !@"4c @$FX ((!ϠB(@$uܓEFG@ABCD $ (0!<8`!'@<'!'p|x(\(!'p'9v p(@@!< 4BC `B@"!@!$`!"PϠB(@X(C!E $vT(0$0&2K @#$b ,#b !$ !0C&s,&DY % $(Ϡc(`B(  $v(\ !'9w &s(P`! !( !'0\$'9x @!(@!~ !%& '0(@ "@@ !% (  !(@!"@-D0Y $% (Ϡ(B($w@# (\'9w  !(ϠB(@ ( $w( ! (@ @!@% @ !( !DY| $ $(\#p !'9v C(!|x'<'H!'hd`D$b!<44BϠB(@(!( $wȏDPp!!  ! !' @$\'9x @! !@' @ hd`'p<',!'د D$b!<4BϠB(@(!( $xDPp !@  ! '(<'p!'௿!\'9v 0!<4c@ !@(!\'9y\ !`!' <'!'௿!0!@@ !@\'9v @!<`4Bc<DCp<` !(!`4B\'9y\ !' <'0!'௿\!0!'9v (!@  \'9w @ !@<4BB@@ !<4B\'9y (!!' <'l!'௿\!0!'9v (!<@ !@4c\'9w <4c@ !@(!\'9y !`!' <'!DD$演b$0伔<'!'د D$!Y !,E  0` !" '9 '(<'!DD$漜b$伜<'!'د D$!Y !EB,F  ` !" '9 '(<'T!D!E@$EE@!$BE !<'!DD$漘b$优<'!'Я,($ D!!Y! 8!b,eF $  ! B`,($ '9 '0,($ '0<'!'Я($ !4!!$'44(!@$ @!S!a&@Q`!!($ '0<'$!'HD@<840(!!!$$$$ 0&(!@ ! $ (@@!@$}FDEC(($($Bx< 4$^P$x $(!&D2PY !b,DeF 8! (!HD@<840'P0 !D!B$c0cFe8+$!<'!'PLHD@<80!!!!@@ϠbLcb@#Q!<b4cMCBC+@U!b1@,#@$$ϠCjL B(@DEHI( $($x 1E0$#Q!<b4cMCBϠB(@!DEIC( $($yT  (!0!PLHD@<8'X<'l!'௿@! @b#b!<b4BMb$BB ' <'!'ȯ40,($ !!!(!<b4SMӒ@?F@b#b!sBd+`/ @)X'( @8!#O(P%0$  @(!Ԏ'(  0!@(! $B0C` @C#C!SB <b'(`  0! P O(!<b4SMӒ@>F@b#b!sBd+`. @(X'( @8!"O#P%0  @(!Ԏ'(  0!@(! $B0C` @C#C!SB <b 0!` '( 40,($ '8<b4MӬ@C#C!F @C#C!F @C#C!F@C#C!F<b4MӬ@C#C!F @C#C!F @C#C!<b4cMC  <'$!'840,($ 0@P !0 0 !@D Q!@ ! !' !@W@!D&8!C`0!@G!G!$F!0g *$C4C0DP!@g!P!g!0!Dd!&e`0F 8!$@F!0g *$C CD@&&B8!T !b!D` D(!@G!$E!0g *$CCD@g!BPb!D`!UDDTDD840,($ `!'@<' !'د ,,!$,',(!@$ @!Q !a0`!! '(<'x!'LHD@<80LT0! !0@@!DT E@$EE0@ !$BE$㼔  $(,0\!,&, . (!'T $0@#@%`'9  !0W$[U(V(T$($Byį< (4$^P$x $0J!&2010ϠB(@ (WTUV $y0DCY0 P,E  0!01@#T 0`!D8B0B@`!$v((($Bz<<4$^P$x $04B`!LHD@<8'P<'!'د (,!$,',(!@$ @!Q !a`!! '(<'!'TPLHD@8 \00! !8@@!D\Ѽ E@$EE$#@!$BEļ#0 2 a !P(&S(5(!'\ $8@*@,`'9  !8G_$JHI](^\$((($Bzh< ,044$^P$x $8O!&ϠB(@DCHI_(\]^  $z8DcY# +qB,$EF  8!8#!D8B0B@!$د((($Bz<4$^P$x $84BB P! !TPLHD@'X<' !'PLHD@<840(,!4&(( -"$B@$"Ϡ(B(@${"%&'$ (` (!'9 @ !(&2Q0p,&t,!@$D$b$@&Ϡ(B($@${|BEFG$ (`@(!&$$'9, $( Ϡ@*b(@ ( ${䏼( b1@5 (!(  *%1 0!(b(@ ( $|0(b1@ (` !'9D (!(b1@ (p ` !(S @ $B@ `` !'9d (!(@$$B@",B$BϠB(@$b($B|l($B|t( $||(@&0$B@@ϠB(@ $( $|䏼($&0p,!&  ! !"@$B@"ϠB(@!"%&'($}P$ (b1@ $ `0!(` ! (!0!'9, 8!$(b:B(@"%&'($}$ (`    ! (!'9 $(@ `'9  !(U!b1@=% $3b1@<% 0!(`'9  ! (@ B(@ ( $|0(b1@$ (!(` !'9D (!(b1@ ( !" @&5$B@" &&5 D` (!`` !'9 $(&00PLHD@<840'X<'!'d`\XTPLHD@00!!!x!B`@Q !%$y&D 0! 8!0@@!`$'9| @(!0@ @!DB8B0B@$ϠB(@DCHI( $ $~ 0`@ !(!'9 0!0@1@E 0!0D,0!!%$s&D$0!`! '80@%@!`8@(!$'9, 8!0@ !(!`'9 0!0@c1@rE 0!0D<$ b%&D 0!`! 8!0@[@!`$'9| @(!0@@!DB8B0B@~&$믢((($B~p<4$^P$x $04BjϠB(@DCHI( $ $~0`@ !(!'9 0!0@ `'9  !0@&1@E 0!0Ϡ"(@LPD* BCH ($(((! $~0LP$ bd!@C#C!<b4cMCB&0U+@1@D 0d`\XTPLHD@'h<'ڰ!'XTPLHD@<800!!!p@+`t!`V!E&$ 0!'9 8!0@X@!`D'9|  (!0@@!DB8B0B@S&$:((($B~p<4$^P$x $04B?ϠB(@$#()( $ $}0` !(!'9 $0@`'9  !b1@&$ $b1@ &<$0! 0&0T+@0 &2 8 !`'9 (!0@,Ϡ(B(@$h#()*  $0b1<@0!$ 0`(!@ !0!'9, $0&P$"b1@$ $0`!V!`&$$$R0!@! 8!0@z&&$ 0!@! 8!0@q&`'9|  (!0@@!DB8B0B@`&$((($B~p<4$^P$x $04BL` !@(!'9 0!0@`'9  !;ϠB(@eLbP$J "#( ($(((! $~0cLbPD bd!@C#C!<b4cMCBb1@&% `0!0&0T+@x0 &2 / !`'9 (!0@#Ϡ(B(@$h#()*  $0`(!@ !0!'9, $0&P0$&2$8 !`'9 (!0@,Ϡ(B(@${|#()*  $0b1<@$$ 0`(!@ !$'9, $0&PϠ(@eLbP #("&'$( (!0cLbP bd!@C#C!<b4cMCB"b1@$ 0p` !XTPLHD@<8 '`<'x!'tplhd`\XTP@0!!!!QHO$((S$PB@@"$ϠB(@$efgb#()< $ $$@` !'9 `(!f'dec()*<$((($Bt< ,0484$^P$x $@#$b%`b@"bϠB(@P"<%&'tplhd`\XTP$ 'x B3@"(@$H0 H@ !`'9 (!@0!@ !@  (!`'9@ @@'!`W!&$ 0!'9 8!@@p@!`'9|  (!@@@!DB8B0B@&$>((($B~p<4$^P$x $@4BϠB(@!#$%&'   <$B$<$B,<$($4(! 0! @8!@` !(!'9 0!@@ `'9  !@I&B1@% @0!"@@$ 0!@Ϡ(@ELBP$ "#( ($(((! $~@CLBP bd!@C#C!<b4cMCB`b&0V+@OH@&S,B,Q$S0B0@b@$Ϡ(@ "#<&'$ @(!@" @.((0 @$}P#()*  $@"@ B1<@0!$ @`(!&$ 0!'9, $"$@,ϠT  !@!΄ @0@!x'(! $ @@B!x ! ' !0!x@8!΄ @@ !xE0! 8!@!l `!TPLHD@<8'X<'!'ȯ0,($ ؏!!!(!0!<! 4T΄  !@ !@(!T`0!@ 8! @!l !0,($ '8<'8!'PLHD@<8؏!<!!(!0! 4S $$@B@u@~ $$DT !@!<4Sn@E !x'(! $  @ 9 6"x ! ' !@0!  0!@ ' $"`<T  !@!΄ @.@!x'(! $ @@B!x ! ' !@0!΄ @@ !؎E 0!@!l `!PLHD@<8'X<'d!'Я,($ ؏!!!(!0!< 4S΄  !@ ! (!@@0! @!l `!,($ '0<'!'د ؏!$(! 0!  !$l @!! '(<'!'د ؏!$(! 0!D  !$l @!! '(<'!'@<840؏!d<!0!(! 4R$"@&'x(! $ @!D '@ (!  (!@!dl @!@<840'H<'8!'د$ ؏!D!0! (! ! (!Dl @!!$ '(<'!'د$ ϴ$$ 'D !(! 0! l $ '(<'!'xtplh! !'$x(!$L !@  !<<0$$L $N<4B`! q@ !h 8 !@(! $   !@@!8b`!xtplh'<'!D(!D $O<'!'PLHp'! !D!`!  @! !PLH'X<'(!'PLHp'! !x!`!  @! !PLH'X<'~!'PLHp'! !!`! $ @! !PLH'X<'~ !'PLHp'! !!`! ( @! !PLH'X<'}!'PLHp'! !!`!  @! !PLH'X<'}!'PLHp'! !p!`! 0 @! !PLH'X<'|!'PLHp'! !!`! 4 @! !PLH'X<'|!'PLHp'! !!`! 8 @! !PLH'X<'{!'LHp' !!@! , LH!'P<'{!'௿<4B !' <'z!'LHp' !4!@! < LH!'P<'z\!D(!D $M<'z4!'د Dx!& !(! $L  !  '(<'y!'xtplh !! !!` !@ (!`'9  @!'$x(!$L ! 8  !@!` !@ (! !@!xtplh'<'x!'plhx'! !(! $L" !d8$ "@8""plh'x<'xL!DB!<'x!'௿ !D$ !' <'w!'௿D!$B܌B@$B܌D  @!`!' <'wp!'௿HD!$BܐB$$BܐD  @!`!' <'w !'௿D!$BܐB'$BܐD  @!`!' <'v!'௿丏D!$BܐB&$BܐD  @!`!' <'vD!'௿tD!$BܐB4$BܐD  @!`!' <'u!DB !<'u!DB!<'u!DB!<'uP!DB !<'u !DB!<'t!DB$!<'t!DB!<'t!DB!<'t`!'@<8'!<x !$(!&4Gp $D (! $ԏD@@8!$((0bb b$b (b,b@<8!'H<'sp!D(!D $L<'sH!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'r!'د !!"D$x$(!C$(  !x $@ !D@$ԏ`'9  @DDC$&(` !` " @&("" '(<'q!DB(!<'q!DB9!<'qT!DB0!<'q$!DB<!<'p!DB@!<'p!DB:!<'p!DB4!<'pd!DB8!<'p4!'840'!<x !$(!4G  !$ɠ 0! (!D@@8!$DD(bb b$b 840!'@<'o`!D(!D $K<'o8!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'n!'Я($ $!b8!Dx(!$D $ !x $@C@ !D`'9  &eԏ@: !x $@3@ !Dt &E؏@+(!Dx&( ! $B&dԏ (!@$"DDDB@DDpE(&D $@&DB""($ '0<'l!DBD!<'l!DBL!<'l!DBP!<'ll!DBT!<'l<!'840'!<x !$(!4G  !8!ɠ 0! (!D@@8!$DD(bb b$b 840!'@<'kh!D(!D $K<'k@!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'j!'Я($ $!b8!Dx(!$D $ !x $@I@ !D`'9  &eԏ@@ !x $@9@ !Dt &E؏@1(!Dx&( ! $B&dԏ (!@!$"DDDB@D$(C$b Dp(&D 8!@&DB""($ '0<'h!DBD!<'h!'ȯ0,('!<x !$(!4G  !D 0! (!D@ @8!$XX$b b b0,(!'8<'g!D(!D $J<'g!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'g4!'Я($ $!b8!Dx(!$X $ !x $@B@ !D`'9  &eԏ@9 !x $@2@ !Dt &E؏@*(!Dx&( ! $B&dԏ (!@$"DDDB@ DDE( &X@&XB""($ '0<'e!DBX!<'eh!DB`!<'e8!'840'!<x !$(!4Gp  ! D@@8!$hh(bb b$b 840!'@<'dl!D(!D $J,<'dD!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'c!'د$ D$!x&Dh(!Q$ &Dh @&Dh$ '(<'c !DBh!<'b!DBp!<'b!DBt!<'b|!DBx!<'bL!'840'!<x !$(!4G  !  (!D@@8!$||(bb b$b 840!'@<'a|!D(!D $I`<'aT!'Я($  !! ! !t@'  "#$d !b`(! ($ !'0<'`!'د$ $!b(!Dx(!$| $ !x $@,@ !Dt &E؏@$Dx(!&h ! $B ! $"DB@ DDDh &|@&|B""$ '(<'_|!DB|!<'_L!DB!<'_!DB!<'^!DB!<'^!D(!D $H<'^!'LHp' !,!@! @ LH!'P<'^ !D(!D $E<']!'x0'! !'<']!'x0'! !'<']P!'x0'! !'<'\!'x0'! $!'<'\!'x0'! (!'<'\T!'x0'! ,!'<'\!'x0'! 0!'<'[!'x0'! 4!'<'[X!'x0'! 8!'<'[!'x0'! <!'<'Z!'x0'! @!'<'Z\!'x0'! D!'<'Z!'x0'! H!'<'Y!'x0'! L!'<'Y`!'x0'! P!'<'Y !'x0'! T!'<'X!'x0'! X!'<'Xd!'x0'! d!'<'X!'x0'! h!'<'W!'x0'! l!'<'Wh!'x0'! p!'<'W!'x0'! \!'<'V!'x0'! `!'<'Vl!'x0'! t!'<'V!'x0'! x!'<'U!'௿$b !' <'Ux!'ȯ0,($ 픯8<! 4Rp@ !0<<<$c$獰$ $Ǝ @! @ ! 0@!@(!'8@, !`'9  (!`8!`@ ! !@0! @!D`!D @!h@* ! @0!<<0$h$L $Nh  !@0!<<0$h$L $N  !  !@!0,($ '8<'S!'@<840,( 픯HL<! 4Pp @ !!! ! @f@!` !@(!'9 'L @7@! @ !h @!  !08<<<$c$B8$$Ǝ$獰   @!  @ ! `@!@@(!/!` !'9 'H @@!  !  @!D`.D`(!8!  0! @@!h  ! @0!<<0$h$L $N @ !h  ! @0!<0<$L$N $h  @ !  ` !  ! ! @<840,('H<'P!'LHD@<840(픯PTX<!` 4Pp(@ !!! !(@@! ( @ !(@@!` !@(!'9 'X(@Z@!` !(!'9 'T(@Q@! (@ !h @!( !h @!(0$c8$c8<$Bl<$B|<<< !$$Ǝ$獰 ( @!( @ !(`@!@<;4Pp !`@(!'P'9 `@(!'P'9 (@@!  !($@!D`.D`(!8!  0!(@@!h  !(@0!<<0$h$L $N(  !(#@ !h  !(@0!<0<$L$N $h(  !( @ !( ` !( ! !(LHD@<840'P<'M !'LHD@<840(픯PTX<! 4Pp(@ !!! !@!(@! ( @ !(@}@!` !@(!'9 'X(@J@!` !(!'9 'T(@A@! (@ !h @!( !h @!( !0<<$c8<<$c8$BD$$Ǝ$獰 ( @!( @ !(`@!@@(!3!` !'9$ 'P(@@!  !($@!D`.D`(!8!  0!(@@!h  !(@0!<<0$h$L $N( @ !(# !h  !(@0!<0<$L$N $h( @ !(  !( ` !( ! !(LHD@<840'P<'I!'ȯ0,($ 픯8<! 4Rp@ !<<<<$c,$獰$ $Ǝ @! @ ! 1@!@(!'8@- !`'9' .c (!``8!@ ! @!@0! @!D!D @!h@* ! @0!<<0$h$L $Nh  !@0!<<0$h$L $N  !  !@!0,($ '8<'G!'@<840,( 픯HL<! 4Pp @ !!! ! @f@!` !@(!'9' 'L @7@! @ !h @!  !<8<<<$c,$B($$Ǝ$獰   @!  @ ! `@!@@(!/!` !'9*| 'H @@!  !  @!D`.D`(!8!  0! @@!h  ! @0!<<0$h$L $N @ !h  ! @0!<0<$L$N $h  @ !  ` !  ! ! @<840,('H<'E!DB<'D!(! 0!<'D!l <'D!'ȯ0,(D"@$DD0! ' @ <(0$$D $NR0`'9F D"Ȍď`'9G  ,b@2($c]C!B\!@P   p   8!   (!  0!4  !<'B!'Я,($ !<į8<!$ԯ'$ $ @8@!@5!`'9F (!x $ D<@DH8(Ĭ DGȏ`'9G  "ďDD̏DE !!,($ '0<'Ax!'@ 0`@!4!(!88!,(0!'9I $ @'H<'A!'@ 0`,4!0!8($'9I  @'H<'@!'@ !H!`@(!8,!@!0(4 0!'9I $ @'H<'@0!'@ 0`H!@!0!XP!!8!,(48'9I $ @'H<'?!'@ !!@(!0`,8@!0!(4'9I $ @'H<'?H!'@ 0`(8,!4'9I ! @'H<'>!'tplhd`\XTP<08<<$bEEcE<ִ$'($(%8' %(,'0%Iܯ $,08@H<!4&ܯ<DLD 4Q&C$D<¼$쯣$@ 8!@!0<8$ $D@ @!Dh &eЏD@@! `$$G, 8!@@!ĎD D̎eЏ !@ <(0$$D $N<"4B &܏ļ $@&܏<$ Dh $p @ <<$D$܏0 $N,$Q $@@!<<$d$L<$Q@(! $@ @!<<<$$L$Ǝ<$O'  $@ @!<<<$$L$F<$M(! $@ @!<<0$$L$(!$L $@ @!<<8$$L%8'8$K`(! $@ @!<<<$$L$ƌ|$K`(! $@ @!<<<$$Ls$ƌl`(!$J $@ @!<<<$$L`$ƌD$J,(! $@ @!<<<$$LM%&,$I`'@ $@ @!<<8$$L:$ƫ($I (! $@ @!<<<$$L'%F܏$H'H $@ @!<<<$$L$ƋЏ(!$E $@! !<<8$$L$&0 $N !tplhd`\XTP'x<'8 !'د <쏐D $<4gDD$b$$C&$EQ $DEQ $&@ !x Q@8!D4$ž4@ !$,Ѿ4  '( !'(<'7!'plhd`\XTPϠ"(@ !(!< $x' !(!D $̏⽐'菖D&ž@ $0Cl`$ $*.0*,.@T0!H$<DFBH'  ! (!lhd`'p<'-!'@ ! ! @$į !(! ' CC  !f$$ 0! A@!(<$<4$^P$ $ x'( !(! $n '+@ !<` 0! $ $(P ! (! $n A$(<<4$^P$ $ x !(! $n @ ! 0!<` $ $n !(!0!8!(   !䨯(!0! 8!   ! '<'+$!'8į ($$b]FDEc]$D$ 123(0$$ 0! AB(<$<4$^P$ $ x'8 !(! $n D8?@(! $n A$ď(<<4$^P$ $  $ $$ $ @!T@#a(<$<4$^P$ $ Ԏ$$'(4 $ $$ԯ'(! $! $'ԯ(! $" $'ԯ(! $ $'ԯ(! $6 1$'0(! $ $'ԯ(! $ ď'<'(!'plhd` T'8D$\'(8$<'X@$D'8H'8$LXP@(! 0!@!L ,B @!$ H(!,@@ !$b @0!$  $$ ($B^8$(b0΄ 0 ` !(!@8! '($<$B (<<4$^P$ (! plhd`'x<'&T!'诿  x'($n !(!$nD  D''(!$d8!  <@!(<4$^P$A (!$2($B^8 "(<(<$$^P$b 4$=<$B     ! Dȯ(!$d 8!  '<'$!'d`\XTPLHD@!!!!!<x@<a4BϠ(@ <{xyz $,x'0@ !(!T $$$P40@(! $@' (@ <7456 $p<*4Bx !(! $x$ȯ$$ (!0! 8!V (@<<(! $<4WP$4@(! $!d`\XTPLHD@'h<'"!'LHD@ x'($!(!  ! '8L @ ! @!8!(!@!$ʏTC *D$8(+0, 4 <@!(<4$^P$@ $$<$B   !LHD@'P<'!!'@<8 x'(!(! ! $   8!T(!D$$˧(  <@!(<4$^P$@ $$<$B  !@<8'H<' !'<840Ϡ!?@AC8(! $n A$<<<4$ƣh$0 $ &DD0$bBb!d$ %*@d0!D$FDD D(!d0! $& d'G#<|24Bmb0r@R!R!R!8!@O $RB% C$4BU$$(! $D  $" @ !!"#(!$B0G$s"4`0! $t "|@ |d'9 d"2'9p  0B$d%< !'9`(!&& 4  d'9 @ ! DЏD & $0!x@(!DCd$Yp# ! ! ! #0@D!C!C$b D $d @@ !d$ '8 `8!D$F$ $ $D'@8!$f$ $ $& '0 @!'(D $D@ !  @!@ !%C*@ !"C*@ !D$d `(!D@0!D8! $ @@!D(!d 0! '(DBC!B0b0B@$n䨯'8'(!$ 8!$D@!,폼 @&DU4 ' @<`(!0!A4D!@7@Q!DQ!Q!E!B@ &#D$C0b@$b0q"+ E !D$$|(!$  $n B!CP @"*@ <`(!0!4d'9  !@d$Y (@!DQ!Q!D !0B@$|(b@20!Q!dQ!0!< !`(!$ '9 4Q d'9  !d !`0!'9 (! D$D ED(!d 0! DB@!D" !$b'(BC!B0b0B@$n䨯'8'$' 8!@0! @7&d0'9|  ! DB0B@"(! b*`1@0#00!D0 $D" $!ŬC"!B$@d !'9 (!$B,B@DBA< $DB@!@H!DG@C!C!C!(!BH$d0i+@@`DBb*@}$Dd0q!$B !0'9p $ 0B@T|@' $d  &  !(!d'9 `0!O`!0*b@ $BA?<$<&e0 $@@Q!Q!Q!C(!$ b$ $BA <$T 0c $ %*b@4$0!D$ $n(! 8! d'9  ! '0$cDBb*@D$D <GU$(<4$BH询$ƣh (!<'!'د !<#4BD0!$ (!0!D$p $ $$$ ! '(<'!'Я,($ !!<i4BDD(! 0!#< $<4Bb$d%#<4B'b$'d%#<@ $<4Bb$d%#" &#" &$@(! "@2&0x !(! $d !P @(!#`#8!D$I@G!G!G!I(!$0GD@+|@&f0|@`,DT $$ !,($ '0<'!'Я,($ !<z4BD(! 0!2$2Cb&<D!b@)@DP!cC!b@2Dg $e$&$ $c"C  @<<A4P?4PQRb&0p+D!X!@2@DP!d&DP!B@$0p"#$%)&' ( B $DEBCFGHIc,(cDT#$BC @,@$@( $!D+<4PQP$ !,($ '0<'!'د D0$0! (! !d'9 $$$ @!! '(<'@!'د$ D0D!0! (!$  (!@P!DB+@D! !DDBb!C#C EFG#%&' C E$#B(% " !$ '(<'(!'د$ !<!D(!$ 0!D@DF0C$D@C!F!B@0b+@$C$ $ @(!4$  '($ !'(<'!'د$ !>!D(!$ 0!D$B0BC+@DF0C$D@C!F!B@0b+@$C$ $ @(!4$  '($ !'(<'!'D@<840,($ X!!@0!(!! !@!D@ bA(!< $ bA< $bR!bCBb%$1*@$ $ $4<$"6DBA<< $DBA2<$ *DBA%<$܏DBA<$DBA<$DBA@(!< $b$CcBcC%$b(b@$$b 2b$b$,DBA2< $4DBA(<$H  DBA<$\DBA<$pDBA@(!< $dD$bE$HBf,'e%b%"h%%<@(! $b$Bb$(*@$ $ $)/ $")"A0$<($"A($< $Ď"A $<$Ԏ"A$<$"A$<$"A$<$  $ *@$$!9$ 5f௷ !(! 8!@!DBA3(!4 $K*D<"A$0bP!E *@ &0"A$  *@DBA< $ďDA(!0 $NA(!< $4bD@R!b<840,($ 'H<'!'D@<840D!!!A0< $HA `(!<$\@0! 8!A< $|A<% $"0C$b(b@$`bA<$A<$A<$ĎA<$ "0E,@=$d '9 p B 0!P<$0c$$`DP!$&1&1&1&1&1&1P!P#P#C(!Pݜ0B@ `<C!G$ $ t<D !<<$$ $ƪԏ !.%d($ '9g '0($ <4B'0<'!'Я($ ֔8!$!0! (!B+@P!ݜP#cP#C!bL@$$ B+@<4B< 4BdP`4$$bP$$ !($ '0<'!'ȯ40,($ ֔8!!0! (!B+@ݜ!R#cR#!bL@ !$ B+@<4B<4Bx(! $e !(!$ $ e&$D(!$4 $@e&$(!$ $@e&$̏(!$< $b!D $xC#@C!C!C!C!#!#b#!D4#@&%  $ b!P4"@#Ď<"ЎD#̎8$ԎL#Ȯ"܎H$ #,@%$,B@"!`C!B"R#cR#C!D,",b9("(b4"b/"b* " b%$"$b 0"0b&RD&< @(!@"b"b @ !<$ $P<B4Bh !(!'9 $@!@8() *+,-. /$#$(%,&0'8"     $(,08&<&%<$P $#"̦ $b @!h'9(  !@!@!$ '(<'g !$b$h'9 <4B<'f!$b$h'9 <4B<'f!'௿$b!<4Bh'9 &@<4B@0!&$H $ $!' <'e!$b$h'9 <4B<'e!$b$h'9 <4B<'e!'p|x@!<H4Bx'$ ! (!h'9  !'@!0!8! $ $@%'ȏh'9  !@!B0B@  0!h'9$ '@ 0!&s8!'x $ $`!<4B|x'<'d!'p|x$!b!<;4Bx' !(! $h'9  !@+!' 0!''x $ $hb !'9& . @!h'9$ '@&R '@<4B!|x'<'b!'௿<!$4d$Ch'9 @0!<4D 0B0d@4c@ !8!' <'b !'Я($ $b$<G4BD0!$g(@$I$$@!$(@<04B$c(C!IDDc P$@C!C#!+@!4@$  !b (!h'9 b D$&@b!b# ! +!($ '0<'`!'(ԯЯ̯ȯ$b!<:4Bh'9p @2<D $ C D@C!0$C#!+@!4@$  !(!b$h'9 B $$&@b!b# ! +!ԏЏ̏'<'_X!'௿!<$< ' ($c\!@(!,B@ <4B<$t ' y ' <'^!'\XTP`d'`'d ' @!$b (b@$$b'Fb' BD' $(!$gh$p"$0!$(@@F#$chC8! 0!&(p $ $<# !"$ $h'9l @'x !(! $$(!P $@'؏x !(! $ !h'9 @ $b4d'e$"bfeb h%''('9 h''9ЏD hb 0!$h$(@$pBbF#$hC!@<# !"$ $h'9l !@'@x !(! $$(!P@ $@'x !(! $h'9  !@, $b4'e0!BbeHb hE'9 @&1h'9 '@ O< $ G< $` (!(!P $@< $DH C DD$@C!C#!+@'H$4@ F$B4$+@<H $؏ h'9p `@\XTP'`<'X!'Я,($ D!$$$B($cDa$BDx(!$h $@T!D<T#$$@0! &g$@@!Dxd$ @0! (! $*@ !g$$$cd*4@$ !,($ '0<'W!'௿ ̏$$ 0!A\<G]<$4$$ $x'  !(! $n\$ &V@ !$9B2@@ !$  ! ! @! !t @(! @ !$ @ !$   !A ! $@ !$ h'9V B0$B,B@B@L$D&3  !@D@!e$#E#q*@`!D e!V(!&  0! Ѱ!bQ!bLd&e &p$Cd @ dEa$c Ea  ! !Ҩ@$> @  !C*@$ȏh@ !'9V $  @ !  !$oC @ !B@ $ h@ !'9V $  @$ $h'9V <840,($ !'@<' !'LHD@<840,($648!'  &u &r&wX&~X!$$B`A$c'$$B`A$cBd!ed$2P %(%de@ ! (!@ !\ $@ ! $@ !t (!0|頮 Ea ' 8!0!' $ $0!8!'  $ $"0$C,b @<$cC!B\!@"|@ ! $@ !",@$#0b$bh'9d\ ` !@$h !'9V $ $" ` !#@ !$b` $$b # " &"&(!0! 8!@*B#$b`$bE$B" $c$b !@(! $@ @! @ !<)$c܏@(!$b@ ! $@ @! @ !$b !'( $@@! @ !<$cЯ0<<<$cN$$$ʘ @8!!\  !@!<0(<$N$ʘ& &'N&&'N(<$N4 $!@<840'H<'p`!'௿ !  !!' <'o!D$B!<'o!<$B <'o!'௿D &T &l$cp' !<'o0!'௿<!$$!  !<@$  !<@$  !<@ $ p@甏`!' <'n\!'ȯ0,($ ޠ! ! $(@!!@9&$ݬ  @(!C @!<4Bb!` ,B<@4u<4Bud4u"#  h  @ !b! &RS*@0,($ !'8($<'l!'d`\XTPLHD@%"^ %C^(%h^0Lm"^ C^(h^0$(,04 !!!x| !@ ! !' 0! @ ! @! @ !@ !0! '( @!(!@0! ` !  @ ! 0!@ ! '0 @!` ! (! @0!%$$b^8Bc^8< 8 @ !@ !0! '8 @! !(! @0!$# (!$2(!7X !`(! 0!@-@!X&(!$ 0!@"@!X (!0! !X$ &@@!X0!$`(! X8! ` !@! ` !@!d`\XTPLHD@'h<'i,!'د$ 0!!$ @(!@ $h$  '($ '(<'h!l!!(!@0!`8!$'9 <'hX!'h|xtp! ! &8!!1! *" @&h$ 0$0$B 4!h 840<$ <8h$, (HLL<HpD$ ! @@ !$l'9 `dDPd`TPhwXDT% @"0B@$ @!BXS!(B@< $UDT @PBXS!(B@@Th$ $ @!(!X @0! ! @X(!X @0! $< $$@<$ $H@<$B$ (l'P$$' 8!'9 p"0B@D  @ ! ט@ ! @( 􏙉$^C^B@8 <  @ ! @ !'8 0!  ! @! @@!􏙟X !(! 0! @{@!%^%$^%E^%f^$^Lm^$^E^^f^LTdtPp`HX\hlx|  @ ! 'H0! @ !  @!  @ ! 'P'X @ !  @!  @ ! '' @ !  @!  @ ! '`'h @ !  @!  @ ! @ !'p 'x @!&(Dد$B䯢XD$B0hD$B x  !(! @0!   !`(! @0!   !@(! @0!   ! (! @0!  !8!X (!  ! @! '|$^&^ČEf^c^įȯ̯Яԯد௠ @& $  &  @ ! '0! @ ! Ȁ @!  @ ! '' @ ! @ ! @!  ! @! ޠ @ !  !, ! ޠ @ !  ! ! ! !ȏ\<$1 $Fؘ   ! (! @0!  !X(! 0! @ @ ! @ ` !!'쯾请䯶௵ܯدԯЯ̯ȯ $!!! ! @ !'(τ' '0  !(!x$ @!'0'<'H'T'`'l'x''''' ''įа'8 !@(!`0! 8!@! ``  ! @($E<$Eď< $ԏ   ! <$ceDC!E $   ! @(!< $4   ! @(!< $d   ! @(!< $씏 X  ! @(!< $ď   ! @($E<$Eď< $ L  ! @(!< $$ ؀  ! @($E<$Eď< $T   ! h @ ! @(!< $턏 < $   ! h @ ! @(!< $菼   ! <$ce4C!E $   ! @(!< $H 4  ! @(!< $x   ! @(!< $   ! @(!< $؏ 4  ! @($E<$Eď<$,@ԏ  ! 8@  ! D@(  ! P@l  ! \@D  ! h@,x@<$x$8 ! t@(  ! @  ! @ $/b !'(! @(!  ! @(!  ! @  ! @(  ! @ԏ  ! @<  ! @H  ! @$| ! $쏾菷䏶܏؏ԏЏ̏'<'5!'Я,($  ̯<!! !@ !@!τ'  'h !(!x$H @! !(!x$ ' !(!x$! ' !(!x $'(!x $'(!x $!'4@$<'X'@(!(@Ld ! `0!@!@@D  !h @ !@(!< $d̘  !@<$E4$EP< $<0$ $HԬ  !h @ !@(!< $\$$@(!  !0@  !<@@H@@ T@w@sݬ (!@)@! & @ ! @ ! @!@0! !x (!@ !  (!EDX  !Y  ! @!@ !9 $<@@  !9 (! !| (!H@ @(!9l  !T@ @9t'  !9\ ! (!9d !0 $H`@@!4 ! '؏@!,($  '0<'0<!'쯶诵䯴௳ܯدԯЯ!!! !'  !x(!$0 @!'P !x(! $!'x !x(! $!' !x(! $'(!x $@(!$'(4@L !`0! 8!@!@@< $$@P@0@x@<@@ H@@!@@!| @(!  !@yݬ (!@!< $䏼) & @ ! @ ! @!@0! !x (!@ !  (!@!X  !Y  ! @!@ !9 $0@x@  !9 (! !| (!<@ @(!9l  !H@ @9t'  !9\ ! (!9d !0<$HT  ! @(!@3@!  @ !, @ !@@! ! @(!@ !P (!$0@@!x@ @! !(!Y @!쏶菵䏴܏؏ԏ'<'+(!'TPLHD@ x'(!!! !(!$  ! '80hа@ !`(!0! 8!  @&@!@  @(!< $,@$8P<,b 0!$@$! ` ! $ !TPLHD@`!'X<')!'௿D<$$H$ $<& $k&(!P $e(!' <')@!'د !8 @!:x&$.(! $&  '(<'(! <'(!'840,($ D!!&CX@ !$b`I0R!D$BBb !!BP!&t!$ (!@+0pP!&C!+@(!d @&Dp!$Bb !`@ !.@ !@&!0RX&0u$C0B$B*@!0u840,($ !'@<'&!'د$ p'9c0 !@@!D$P\D&&"+@!h @(! @ !R&#!&+$ '(<'&,!'د$ p'9c0 @!D$RCXC!R!$b! !<<<$$$p$ 00#&(! x !(! $BX !$BBX$ !'(<'% !'௿D$X$0C!F!X0#$ x !(!$ ' ' <'$!DB|<'$L!'840,($ h! !@!D`$R`<k4Cu$g!$ p'9d  !@\!@ ! $.  !!BU !,$$0!` !@(! 8!@!Ҩ $.@@!@,$$0!` !@(! &'@!5<'4Cu` !t $t@(! 0!@@!XD  (!@@!D <4Bu  !td & @ !!840,($ `!'@<'"!'Я,($ D! $R`ST@ !`7!    @ !@!@ !<h"4Bu @(!@0! ` ! ! @!` !@(!P0! 8! @! @ ! !,($ '0<' !'௿p!'9i $ p'9f  !!' <' D!'د d @! !  $ ! '(<'!D$E$D$BDXd!b!+`0!0!!<'|!'௿0 !@ @!@ !BP`! !' <'!'د h !p'9e @ !@!!D$$$ 0@$# ! '(<'T!'<840,( !! ! @ !$.Ҩ @!@ $T $P0$@0!`(! 8!@!@8!8!P$@0! `(!@!$. `<@$T$ `(! @!$ b@ `(!<$T̯$ 8! @!<840,(`!'@<'!'د  !h`b @d  @ !#b!# !'(<'P!D$D 0!<',!DlD <' !'௿X  !@@!C @ !$b$b  p'9k &쏼   !ď ' <'D!'د p'9c0 !@ @!B (!@@ ! @ !p ! '9d '( '(<'!'د X! !  !@ h@ p'9d @ !@@ !  ! '(<'!'D@<840,($ ! ! ޠ@! !$S`u!<f4Wu`Z`(!X  &   @!Dh @!Dh @! !0!(@8! $@!h@@ !  @ ! ! @!B  !@`(!$" &s'$ ' @! ! (!$B&s @(!(  !@!! & !D@<840,($ 'H<'P!'د  X @! !@!@!C @(!$b$b  !p$T'9g @ ! p'9k &쏼  !ď  '(<'L!'lhd`\XTP ! !@!. @.@'<h @ ! @ !Ҩ $.B @<hT @ ! @!D $S`  ! @! @?!C$.b !Ҩ ! $. @$Q</4Bu@ ` ! T4P0!`(!  8! @@!PT`(!0! 8! @ @!Xd  (! @P  ` !  $."!@!$Jh@ ! '( (!$x ! @!  H  ! @!  !(!p'9m| $ @$HH@  (!pPdT$n 'H @$H '(H @$H@HH$ $<y4Cuh@ ! ! X @! p'9c0  !"p,B@$yi @!$"   ! h@@!B@@ !` (! @ ! $h @! &$ `4`!h @ !  @ ! U'!X p'9l @ ! @@!<4Pu D (! $p (!'9g  ! @! !`!!4Pu @ ! ! !lhd`\XTP'p<'!'Я,($  4!B @/ Dh @!Dh @!0!@8!( ! $@ !h @! @ !$C !$B sX(! ` ! @@!,($ '0<'!'TPLHD@8 !'(!x$ @!X  !@8@!Q$".hp &Yd @ !@@ !BQh &Yd @ !@@ !C$bh @(!'p'9m| 0!@!  ! @! 'pPdT$z '8 '8TPLHD@`!'X<' !'@<840! !Sz!  @ ! @(!X @! p'9l  !@@!<W4P3  !@!<L4Bph p'9c0 @ !2 ! p $('9f h p'9e @ !@ @!<<<$ $$Ɉ $ $( @p$T'9g (! !@! !@<840'H<' p!'د X ! !@ @ !B$B,B@&1  p'9|$ @!DޠD| !! '(<' !'tplhd`\XTP Hu!'H ! @! !D! $T`@!H @b  ! Fh@@$B,B@/ & @ !Ҩ $. @!h@@ dT@0!P(!&'  @!(!<8!@$dT  @!$."$B  ! @@!@@PȎdT`8! (! @@!D$cb|!b|  ! @@!H@F(!x'( $  ! ! @! @@!$hb @(!'(p'9m| 0! @!  ! @@! 0@  'HpPDT$r '( @! '(  e !H@aD 'H @!'Dsx!$U`H@Q!  !H @6h`1p&  ! @ !Ҩ $. @! !h @ T@0!P(!&G  @!(!<8!@$T  @!$.Bs$B@ή P(T8! (! @@!'b|!b|  !  !tplhd`\XTP`!'x<'!'Я($ D'&0x| |@ !ޠ xޠ @!!&2 $&&"ޠDx $P2 (!& ($ '0<'!'ȯ0,($ hD !@!&Px!@(!  !@  `(!@0!Dx $|@!&tDx $@! ` !!0,($ '8<'\!'Я,($  ! @!`s!rB@jB @f  Dh @!Dh @! !0!(@8! $@5@!h @ ! @ !@!$B,B@#.B  !H @ !@@! ! @ !@ !$0 (!.B@ DޠD| (B@ & $  !s,($ '0<'$!'د  X @! !@@!B@(!p$T'9g   ! !   &$ce` ! @ !@ !t@ $  .@!   &$ceP ! @ !@ !t@ $  .@ '(<'L!'௿DB|@$p'9|$ *`!' <'!'<8x'(! $(!D$ (!0Dtܐ8$BH 0!@! @/$8@ `DE` C` b!C`P`D8 !P+ @$E`8@ ! `8! Dt8 (! $ @$B`$8C!B`XTPLHD@!'`<' !'xtplhd` \!p$!'P'LTH ! Dtp (! @$Dtt@(!'T8!  DpT(! '(@! @$\Dp (! Dp@ (! $Q\ (! Eb*: @! !&&Dp (! $FB&d(! 8!\E q # @x$`DtT(! 8!@! @n$Dp(! `0! Dp(!`0! @! @$!$ Dtt (!0! 'X $,XX0@ !  0!?ȎD'H0! $! @9$D @!$ $ Dtt (!0! '\ $,\\0 0! @ ! @$D @ !x S(# 0@ !, `(! @$$xtplhd``!'<'t!'x|xtplhd`(!\pPXT\!!Q` !@!$( !l'P@(! 0! 'T(@$T"!Dp (!@!( $P\Dp (!@!(@$P@'X&f&'T <\$B$'X(! 8!(@w$l@(! 0! 'T(@m$XP!$BXX$FT"!f+@Q`P@[$x'0(! $ (Dt(!ܐ0! $(@!$؎Dp(! '0(@A$$ !Dtܐ8(! 0!(@!P@'T8x4H@ ! 8!(@%$#!٠$'\0! 8!(@$T"! Q`8x4H@ ! 8!(@$\"!B`!|xtplhd``!'<'!$,@$<$cC!B\!@$$$`!(!(`$( $(`$<D *$$$ (@!@! 8!$FD !!C$B*@@!!`!<'!'XTPLHD@<8|$!CpV0, ! !dp@(!\'$'( @!$ @(!dp ',@!$ ,<$W|dt0 (! 8!dt'0t (!0!8! d 0Q*@$t'9   !A@!b8 (!$0!8! 0d(!0$\dp @(!$C0(C*@$b*@ e $$(,e !0(P `q*@$"*@` $b8 (!0! 8!$(*@$b8  (!,$t'9  @! ((b@$b$D*@ Ȏd' 0! $@T$0d(!8!00t, !'9 p 0!$b*` (!0d08! 2@! /!!, 0!H* (!8!!E!Db*$*@!*@0!*@$ & $Ƹf (!*@P!$XTPLHD@<8`!'`<'{T!'lhd`\XTPLH $|!px8<40!W ! p`(!\'(', @!$ "`(!p '0 @!$ 0<$Vt'9   ! p@!\ `(! A.$`٠$'4'80!8!  `84(!` ! 0! 8! @$$x 0!tܐ `8!@(! @$`!Q!®`Q'@ !, $.@!@R# @ !@!܎  (!  (!@!@@(! E @!@0!T8! @`  !܎  (!@@!b&r !0,($ '8<'(x!'840,(!!!<$t'9a A2@܎D @(!`@!Bb ' @$ D' 8!  ' @ @!$` "$bA$bb$" @!840,('@<''4!'د$ ! '+$ '(<'&!'ȯ40,($ t!!'9aH !@7@!܎$ @(!@!B@.$$ $' 8!  ' @ @!$BA&"P'  Ï@(!' P+@ $  ! 0!+@!@`!q40,($ `!'8<'%!'د$ !$t'9d $ '(<'%4!'د$ ! $t8'9d $ '(<'$!'D@<840,($ !!!!$h$  @!@@!t@(!'9a  !@!$$$P $0! (!@!@@(!$ U&܎$ (!E$ @!$S+ !(! 0!@8! !F$ !!  !(! $FF$(! 8!$.$(! Ӱ#U@! !D@<840,($ 'H<'"!'PLHD@<840!!!!$t'9a @@!B@$a $( , @(!A#@!,@ ! $.@R# @ !@!H 8!(! @0!  @(! ' @!B@l@ !, $.@!@R#H 8! (!`(!ܯ  ' +@! @ !@!܎  `(!@@0!@! `(!E @!@0!Q 8! @܎`(! &A@ !, $.@!@R# @ !@!H 8!(! @0! `(! ' @!܎ `(!@@!$0B@ d   Vd   (!   0h 8!!PLHD@<840'X<'!'Я($ !! !(! ' '  ! (!@8! $($ '0<'(!'Я($ !!0$t'9a @! '$܎D  (!@@!E dD dD D (!0! 8!A$@`!($ '0<'!<($X!$|P!@$ |CKBDEFGHI!`!<'!'௿ ! @(!!' <'X!'௿<$ $|,B' !@d!@d!<'!'Я($ 0!! !8!(! @0!(Q!$ '0<'!'د ! ! ! Q!'(<'$!'د !!@ !G!$B+ `(!!0!@$ "!P!" `!'(<'!'`\XTPLHD@x|!!!+!@e@ !t' $QpP ! $ @ !u*'$@$VP ! @ !'( ! $$@ ! ! ',$,4(`(! ! 8,@0!t@ !0$po! (!4@ !8 8@0!@ !(!! <<܏ '0 @!`(! !`0!! @! `(!&@ !(!0!b8!t'9q4 P+`\XTPLHD@'h<'!'ȯ40,( ! !"#& $ !!! !(!t 0!@8!'$'9q4 40,(!'8<'!'d`\XTPLHD@(!!!!x@ ! `(!x@!(0B !+4 8( '9 $@5@!R#@20#p!!'$ $(! @@ ! (!@<  !@ @ !$H$ !(!'$$  @ !R'!܌E  !@!* ! (!@! ! (!(!  !@! !@@(! E ! @!0!@8!R !% @!@ !܎ ! 'd  !d  ! S!E ! '!b!$L'(!YD $@*(!$LDY !$D$@$<$8$4$0$,$($$$ `!'$H<'!$$B},b!!b<'!$$B},b!!b<'!'HD@<840,( D!! ! @@!*@! !bt0W  ! @@8!<$G, !$ (! p!x 2 @@8!<$GB0DQ(# $!BS!B< ! $d"! 0B@ 8!B0BC!BS!GB0B@ !B0BC!BS!Cg+`@Q(#< ! $<$  ! "!c0B@B0BC!BS!E ! 0!@8!B @ !<Q(# $쏼 "!b0B@ &8X !Q0#$M$ &12+ @% !&,B@!4 #c0B@ $B0BC!BS!RD ! @(! @ 4#L !@(! 0! 8#  !4 #HD@<840,(!'P<'!'௿! $  ! @(!$' <'!'௿D $ @B0B$' <'@!'௿D @(!$$B0c0B@d!bE!F!' <'!'௿D !@ !$0B$B0B@C!bD!E!' <'!'௿D @$B0C`!' <'!'௿D ,B#' <'!'د D! !@ !:$0B@ (!B0BC!BD!E B0B@ (!B0BC!BD!E%B0B@ B0BC!BD!B@!$`! '(<'P! $<'(!'Я($ !' !@(!  $ !X  0! ($ '0<'!'Я($ !! '@@(!A $  !X  0!($ '0<'!'lhd`\X!' !i$ D `^$X ! $,D @ !@!, ! $.@@!@"@C  !@ (!D(! @ !C@ !0B@1$B0BC!BD!P'&q$ @ !@@!@(!D @ !F'P(! 8! @ !@! DP @ !@@!!@$&q`!lhd`\X'p<'!'P!y!x! @0! !$  '@j!x(! $  !,P $.X@ @!Q# (!' &!&R@ (!' $t'  !%  !"@ @(!  ! @(! ! 0!$ @(!b@bA   @(!!`!'<'!'Я($ !!$ '@$    !X@(!  0!($ '0<'$!'௿D @$C`!' <'!'Я($ !'!$ @$bbbB0B ($ `!'0<'4!'௿$ $C@ !,d !' <'!E(! $*@ !b!bF*@ !b$b!` !$b!*@!b!b$b!$b`!B(!+@!$!`! $*@C!B0!! 0!*@C!$F!! *@E!B$BE!$C`!<'!'Я(!$'  $c$fe  @$F(!'0<'X!'Я(df$ (!'  $@$C(`!'0<'!'௿0! ! !t@(! ' (BE!B<'!'௿ ! !@(!0! ' *@$$D!B(!D!*@bG%@%E!*@$ <'x!'Я($ !'!$ @#@(!$B0B 0B0B0B0c`($ !'0<'!'Я($ !(!!'$ @#@(!$B0B 0B0B0B0c`($ !'0<'!'840,(D!!!!"$ F' (!`8! @ !@@!D @ !  0C#C#BB0B" !840,('@<'!'840,(D!!!!7$ F'  (!@ ! `8!@!D@&@ !  @ !B$B0B 0B0B0B0c` !840,('@<'x!'د  '@$B0C `!'(<'!'௿D @$B$C`!' <'!'௿D @$C`!' <'!'௿ 0!@0$BH' <'4!'Я($ D!@D !@ !6$0B@ (!B0BC!BD!E B0B@ (!B0BC!BD!E%@0BB`!0Bb!($ '0<'!'د  '@$B0C `!'(<'!'௿!$ D  CB$!' <'(!'௿!$D $ CDB$' <'!'د$ !$( ' @$$CB$ !'(<'8!'௿!$D D<?4c $CB8!!' <'߰!'௿!$D D<?4c $CB8!!' <'(!'<840D!! !F $($E'  $@$C<840`!'@$<'ހ!'840,($ !!!!b0!D @!@D  !@!D !  (! !@(!D @!@8!@0!E0c0Bb0c0Bb0B@ B0BC!BP!F0B@B0BC!BG!B0!B0!B0B@ 0!B0BC!BP!FB0B@B0BC!BG!B|0!x0!0B@ $B0BC!BP!F0B@ B0BC!BG!B$Z0!0B@ $B0BC!BP!F0B@ B0BC!BG!B$ (!:0! !$ '@(! !$' @!@!@'$ (! !'b&R8B@B0c0B0b1 `(! !' @!@!R*@$840,($ !'@<'d!'௿$ ,E@ !$C<4Bb$$@ !!' <'!'د D! !@@(!BB0c0B@d!b !E!B0!@@(!  '( !'(<'@!'د !! ! @Q ! '(<'!'௿!$ ' E&,B$,B <'d!'௿!$ ' <'!'د !!!<@ @0!#" eD @! ! `!'(<'ׄ!'௿d!@@(!d !' <',!'௿Ȑ!$ p & d d &  !!' <'|!'Я($  !@0!$L' !(!$Lx@E!  <<Ȍ$$  $<<Ȍ$$ $ (!< $, $b󼏅 ` ! 0!`@b  !! @ !兀D ($ `!'0<'!'௿Ġ!$ ' <'Ԡ!Ȑ $<'t! $<'H! $<'!'Я($ !!@$``'0! '@ @ ! !C#"!($ '0<'d!'௿!$ ' <'!'௿!$ ' <'!'௿!$ ' <'t!'د$ T! !A$$p@(! ! R !Ű@!@(! !$ '(<'!'௿!$ ' <'ф!'ȯ0,($+!! `$!! D$Fx$B'   0,('8<'!'ȯ0,($+!! `$!! 0 D$Fx$B'   0,('8<'<!'௿x' $ƴL! $ ' <'!@ !<4B$` !  (!@M< (!  !@F<B0B@0B/0C<4cb4C $<4c($8++0!ް!@!b@c b!&$!b@c b! &@!@ *2BB0B@0c`B<B0C`B0B@ 0B@(!(!`$$(!<840,($ !'@<'E!'ȯ40,($ !!!!!L$<`$@ !<4S ($@>$ @ !$D&d +b8!,$<`P!4IB0B@% ($B4+@0!B@C b0!B0B@i$! "#!$B$%*@B !40,($ '8<'C!'ȯ40,($ !!! ! !'8 $P@@! $ @!xbst$c  8!@(!0!` !@!` !0!(!!  !40,($ '84+@ $@ b!@F8!!4+@ $@ b!@F8!!!4+@@ b!`$b !4+@ @ b!@B$4+@ $@ b!@F!$4+@ @ b!@F!<'AX!'د !!$ $@ !@(! @!! `!'(<'@!'د $ 8! 0! '(<'@! <'@!´ <'@h! <'@L!t <'@0! $"$4+@@ b!`$$*g@!!$+@*@!@ b!g!4+@$@ b!`$b@(!@0!E+@!@ b!bA!<'>!'Я,($ 4!!+@!@ b!`!$h !@ @ !4+@@ b!x !(! 0!'9H $@@!@Bb,($ `!'04+@$ @ b!`$g !+(!%)@!@ b!g !+$ !8!$4+@@ b!`$f !+$@!@ b!f<'<!'د$ !!!$ (!A@!@!(!  !(!A ! A@!$$ `!'(<';!'د$ !!$ !@@0! ! @(!&&$ '(<';p!'840,($ X!!!PT@%!$ ` ! @!$ @ !` !(! @!*$` ! (!@ ! (! @0!` !(! @!A! @ ! (!@(!@ !! 0!@{$y!! qt! @ ! (!@(!0!! @ !@e@!` !  (!@` !@(! @!J  (!@(!@ ! @!` ! (! @!6%@! (! ` !(!@ ! @! 0@!4 (! ` ! (!A` ! (!@ ! @! 4(! @ !` ! (! @!(!@ ! @0!@!!!$840,($ `!'@<'7!x$'9H $<'7!'௿4@!$+@(!@ b! 0!x'9H @@8!!' <'7<!'௿4+@$@ b! (!x'9H @@8!!' <'6!'Я( @xD'9P`$  ('0<'6d!'840,($ !!!PT@(!$ !@@! !@(!@8!  0!(!@ ! !840,($ '@<'5!'<840,($ !!!PG!r$pn  ! @!a$ ! (! !(! @!S$!!@(!  ! !`(! @!@(! ! `(! ! @!T !! @(!@,$ `(! ! @! ! @! !(! $F@$@0! ! (!`0! !(! @!@@!A$<840,($ `!'@<'3,!'ȯ40,($ !!!!~$$$f4+@s$c@e !@F+@ C!@ +@!@Z$ (!RS$` ! (!@-@!` ! @(!U@!` ! (!` ! (!x@0!'9H  !(! ` !@!(!U` ! (!` !(!x@0!'9I( ` ! (!@$ ` ! @(!` !@(!x0!'9H菙x(!0!'9I( $40,($ `!'8<'0!'Я,($ !!0!!U$4+@P@ b!I$AE  & @>$/ ! (!S(!x !'9H@!<4R(!  !S&R@@!$@`(!  ! !(!x@0!'9I(  $ !(!,($  '0,($ `!'0<'/!'ȯ40,($ !!!!!q$ <$B4cb+`f$@ ! `(!@_$B4b+@ZB@C bb!@SP;9@ ! (!<$B4cb+`B$B4+@=B@C b! 6"A@!!"A@!0$0!@ !! &% @@! (! @ !A$x@ !`(!'9H $0!@ !x`(!'9[ 8!@$$$40,($ !'8<',!'ȯ40,($ !!!!HLi$geĠ  !`(!Ġ @!W$ ! @(! !@(!0! 8!$C$4d+@!"@# bb!D+@!"@# Bb! ! $F&  & (!"4+ !@!"@# b! r@0!$$x !`(!40,($ 0!8!'9[ '840,($ `!'8<'*!'<840,($ !!!!PT*$(%  !(!h@$ @!@0!x8! !$R_(!@!  !`(!0!@8!@! A!$<840,($ `!'@<')!'LHD@<840,( !!!`dh\!w$us  ! @! f$@ ! (! @ !@(!`0!  8! A4+@!@ b!B4+@I$B@C b!%#`  0!@ !`! & @! @6$@ ! & & $F   !   0!(!! @ !@! @ $$(!  ! @@!x@ !(!'9P`@8!0!  (!@ ! !LHD@<840,(`!'P<''!'Я,($ !!!!!$ @@(! !0! `8! !@(! @!@!,($ '0<'&H!'ȯ40,($ h!!! !@!`@!?$D4+@:$B@C b!2!+(!B4!+@!B@C b!! & @3*&13*@+!@!B@C b! V3*&13*@3!$40,($ '8<'$!'<840,($ h!!! !@!!!&!$4 !(!"+@!@ "b!& ! @ W&s 0! ! (!@! u*@u@!$<840,($ '@<'#!'<840,($ !!!!!P!&!$4 !(!"+@!@ "b!& ! @ W&s 0! ! (!@! u*@u@!$<840,($ '@<'"X!'Я($ !!2!&!. (!@ ! <$B4cb+(!` ! (!A  ! @(!@0!`!  !@!&  !*(!@ !($ '0<'!@!'D@<840,( !!!X\`#!!  0! `3*@(! @ ! @@!x@(!&"@ !`0!8!'9j  (! @ !D@<840,($'H<' 8!'840,( !!! ! TPx ! (!@0!'9j  840,('@<'!'د$ !!! (!@ !@& A&1 @ ! *(!@@ !$"&$$ !'(<'! <'! <'! <'!'Я($ #!! !(! 8! !0!(!x@ $$ 32 !($ `!'0'ȯ0,($ !@!!B (!$S!&1'@ &s<4( @ 0,B"+@$B !0,($ '8<'(!'<840,($ !!!!! !Cb@$c<&1$+@$+@7$CQ#xb! !(! $<$X(!(PX&4T$ 8(!&X $ \$QB @`!4( (!$ '@!@@!0,`!<840,($ `!'@e#b!b@$` !!<'h!'诿 !@!!U!B@`(!D(Y4$ 'D(Y4`(!$' @!D(Y4`(!$' @!G,C0<`@!' !&F$  C# "!<` ! $0"!<$b8M DEFGHIJKL c8B $#%&'()*+, " - &1   !<` $0"!<$b8M DEFGHIJKL c8B $#%&'()*+, " - &1   !<` $0"!<$b8M DEFGHIJKL c8B $#%&'()*+, " - &1 <` !$0 @0!&sb+@Z&< !'<'P!'د !+@!e#b!b@+&+@$c<+@$P#X(! !$ $(&0! `!'(<'!'<840,($ !D!!P$@!!DQ!&@3&1< @/&R&R !X& $(.@$ @(!!`! ,(40! 8!@!4(@(!$ 8!@ @!0C#&RU+@`!<840,($ '@<'!'د$ !@!!"R!b@ &R!NT$p  ! b l @ !@ ! @! @ ! ! `(!'@(!9 ! $T  !l @ !Y !@(! $@ !@ !  @ !P  !$40,($ '8<' !'D@<840,(ݠ!! ! !@! $ !ќ @!@!T  !l @ !@!$" ."@$$"B$"G$|瘎`(! $g @3@!8$V ! @(!@ (!`$ 8! (!\$'  @! d@V`(!  ! ! @(!A]@@ ! (!\ !@(!0! $ST  ! !@(!8 @!@D  !@ ! @(!A0B@@0@B@$@`%$ 8!A ! @(!$b$b BU  !@P  !! !(! $@!BU  !@P  !!D@<840,('H<'D!'@<840,(! !! !@ !@!ݠ $@ !ќ @!@!T  !l @ !@!$" ."@$$"A"F|瘎(! $g(@2@!8$U ! @(!@ (!`$ 8! (!\$'  @! d@U`(!  ! ! @(!A- !@@ (!P`0! !@(! $GT  ! !@(!8 @!@D  !@ ! @(!@P  !7!B@@B@$@`%$ 8!A ! @(!$b $b  ! @(! !(! $ !P @!!@<840,('H<'!餏 <'!'௿ @ !(!x$ @!$ !' <',!'840,( T! ! l @ ! ` ! @!  )@!B@@ ! D@(!&$  @q#q! @`0!` !<;4B"D$  840,(!'@<'!'D@<840,(! !! !@ !ݠ @!@ !ќ @!@T ` !l @ !@!$"=."@$$"` !"x(! $,  !@p (!@(!\$* ' @  ` ! !@(!0! $c $ bQ p` !|瘎(! $g0@2@!8$V ! @(!@ (!`$ 8! (!\$'$ @!$d@V(!  ! ! @(!Ao !@@ (! !@(!0! $#` !T ` ! !@(!8 @!@D  !@ ! @(!ABB@` !@@(! $,(! $BU  !@B@$@`%$ 8!A ! @(!$b $b BU  !@P ` !D@<840,(!'H<'ڀ!'8 T! $ @ !l !C vZ@!`R$b$bE` !m@!` ! !D @!!! @ (! 0! $ @#$T` !$ 0! ' @ $ $ԯ$ 8! $$$ 8!  '0į(` ! ' @Q$T` !$D0! 8! Aɸ G` !p$D 0! T$'(,` !$0! 8! @+$(b($,,C`@!$$$$ 8!  0' 0! $ $$(0!b '0 @!$ ,$8!$ $ $,&T'(0!` !8! $ A&T'h` !$F0! 8! A$T` !0! 8! A $LT` !0! 8! @ $$ԯ$$ 8! $,!!$  $,T0!$8! ` ! 8!&$$A&!$,!$  $,T0!$8! ` ! 8!&$$ A&T` !$0! 8! @ $$ԯ$ 8! Ԏ$4p$8!$  $ $ @@!$" $ /!` !(!$(!$ #@!D @! ` ! $E @! !`<;4c$$ 0! @!'<'!'ȯ0,($ T! !l @ !@ ! @!C @!$b,$@@ ! $@(!0!$  @@ ! @$$8!  @ !0,($ !'8<'!'ȯ0,($ T! !l @ !` ! @!C @!,b@$`$@b> !< !  D@(!0! $@@!  @@!$    !0,($ !'8<'!'د T !l @ ! ! @! ! @(! !'('௿!8! 0!$$e !' <'(!'د $!!!$$b $  ! !@0!$   ! !'(<'|!'Hx' !$ ! (!L< &0 0!$8&D$8  !@!< $&D&eD,t$ @$ $ &D&eD*,@< (! B@! BDӴE8! 0! D`0!@(! @! D (!ܐ$; 8! (@!$b"@W!B瘎D'@@(!  0! @@!(D 0!`(!8!  D@(! 0! &@W!C$ܐD`(!$+8$  D`(!ܐ$g8!  D(!`$# 8! @@!Dܐ`(!$#8!  D@(!8! 0! `D(!$!\ 8! @@!Dܐ`(!$!\8!  D@(!8! 0! D$ (!|瘎D$g (! @  ` ! D'P|PP@(!$g 8! @ P@ @ !'9D $ |$ 0!P@ !$@ B , ` ! @t|瘎DP$g (! @$8B@ ! (! @'9ʈ @ !NɸD @ ! $T|瘎D$g (! @S$D)Pb3$c,b@$<$cC!B\!@$$ $$0$`@)PD#D!$c)P@!<;4BD`$l@0!  @!C(<8,t)P$ $&&%D $ &&%DĎ< @(!|)$gȏ` (! $#' @`|@(! $0C ` \8$@ԯ'X$0! 8!Ď8 @(!|$g $ @(! Ď8 @(!| $g؏ $ @(! 8 $0 8 A'9\  ! ,($ !'0<'`!'840,(P! !, @ $$0B@$ ! (!$. @$ $!! @ !l @ !@ ! @!$@0! ! @! @ !`(!| $g@V@!8 ! (!d@  (!  !(!  ! !Ј  @ !<  <  !Ј  ! ! (!@@! @ ! !'9D  (!A}$ \  ! ! (!|瘎$g `(!@  @ !@ !, `(!P @ !@Qɸ @ ! $'94  !; @ !l @ !@ ! @! !@0! $D' @ !$$ 8! @ $ԯ@ !$$8 8! @ ! @ !$$840,(`!'@<'! $p<'!'௿ɸ !(!@ ! ' <'|!'Я($ l !@! M$Ј !&,H&0$  !(! X @(! 4 `(!ɸ  !$ @ !$'9D  !@!A&(  @(! `(! !($ '0<'!'Я($ l !@! M$Ј !&,H&0$  !(!  @(! 4 `(!ɸ  !$ @ !$'9D  !@!A&(  @(! `(! !($ '0<'T!'ȯ0,(l! !%$@(!' @ $ D @!$$@8!  @@!  @!  !0,(`!'8<'p!'ȯ0,(l! !@ !)$'(!$@' $ b$ @@!$%8!@$    $  @@!!0,('8<'|!'௿l !$@C`!' <' !'௿ D ' <'!'௿ 0+@!$b$$b !a$!' <'t!'@<840,(T!! !@!&B,Bp@ !$B $B$bBb@$|P !$g(!'  g8 !|($h(! @! $ bA&b|($h ! (! $$B$B$bBb0B@ &b$ܐ ! (!$` $bh@${ܐ (! !$8! gh !@(! 0!${B$B` ! (!` !(! 0!@<840,('H<'H!'Я,($ T!! !@!BT@@ ! @ ! @!9T@ !@(! 0!@ ! (!@ !(! $@!$b !`$b`` !`,($ !'0<'4!'ȯ0,($ T!!! !@!B@ !  ! @!Y@ ! (! `0! ! (!  !`(!0!0,($  '8<'L!'د ќ! !P@  ! 4"  !'(<'!'Я($ ! !@!$!`"8!Ӵ@0! @@!h@0!@@(! ` !  (! (!$ ,P$!($ '0<'!'Я($ ! !@!%!`#8!Ӵ@0! @@!h@0!@@(! @` !  (! (!$ ,P$!($ '0<'!'Я($ ! !@!B@!!Ӵ8!@0! @!@0!h@@(! ` !  (! (!$ ,P$!($ '0<'!'\XTPLH! !@!BB@F0!Ӵ 8!Ӵ0!8! @!@+@!@)` !$ '@"@(!h '` !$ '@ (!h '` ! (!@0! 8!@(!  0!$ @(!쏙$  (!\XTPLH!'`<'h!'XTPLH! !D@!B@@0!Ӵ$% 8!$%Ӵ0!8! @!@%@!@#` !$ '@@(!h$ '` !$ '@h$(! '9` !(!@0! 8!$$ @(!$쏙$ (!9  ` !߸ ` !XTPLH!'`<'!'HD@<840,( !!`dh ! @!@ !h $ (0!@8!@ (!$  !l(8!(!  0!  @:쏙$(+$  8!!  ! (! 0! @!$!HD@<840,('P<'\!'LHD@<840,( !`dhl ! @!$ (!9   !`(! 0! @i$@ќ @ ! @`$ ! `(! @.@!$"T@ @ ! @ ! @!9T@ !@(! `0! @ ! (! @, @ ! @P @ ! -$"0@ 0!90(! !@0! `8!$쏙د8! `(! @ $&$(! `8! !$P @ ! !!LHD@<840,('P<'!'hd`\XT! !@ !ќQ @!@k$ ! `(!@!$b$bGX| !$h `(!t !@(!'P8! @!B0B@$(!` !$8  8!@@(!P$b$| ! ' @ !' $ '8(B@ $BC$L0cC%Bd @ !@ ! `(!` @ !@  @ !@ !  `(!P @ !!hd`\X`!'p<'!'ȯ0,($ T !!!H !@ !h @!ќ @ !@b$9,  !@(!0! `8!@T @ !P$"P@ @ !@ ! @!9P@ !@(! 0!@ ! (!, @ !@$B4@"4@ @ !94` ! @!@ ! (!S4, @ !@(! @ !P @ !!0,($ `!'8<'!'௿$!4ќ@ ! d@ !  @ !P  !!' :@$9:D!$C;0B@@ ! $$$`!<'!'د  !@!<4BHb$<b% !  ! 䏱 '(<'!'௿x$$H !$ :@DTHl49' <'!'௿T! !! @!0@@ (!b@ 0`$ b0!$!' <'!'௿$P ! !8 !`! !@! !' <'!'D@<8 T ! ED쏙\$@!$0($<'(, ( @C#\C!$B'( ( `@C#C!((\$', , @C#\C!$B'0, 0 @C#C!\0$B '4 @ 4@C#C!,d ! 4( ,4t@ !0@8!$  <̼ &%" 0B @ ̼< &%$"$ߏ C$"  !<4cÏ  !e!b#C#(#$ %8؏ @"8"<"p4B@ (!&& " ' !p 8!pd8!$'0! d'9@ E !`$%h 8!d'p?$@0! d$Hp0!8! d$Jp0!8! d$Ip0!$ E !`$ % 8!d'p(B8$G 0!Y   !D8e  !|xtp!'<'|!'د$ T !@!B@ !  ! @!Y&@ (! @ ! !(!$  '($ '(<'| !'د$ T!! !$ќ@ ! d@ ! @ ! @(! !P @! !$ `!'(<'{X!'د$ T!! $$ќ@ ! d@ ! @ ! @(! !P @! !$ `!'(<'z!'د$ T!! $$ќ@ ! d@ ! @ ! @(! !P @! !$ `!'(<'y!'د$ T !@!@$ ќ@ ! $@!, @ !9, $8 @(!9$ $8 @(!ET $4 @TD< @ @ !EX$$ $BX @ !"@ @ ! @ !B4@"4@ @ !D494 @!@ ! (!d @ !  @ ! ! @!" !$B "$ &EH @ !P @ !!$ '(<'w!'Я,($ :!!$B0C!!`:# $b$By$# 3B82 $b  ! !$B T  ! !@!@ќ  !@ &%H  !d  !P  ! @$  ! ! @!  (!@ !@0! `8! ! (!B  !,  !@  ! @ ! !@(!X 0!":$B0C`":%90Q!d;$$s@!0<ff$B4cfgCB !D#"9":@d,($ '0<'t4!'د$ T!! !:@ !0&,<ff`A4Gfg9$e!$cg'CD(#E!b(#$g'CD #D!b #!b;R(!b@Q#@:;9<ff4Bfg$cb (!@0! 8!HB I!bH#0!Q@R;Q $ '9 '($ '(<'r!'<840,(T !# @!$btb@C$T ' $$ !$"0! ' A  (b@C!@T' !$%0! '$A$$(b@C!@  ! ! @!@ !$@0!8!y  (! ! (!,  !@$# b$b#,b@ < !$cC!F'9 $,  !@ $ <840,('@<'p!'ȯ0,(!0b@@H$$b$$ $T$0!'   !T$0! '$ $$ $b$!$$$$" $C,b @p0b`@0b@0b @  "0B@@$$ !0!'9 $0,('8<'o!'840,(T! $ !d @!@!;$ќ 8 ! '  !T$@@.0!   $ @ '    !$$ @ !l @! !'9P $P  !`!840,('@<'m!'Я,($ T! !@!$*$ќ`' ! @@$ b!$d @8!$p0! !   ! !P @! !,($ '0<'l!'Я($ T !@ !h @!ќ  !L@0&H$ 8!$T0! ! $f$p0!A ! d  !$@ ! $ !'9P $P  !($ !'0<'kl!'ȯ40,( T !! ! @@!$B?ќ  ! @$ b*$+C`%$ 8! @`  ! @`  ! @d  ! @ !$ $  !'9P $ <4cPC$4BXќ  ! @T$ bK0B@E  ! $ &H ,  ! @2$ b.0B@ !$`!$#00!#``!<4BB@b`$$#00! H<4cC$<C%P  ! 40,(!'8<'h!'د T !@ !h @!ќ  !L@&%H d  !$@ ! $ !'9P $P  ! !'(<'g!'د$ T !#@!0b@@&0f4b !$B0@  ! @!Y0@ !  (! ! (! !'9P "$!$ '(<'f!'௿d0B@@ ! @ !$ $ !4B'9P $!' <'f!'TPp0!0B@ !$ $@'!`! T  !' h @ !'  !p$0!8! d  !@ ! $ TP!'X<'e!'د T ! !ќ @! &%H  ! !$B  !$'9 $,  !L@ ! P !  '(<'d!'840T$(' 0!$$ '( ! '(0!(!@$ @  ! @8!p0!$$  !d  !@ ! $@!@ !'9& !840'@<'b!'د T! !ED쏙`$< 8!A$d0B@ ! @ !l $  ! b !'9' @! ! '(<'b!'lhd`\Xќ !! !@"$$T  ! !$, @!@(!|(8!$h0 @! !T$0!8! @!A(' x@ !(!$0 P$(! 'PP$ @0!쏙ܐ`(!$?8! @(!h @0!'P ! @(!@ `(!쏙ܐ@8! $!\|쏙($h@(! 8!@!"#@0B@!4C*@$$ܐ`(! $(#@4C*@9<b$b4MGÏܐ`(!$:$8;8#&$`8!4C*@<$4BC*@<$4BC*@< $4BpC*@<$4BLC*@$ܐ`(!$(  !(!'9 0!,  !@Vd  !@ ! (!@ !'9P $  ?8  (!8" $B,B@4  !@!"A$&8 ! (! !8 $ !T$H0! 'TT@ ! (! !$ 0!<  !P  !!lhd`\X`!'p<']!'hd`\XTP T! '@! 0B@8@T` !(!$ 8! @@!xd4(! 0!T @$T$ !$K0!'HH  $  'HX \d '(d 'Xd '(@! $ %(!'('X  H S@!(!$ 8!@! @L@!d4 (! d4@'@! @(! @(@!B0B@#hd40!  (! 0!@8!&@ $ $@! x(! 0!T @$0b@ 0b@ !$ '9 0!'9  ! !hd`\XTP`!'p<'Y!'\XTPT !@!0b@Y4bܔ$r$  !$CPLL#0@@?0b@DB0B@' T !$0! 8!@p!#$pb 0! !$K 8!&" !p$L$ !$K  !h ' ' p !$0! 8!4B0B@0B@$4BD0B@@) !T !$D0! 8!A$:ď`$% 8!$@(!`$D 8!@8!p !$D 0!%  ! !  \XTP'`<'Wd!'xtplh T! $@!$  `$ќ  ! @`!\$-2'X  \$-< '\ AX\\C*@$#0B@$0b@@ !T$0! 8!! A !T !$0! 8! @$T !$L0! 8!' @ @ !p$K0!$@  !p$K0!8! @( !T$0! 8! A@'(x@ !(! $0 $4쯠@(!0! 8! @$p !$0! 8! 'p0:B !$B 0!" 0B@ !p$C0! 8! `J$<Ϗ` 8! '`t@(!0!8! ` @C#C!` &%H` `!<4BB@b`$ 0!  ߜ"H  ! @@!#<4Bb$<b%#  !  !$B  P  ! `!xtplh'<'S4!'TPLHD@<840T !D&%H @!# $b !"#$4D@$$b!0@@$T !$!0!'  !$HT0!'  !$@T0!'  !$GT0!'  !$JT0!'   !T$I0! '$#$b X  !D@(!|P$hL 8!@@!ӴD(!0! 8!D0!@(! @!$<  ` ! $ !$ $@ !$ $  ! !T$E0! '(@(!ӴD0!( 8!D8!@(!0! @!T !$(0! '(@(!ӴD0!( 8!D8!@(!0! @!T'  !$0! 8!A(T'X'P$T !$0! 8!AT ! $@ !T$D0!'( D(!Ӵ0!( 8!D8!@(!0! @!   !DE| $h\A@!|(DE$hd8! D@(!ܐ$-8! @!D(!ܐ$H> 8!p8! !$' 0!` !p$E0!`8! D쏙$ `(!p !$(0!8! D쏙$ (!(@ p !$0! $0T@ p !$0! $@$Dp !0!8! D쏙$ (!   !@!B쏼@$b%T D4 Td  !  @ !'9@  ! !p$!0!  !p$H0!  !p$@0!  !p$G0!   !p$J0! $p !$I 0!#<4Bb$<4Bb$#$ (! @ !B@ !$B B$" \  !A @ !B@ !$B B$'9 0!TPLHD@<840!'X<'J!'௿d !$@ ! $ !'9P $t  !!' <'J!'د$ T! ! !, @!@%"@ 0B@ ! @!"@ 0B@ !A  t !$  '($ '(<'I!'|xtplhd`\XT!! !@!b0B@$Z"$Zd &eH$Z$$c b$ ":."@$n$"."@$$2$"c` !y$4$"r` !"Z."o@${$6$b"` !i$"$}"6` !c$bB0B@d ` !@ !l $b$C$b, ` !@$T(` !$!0! '((@(!8 ` !, ` !@2ߜ ` !@+b0B@&$ c b"` !pT ` !P(!| ! $hl !@(!`$8! @!@8!` !p$(0! ` !$'9 0!,T` !$!0! ',,@ (!T ` !` ! @!(!| !$h| @! !@(!`$8! @!@8!$(p0!` ! '9& ` !, ` !@$T0` !$!0! '00@ (! ` !, ` !@b T ` !` ! $@ ! T ` !P$| !$h(! 4 !@(!`$ 8!@8!` !p$(0! '4 !|P(!$h 8!4@!$b` !$'9 0!T8` !$!0! '88@H(! ` !@A` !ld ` !0(!T ` !P)@!B$@* !`(!$.H 8!8! !`@(! $@@(!'    ! ` !` ! @!9$@ !`(!' BX@ ` !` ! @!9X@ ! `(!` !(! T $R@!|$D$$h@ !(! @@ !@(!`$&N 8!$ 8!`@ !@(! @!(!'p@ ! <T` !$!0!'< @!<!@!` ! (!@ ` !, ` !@$c b @ !|P(!$h '@@ ` !` ! @!@ !0!`(! 'D` ! (!D@sq, ` !@j$<@bd!(b<@$=$b^b+Z` ! $@!  0!4` ! $&1b0B@@` ! $@!  0!4` ! $&1b!$4B b4` !$ 0!` !$4 0!@$=b$x 8!@$ ` !` ! @!94@ !8!`(! 'A"(@0 ` !` ! @!9(@ !0!`(! +T ` !@!BD@ ` !` ! @!9D@ !$'9P |xtplhd`\X!'<'5!'د `! !@$$ b $"# $b$ b !$ $$B,B@  !$$ '9 '( '(<'5!'H ȏ'p! !!(!`0!̏ЎT !! @$ $E\8! ! $P  $(F"`E$[8!  !  !p @(! t@(! 0! ! 8! D4 `(! @@!D4 @(! @ @!B0B@(!hD4 `0! ~$\DE$-2'`  DE\$-< 'd A`dB`C*@Q$BdC*@K$'9 '((D$ b$4B`ED4B$6y8! ( D@(!`$=`8! @! @$t`D`(!$a 8! @t8D (! @@!'(@0!'h $ $  ! @ !(! $   !   !  $ќ  ! @$#<4Bb$$ h$ (!l !# 6   ! DE| $h D@! @ ! B@ !$B B #E`< !4B$%h8! b$ @ !< %<4c<$4Bb$<4Bb$#`E<4B !$28! b$ @!<%#`E !$ % 8!$<4c @ $< %$'p !0$@0!  ' !p<0$H0!  ' !p0$J0!  ' !p>B0$I0!  ' !p8!   !p$(0!`8! `8! !p$'0!  #D쏙`E$5 8!$ b$ D@(!t0! 8! A6!#\DE$<'h  DE\$B⏰h 'hh `@C#C!@P#P!hD쏙\E$B 'llD @C#C!(dl  ! lht$4@ !   ! lht$@ !$ $   !|(!$i  "8  !@(!|@! $i@!"$#($,%0, 0B@  #$"% ̼D< &% | !$i `(!p t  !@(!`$:$8! @! 'pt@(! !0!8!   !(!`$( 8! 'tt@(! !0! 8!t$ b<(b@ $$b(4(b@$<`4B!b<(b@$$b <b < D4B< 4Bp 4BLp@C#C!@4B"Dp(B@"4B"\ !(!$! 'xx$ b$#``(! !$>x8! b$ @6!#`$<8!(!  !  !p @(!  ! @(!$B$ C "p !$G0! $  @ !D<4BÏ D!C#b# #$D"<AB@$<@ ! '0  !(! '| |$ 0!"\ A0!ӴDE 8! "\hD%\ 0! |$ 0!"` A0!ӴDE 8! "`hD%` 0! DE\$,'  DE\$, ' @ @<"4cC$< C%"@<"4cC$<@C%"Ӵ !(!0! 8! 8! !@(!0! @! $0!  ! d  ! ݌ @ !  !$ (!$ 0@@&4@C`"" !'9 Y'@ !  (!   ! @ ! (!$'9 $Y  D8  (! P  !  @ ! B@ !$B B !$`!'<'%!'p|x쏙`!!8!@ !! $-2'ht@ !@(!0! 8!"hC*@$'9 ' $$b$4c<4B4cb$`%4c< 4B@ !$%h8! b$@!<%`%<@ !4B $28! b$@ !< %<4c<$`%4Bb$ @ !$ % 8! <4c@$< b%`%$쯣 $6y 8!$@(!`$=`8! @!@$l`$(!$a 8!@l`%$$lp$Ix 8!@(@!`$$88! @(!$쏙p @(!$쏙 @(!$B@ppA (!$쏙\p$ 'll@p8$ (!@!@$' @0!'` $ $  !e@ !, $  !  !$4`(!x 0!&cTp !$0! 8!&b !p$80!8! g !p$ 0!#4B@`" !'9 p9'p ! (!p  ! !(!$'9 $9  $8 (!  !" !$B " !|x!'<' !'د T! ! $@0B@ "@ ! !'(<' !'ȯ0,($ T! !@! 9$ќ@6 ! $u,@. ! @! ! D@8!|($i( `(!@!PA ! !d  !@ ! `(!P  !!0,($ '8<'!'௿T !"$ќ@ ! @$0C0B@d`  ! @ !` $P  !$`!' <'!'Я($ T! !@!$$$@"ќ  ! d@ ! @ !   (!D (!$ @!P  !`!($ '0<'!'௿T !($ќ@% ! d@ ! | @ !'9  !p  !P  !!`!' <'(!'د T! $@<$ќ  !@5 ! q $ <4cC$< C%!"b  !d  !@ !l $@ @!0B@'9  !P  ! ! '(<'!'د T! $@<$ќ  !@5 ! q $ <4cC$<@C%!"b  !d  !@ !l $@ @!0B@'9  !P  ! ! '(<'!'Я($ T! $ @7$ќ  !@0`!"0B@@%$ 0   !# $b!  !'9'  ! ! @!P  !`!($ '0<'H!'x|xtplhT!!! $@@$ќQ @ !@!d @ !  @ !@@' T0'($@ !, $0! 8!0@ $,d!@,0(!0#X(! 0 @ !p$0!$@ , @ !@ @! @ !p$C0! $d @ !  @ !$Cb@ !, ${ !@(!`$.H8! @! !@(!`$( 8!5@!ܐ@(!$q8! !  ! @!(!@8!ܐ !$3 (! !ܐ$38!  !@(!ܐ$G$ @!ܐ(! !$3i $ `(!ܐ !$>x 8!d @ !@ !  (!@!P @ !!|xtplh'<'!'ȯ0,($ T !!! !@!B,@  ! ,H@ ! (! `8!0,($ !'8<'!'Я($ T!!! !$ќ@ ! @(!`0!,@ 8!  !P @! !($ `!'0<'4!'Я,($ T!!!! ! @:$ќ  !@3@!d  !  @ !@!$ b"0B@@$`6$ $b 2@L  !,$`(!0! 8! !P @!@!,($ '0<'!'د$ T!! $$ќ@ ! P@  !@@0Q&"0B  !$ `!'(<'!'د T! ! $@   ! "$ `!'(<'!'د T! ! $ !@ (! ! `!'(<'(!'840 T! !@!$ $7( 5ќ`2 ! ќ@* ! $ @'( $(! ', ,(!0!8!  P  ! P  ! (!840!'@<'!'Я,($ T !!! !@!BH@ !  ! @!YH@ !`0!8!  (! ! (!,($ !'0<'!'Я,($ T !!! !@!BL@ !  ! @!YL@ !`0!8!  (! ! (!,($ !'0<' H!'840,($ 쏙Ӵ!!! !0!P 8!@!)$ܐ !(!$+`8! ܐ8! !(!@$%w ܐ !(!$1\ 8!  !@(!  0!!840,($ '@<' !'Я($ T!! !$@$ќ  ! (!@8!@@$$ @!P  !`!!`!($ `!'0<' @!'@<840,(!!!쏱X\6$  !`$+ 8!'®B `(!\  !$%w '  @(!& f*@`0!|8!  ! "`(!` !$1\ 8! !@(! 0!!@<840,('H<' !'@쏙Ӵ!!!@ !0! 8!@!`$R8!ܐ@ !`(! $GH @!ܐ&@ ! (! $@ܐ (!@ !$' 8!@!@' 0!$ '  (!ܐ@8!@ !$G2ܐ (!@ !$F8! @!ܐ&@ ! (! $8K &ďܐ (!@ !$8Y  @ !ܐ`(!$G 8!@ !ܐ`(!$18! @ !@(!  0!ܐ@ !`(!$.Q 8!@!@!ܐ&@ ! (! $@`!'<'4!'Я($ T!! !$@$ќ  ! (!@8!@@$$ @!P  !`!!`!($ `!'0<'\!'H!!!쏴$  !`$G 8!'®@f`(!` !$G 8! !\@(!$@&GH @!@ !|FH(! &G`(!$'8!  ! !p @(!@ !@(! @!@!$b$b(!2|(! !'  $@ !@8!'  $ \ !$8K &G@ !|F(! &G\ !(!$8Y &G@(!|F&G  !`(!` !$1 8! !@(! 0!!'<'!'<840,(!!쏳P!0$` !$.Q 8!0! !P@(! 8!@@!t'  !(!0! 8!@!`F f*@`0!| !(! `8! B@!!<840,('@0B +<'!'lhd`\X$[!p!b$ $ !, $: !`(! @!@!7!5 &' $'@ !x(! $@ !, $]@!$ 0#&%$ @ !@ ! `(!@ !& !` ! 0E!lhd`\X'p<' !'Я,(!'90 '(!@' ,('0<'!'ȯ0,( !!,h'@$  !<`$$,8$h' $  !<`$ @0!!0,(`!'8<'!'@<8! ''( ! (!(!' 0!@<8'H<'\!'840,(!<\!!$(! $@ &B@ ! "$<\(!$ $@ &B@ ! "$ #<\(!$ $@ &B@ ! "$ <\(!$ $@u(!&B",D$2  $$@a@!D$NQ(O@$P$DJ$K$TD$E$R $U?f(bO@ $S$Ab3$$Ib0$1b,$e-+ `$$$Sb$$"" $Lb(bM@$Ab$ d$ $Ub$" $1b $ (b2@$2`$ b$ " 2 " A &" $ 0"<\$ $@(!&D'90 '@ $' &%@$$ "  <\$ $@ $T&$D" `(!3"!840,(`!'@<'!'诿 T!! !!!@!$@ ! ($$p  !$0! 8!E @ ! >"@:' X (! ! $, @! DbD!BB0B@$c``&s' '(!'9t ' @0!p !$ 8!&`ϯ@9B@5@(!X'  ! $ !!, @!$诣 DbD!BB0B@$c``&s' ' (!'9t ' @0!p !$8!&<\$(! $@(!&@ ! ($$p  !$0!8! <\$ $@ &@ ! ($$p <\(!$ $@&T$ ` ! ' $' p( !$ί<\(!$  $@(!<\$ $@ (!<\$ $@ex'` !(! $0$<\(! $(!$<\,Q $,R !@$!$B'@ !(!'90 @> ! (!@$ $ $h@@$ $hp@  !$0! $0$L0! $0h@$h@ p'` !$0!$0S诳-$@',$;@ ! @@$B$  !$@p$$0!0!' @&$@$  @$8!p !$K 0!! '<' !'ȯ40,($ T!!LP !@+$) 8!p !$0! H !L `(!@@ !p$"0! 8!  !pT$% 0!\  !40,($ '8<'!'<840$- DHL@@!<$cC!B\!@<\@(!$ $D@ 0b$BP*@y!<`H@ !0$ P*@PH @ !DhHD '@`!DB$BP*@Y@ !<`$( 'DBO$CD$BP*@I!<`H@ !$0 D>$CD$BP*@8!<`H@ ! $8+'P  !P*@(!h ! ' X@ !<`@0! $D@!D$BP*@!L|<@C!`H@$i0G8!@ ! $PD$C$<840`!'@<'L!'쯲诱䯰௼H!!!$$$, @!H$x'(!$@  !H' ! 'Hȏ  !*H@ !T'P@ !$0! 8!H@. !'  (!H@'&P$ (!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$j| @(!ܐ$8  8! @!@(!ܐ$8! @(!ܐ$.8! @(!ܐ$/V8! @(!ܐ$,v8! @(!|(8!$j @(!|(8!$j @(!|(8!$j @(!|(8!$j 쎅ܐ$8! @(!ܐ$7$ @!`(!|(8!$j @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$j @(!ܐ$8  8! @!@(!ܐ$/V8! @(!ܐ$,v8! 쎅ܐ$8! @(!ܐ$7$ @!`(!|(8!$j @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$j @(!ܐ$8  8! @!@(!ܐ$/V8! @(!ܐ$,v8! 쎅ܐ$8! @(!ܐ$7$ @!`(!|(8!$j @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$j @(!ܐ$8  8! @!@(!ܐ$/V8! @(!ܐ$,v8! 쎅ܐ$;#8! @(!ܐ$7$ @!`(!|(8!$j @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$j @(!ܐ$%h8! @!@(!|(8!$j @(!ܐ$8  8! 쎅ܐ$!8! @(!ܐ$7$ @!`(!|(8!$j @(!ܐ$!8! @!(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$k @(!ܐ$8  8! @!@(!ܐ$/V8! @(!ܐ$,v8! @(!ܐ$:98! @(!ܐ$HM8! 쎅ܐ$@8! @(!ܐ$7$ @!`(!|(8!$k @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$k @(!ܐ$8  8! 쎅ܐ$@8! @(!ܐ$7$ @!`(!|(8!$k$ @(!ܐ$8! @!@(!ܐ$38! @!@(!ܐ$8! @!@(!ܐ$?8! @(!ܐ$,&8! `(!ܐ$4y8! @(!ܐ$8! (!ܐ$8! @(!ܐ$8! (!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$k, @(!ܐ$8  8! 쎅ܐ$(8! @(!ܐ$7$ @!`(!|(8!$k8 @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$k@ 'ܐ@(!$8  8! 쎅ܐ$?'8! @(!ܐ$7$ @!`(!|(8!$kL @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$kT @(!ܐ$8  8! 쎅ܐ$78! @(!ܐ$7$ @!`(!|(8!$k` @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$kh @(!ܐ$8  8! 쎅ܐ$28! @(!ܐ$7$ @!`(!|(8!$kt @(!ܐ$J8! @(!ܐ$7$ @!@(!|(8!$k|  8!ܐ@(!$8  Ӱ   !'H &8<4c !#Bb!C#(#   !@@!\쎅$Ю$68&  $􏙖 `!'<'!'د !$+$􏙖@ ˴  􏙫$ $ $ ! '(<'!'௿!$@@(! $$@@(! $$@@(! $' <'!<$Bp<'!'௿0!!'௿$ ,@$$ $$Ӵ0! 8!' <'>!'ȯ40,(!$@!<= @(!t0!'  @!D    ! @8!D@$    ! @8!D@$   ! @8!@$!40,(`!'8<'<!$ ,@$$  <$B<<$B<$B܏($B<'<@!'௿ !$$ ,B$B' <';!'௿ !$$ ,B$B' <';!'Я,($  ! !! !$ !@$' @! 8!C$!!  !@($@@ @ ! F@ !  (! !$ '@$@$@ @ ! F@ !  (!@!,($ `!'0<':`!'ȯ40,($!$!d!<  (!t0!'  @!@R!D   @ ! @8!@ (!p-D   @ ! @8!@ (!`$.H 8!D   @ ! @8!@p  (!@(!p @(!t'$ 8!H$ @ !@!`!40,('8<'8t!'د p!쌅  ! ! 0!Џ @(! '( $'(<'7!'د p!쌅  ! ! 0! @(! '( $'($<'7h!'௿  !@!,De$db$b,B@ !$鏙b !Ƭ ' $' <'6!'د ќ! ! @ ! $d !  0!T (!C! !!  !P @!! '(<'6!$`` ! <'5!'د x8!!$ (! $  "4# $$%(&,'0 !'(<'5L!  <'50!8 <'5!$ , @ $$$ !,@$$ ! !|$Bm\|$BmH|$Bm0|$Bl<'4\!'د$ !!  &1@ !| $Bq!E !@*# $`!$ '(<'3!'د $$ &1&@@ ! !! '(<'3\!$,O@<$cPC!B\!@$? $$$$;#$!$<'2!$,M@<$cC!B\!@!$$$$!,@$Z$$$ $ $&,[@$$$*$b$`!<'2!,0@i$<$cC!B\!@^$C\$Z$"X$V$T$R$P$DN$EL$J$H$'F$D$B$ @$>$ <$ :$%8$)6$.4$52$B0$=.$*,$/*$;($<&$+$$0"$: $ $$$&$,$1$6$M$$$- $2 $$$3$4$#$`!<'0\!$,M@j<$cC!B\!@!$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$"$#$$$%$&$'$($)$*$+$,$-$.$/$<'.!$,M@j<$cC!B\!@|$Bmt|$Bmx|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bm|$Bmď|$Bmȏ|$Bm̏|$BmЏ|$Bmԏ|$Bm؏|$Bm܏|$Bm|$Bm䏂|$Bm菂|$Bm쏂|$Bm|$Bm􏂀|$Bm|$Bm!<',!$,O@<$cC!B\!@|$Bn|$Bn|$Bn|$Bn|$Bn$|$Bn,|$Bn4|$Bn<|$BnP|$Bnd|$Bnx|$Bn|$Bn|$Bn|$Bnȏ|$Bn܏|$Bn|$Bo|$Bo|$Bo,|$Bo@|$BoT|$Bo`|$Bop|$Bo|$Bo|$Bo|$Bo|$BoЏ|$Bo䏂|$Bo􏂀|$Bp|$Bp|$Bp$|$Bp0|$Bp@|$BpT|$Bph|$Bpt|$Bp|$Bp|$Bp|$Bp|$Bpԏ|$Bp!<'*h!'\XTPLHD@<8Tlh!p !@!!@v$ќ  !@o$$>2.?@'$K$.@$7$.@$$$(F$$@$(D.8@$8$$!.$(5$9 $(/.L@.S$HE.I@$I$@W$Gl$(v$J$(@$S.Q@$P$($T$( l<,4Bb$ @b%' $l$,cC#<4B0$,<($ 0%$$'$ l<4B($<b$ (%'l $l@$ 'll<4B($<b$ (%'l $l@$ 'll<4B($<b$ (%$l<4B($@<b$ (%$l<4B($<b$ (%$'llPl8l<lDl@lD$0cl$@D$0cC%{y  !"X#V $%&'()*+,-./01253l2L 0! $ *@! $b "@$lD$0c$l<4Bb$<b%8p*.)@$F$ %$=-$L9dA@!Ӵ%@ !0! 8!@!殂d\A@!Ӵ%@ !0! 8!@!خ\hA@!Ӵ@ !(!0! 8!@!ʮhXA@!Ӵ%@ !0! 8!@!X#$b4$SXt`!  !@ !(!`@0! 8!A@!`!  !%@ !`@0! 8!@ !(!<@0! @8!@!'9_  !(!(@0!@ ! 8!@!'9[t  !A@!P  !`(!lA.&,B@$5$6$:$; $' $D $($N$O$Et!T!t$ @ !$tP  !V(!t!tA@@!.b0@5(!<$B $b!B\!@%)%&%#% %%%%%%% %%%%ԏӴ@ !0! 8!t@!N&,bO@<$c C!B\!@&,B@$ b$ b:$t0!'(@ !(! @ !< (!($ @ !$B,B@(!hP$F@ ! 8!!A@!ܐ (!@ !$ 8!A@!h Є@ !(!0!$b$ܐ@ !(!$3 `8!@@!ܐ8!@ !(! $3@!@!$8!b0$ ,b@&<$c C!B\!@ 8!$$$$$$8!$8!$8!$ $ 8!$0B@0G0~ܐ(!@ ! $G@a@!ܐ (!8!@ ! $3i@V@!$$E$ܐ`8!@ !(! $@@!!@C!ܐ@ !(!$3 8!@!@!$b 0B@0S0~ܐ(!`8!@ ! $H@ @!ܐ@ ! (!8! $4ȏA@!l@ !$ (!l@ !(! @0!$ (!$($$宂h @ !0! (!t0!',@ !(! @ !< (!,$ @ !$B,B@Ph(!@ ! 8!A@!ܐ@(!@ !$ 8!A@!P  !(!h@ !0! (! ! (!@ !(!h0! @!l@ !|l$b<4Bb$ <(b%$0$ '0@  !@ !$ $. @$$$ $$.@$$ $$$$ppl ܐ@ !@0!(! 8!@X@!$ I$lE@ !(!$$+l@,@ !(!$8!!l@"@ !ܐ(!$7$ l@ !ܐ(!$J   !@ @ !@8!(!$ $$(! @ !$P  !$$ '9[t  !@T!PtP  !(!\XTPLHD@<8!'`<'!'ȯ0,($ !!H$ ?$$ $ ` !6000+$`*$b(B0@%$@#$$P$(! 8!@!@$$쏙\@(!$m 8!$쏙A(! @0!@@!$0b` !0,($ !'8<'!'|xtplhd`\XT!!! !$@ќ  !@$T ! TS@G@!$8.9@'$J$.@$ $ !. @$$$4$$.7.!@$!$$$#5$7H$.K@$Q$Gr.H@$H$>$@_$ K$Is$.R@$R$K$P$$S$ !8!(! 0!5$ ' B0B  ,B$ '$0B$$8B,B0!$ !10!$0B0!$0B0!$ B0!$|0BP8~|<yw@trDom0B\f0BUB$\ !"#$E$%&'()*+,-./0123 $!$  0!@$>! 0B $p.@ $F$  $.G@$L$( \9!`6!d3!X0!h-!$b'9Xt  !(!@0!`8! ` ! !'9_ @!(!` ! @0! @!'9[t  !V!Pt!&,bM@<$c \C!B\!@t` !(!0! 8!$&,B@.$t0!'(` !(! ` !< (!($ @ !$B,B@ (!P&F` ! 8!@!@w$h` !0! (!dT$$@$3\` !(! ',@!@^$,@ @(!f*@`0!|@(!|`0! ` !,$C$9`(!` !$3 8!@!$$` !\$0$` !@(!$G'04 ` !\@(!$3i '404\@(!$H'88< ` !\@(!$4 '<8<C!$B $@1` !&t0!'@` !(! ` !< (!@$ @ !$B,B@ (!P&F` ! 8!@$!` !@(!$@` !(! 0!@!t` !(!0! 8!@$@!$p(!@(!t'D8!` ! @  !Dd @ !A(!Ű ` !A@!$p(! ` !t` !@(!'H 8!@$@&@  !Hd @ !ip$$t` !(!0! 8!@b$@`` !|(!$ 8!OM'ER$t'L` !(!0! 8!@9@7!Lf+@`0!|` !(! 8!*L'.$\(!` !$J 'P@@!@!Pf+@`0!|` !(! 8!P $#!T@!@&!A$&,P@ <$c C!B\!@ !x(! $0 $ x !(!$ P  ! !|xtplhd`\X`!'<'!'@<840,(T!! !@!@z!@$ќ @ !@$$(".")@$F$ "$" " $L" Pd5&TdP\2&T\Ph/&ThPX,&TX$b'9Xt  !Ep@0!`8! ` ! !'9_ @!(!` ! @0! @!'9[t  !R!Pt$Ttt0!' ` !(! ` !< (! $ @ !$B,B@ (!P0!` ! 8! @!P @ !$ ` !$ (!$P @ !(!@<840,(!'H<'$!'840,(ќ! !@y$T ` !@!R$(.)@$F$ $  $L pd6p\3ph0pX-c$b'9_  !@C@!'9Xt  !ep@ !`@0! 8!@ !@(!  0! @!'9[t  !@%S!Ptt@ !(!0! ' @!<@ ! (! @ !$ $$B,B@ @ ! (!@!$P ` ! !840,(`!'@<'!'د$ T !@!@"$ 0!쏙Ӵ8!,C@ !`! Bp !@(!  0!! 8!Bp!$ '(<'!'د$ T !@C$pQ$  !\$p$  !`\$  !d`$  !hd$  !4h$  !4&t$/$ ! &RA&!$ '($ ,$?',@$n$&$7,@$$ $$$$? $$$2,o@${$Z$;#$! $b $(,|@$@$u$@$}$`!<'!'d`\XTPLHD@Tl !!@!@CQ,b@$`6$nbR$lb$$bl'9@ e !`@0! 8!@!l'9@ p !`@0!8! @!@@!@@8! !@(!  0!l'9@ p !`@0!8! @!A@!`e0! ! 8!p !<@8!  0!@!l'9@ $(! !Ӵ0!8! @!4@!$  !4`e !0! 8! !(! 0! @8!l'9YL @@!` !(!$.H 8! !@(!`0! 8! !@(!`$J8! 0 !@(!`$&8 8! !@(!`$&x8! 4 !@(!`$&N 8! !@(!`0! 8!8$YY  !@!V!L$RtB@@'9X  !@!$b`$b('9]<  !0@0!( !'9]<  !4@0!( ! '9]<  !8(@0! ! 8!@!ԎG !(!  0!&$yY  !@!&R'9Xt  !W$l$Zb$b`8!$.H ! (! !p @(! !@(!|@! $p !@(!p @!A@(!$  !$` !(!$ 8! !@(!p @!A(!$  !$A  (!d쏙ܐ$ 8!@!T| !$q  (!A1@!ܐd(!$8! d@(!ܐ$38! @!d@(!ܐ$8! @!d(!ܐ$?8! d(!ܐ$,& 8!|(!$q  !A@(!d쏙ܐ$4y8! d@(!ܐ$ $l$bb(8!`$.H ! (! !p @(! !@(!| $q$ ' <@! $Ld' ܐ(!@8! $8 xd (!!d`\XTPLHD@'h<'|!'د$ T! !@!@'$ % !#$0b$'9@ Ep !`@0! 8! !$ @(!#$$b !E4 $B4!$ '(<'!'LHD@<840,(TX! !@!@$Q'9@ @ !@!$$b0!pܐ !8! X !@(! @!!@ !'9YL $@@!`X !$.H 8! !@(!`0! 8! !@(!`$J8! @! !@(!`$&8 8! !@(!`$&x8! @! !@(!`$&N 8! !@(!`0! 8! $YY ` !@!ZV!Et$  !$Bt'9X  !@!$b`$b!'9]<  ! !(!'9]<  ! ! (!'9]<  !  ! @0!@!BtA(!Ӵ !0! 8!BtԎEt ! 0! 8!&s$YY ` !@!&R'9Xt  !TXLHD@<840,('P$p<'!'Я($ T !`@!@P$ќ ` !@I$rp@5 !`@(!$ 8! !$ @(! !@(!`$?  8! !$ @(! !@(!`$ 8! !$ @(! !@(!`$ 8! !$ @(! $b ` !P ` !$($ '0<'!'د !! !'9@ 쏙`@0! 8!" !'(<'!'د T! !$@ $  !C$,b (! @0!! `!'(<'!'840,(P !#T8#)$B@%0!$8!'  @# !"#c!bdef" C!$B " "p *C!"$$B840,('@<'!'<840,(X !B!$@H!T@?!@;0!PӴC#,B8!$ $ c@!@$j+-K  !"# " '$ !f0! @(!$@ ! $b H!% $$ "BC!<840,( !'@<'!'H!! !@!ќ  !@$ٮ ќ  !@ !PE@ ќ @ !@P.@ ќ @ !@ (ќ @!@P @ !`P ` !P  ! !P $C$b C$bBCF$ "@"@:$P@6$Tpt  !pU&BHb+|`;$!!&@     '"#$%&'()*+ , - . / 01'9 "#$%&'()H@$t&BHp  !@!t@U$p$C+@O$!@!&S     '"#$%&'()*+ , - . / 01'9     " #$%&'()*+, - B @ $BD@ $B@$Bl@$tpC$B`pE$S'p't !0!`! E0 !0!`! Ot@F$p$lC+@@$!!$`     '"#$%&'()*+ , - . / 01'9     " #$%&'()*+, - tp$Blpp'p't&p !0!! \ !0!! ` !0!! d !0!! 4 !0!! | !t@V!Et !0!&yЯ |$B(C0@ !`|p$Bb+`d  !Bxpyz{x!DCEFp !$B| p@ @ !@!@ @!|' b!rR$@$c|t@$|p8!$Bb+`$~}|  !0!$ ' t|p!C!$B@pt@z$p$C+@t$!@!&S     '"#$%&'()*+ , - . / 01'9 "#$%&'()Bh@ $Bl@$Bp@$tE0$S'p't !0!`! E4 !0!`! Ed !0!`! E` !0!`! E8 !0!`! tpR}$Bpt@P @ !`P ` ! P P  !P  !!'<'x!'`"""""""""|"x $!!!!"\"@"D"h"p"t!$x'(! $l"@ #,BH@$!'(!'@     '"#$%&'()*+ , - . / 01'9 "#$%&'()"@$BHO"@C8`bJ @E@!B0B@Q$@ ! "t@!B @$ 0$ Ep$ D p @ ! @!@!0  ! Ȏ @(! @!$D\'<@$` 0!8 (!@! @$0!`8!'h $ $(!` ! d"@<4B $#< %,c `Xd!'p!'     '"#$%&'()*+ , - . / 01'9     " #$%&'()*+, - "@$B"@p@#$'"@$R'"D(!'8!@!  A(!` !'8!@!  A쏙$|| ` ! "l0!@8!' $ $,@H"@#,Bl@K!''`     '"#$%&'()*+ , - . / 01'9     " #$%&'()*+, - "@$Bl"@쎅'"@'"D&М&fp8!! 쎅&f\8!! 쎅&f`8!! 쎅&fd8!! 쎅$bh&f48!! "D @!&pt쎅0!&8!&ٜԯ *0 @&"DA"D@K$$ep&pt $/ e\$ e`$ ed$ eh$ e4$ 쏥$ 쏥$ $& &  ` ! "Dod"L$"H$d` ! "P 쎅\$'"H @!"H @C#C!"H"t@I$<Ϗ\쎅'"L "L 쎅\@#$B'"L !"L @C#\C!$B'"P"L "P @C#C!"P"H\$B'"T"T "T "H@C#C!"Lt"P"T8! ! $ "@#,B@7!$ep&pt $/ e\$ e`$ ed$ eh$ e4$ $& & CDEB"X"Y"Z"["XdH$"("@c ,b@ $b$b$ b$ b"H@C#C!@ !<;4Bb`$̤`0!  @ !dHb@p"h8D `(! @7"p$ep&pt $/ e\$ e`$ ed$ eh$ e4$ $& & Z"p''c`0! $ $"p@$"p"@$""pb@$b"pHL@D"@+@,!ECDB"\"]"^"_"\$ "@ (!$0 '!"\ "@0@0! 1(!0!"@0(! '"\ @C!C!"@b!"@"\@!8(!D '(@ !0! ~D!@U!U!P!"`8!$HX$F، $ $0!F!Ȏ쎅|$V'"@'"`$08!! F!Ȏ쎅x$48!! F!Ȏ쎅$d8!! F!Ȏ쎅$`8!! F!Ȏ쎅$88!! "` @B!ȏ$E0 B!Ȏ쏙$E4 B!Ȏ쏙$Ed B!Ȏ쏙$E` B!Ȏ쏙$E8 D!ȏ 0!'(!!ȏ$E0 &1 !Ȏ쏙$E4 !Ȏ쏙$Ed !Ȏ쏙$E` !Ȏ쏙$E8 !ȏ 5* @"p&pt $/ ep$ e\$ e`$ ed$ eh$ e4$ $& & $쏥 쏙$ ` ! $"\&*@"\!!'()!B!E!"\0!@@! (!'!Fw$$cg*@$"\b'(!B!@'(%!B!Dx"\ !8!@@!'!GU$$cf*@$"\b'(!B!@x'(%!B!D"\ !8!@@!'!G3$$cf*@$"\b'(!B!@'(%!B!Dt"\ !8!@@!'!G$$cf*@$"\b!B!@t'(!@!t!Э!x!"!C!ČB!C"\'(#!B!@#!C!̌B!C'(2!!Bh@$2!쎅\$" '"d"d !@C#C!@ !<;4Bb`'!0!  @ !h2!"\B!ȏ"l&*E|@l@p`.&1"\T@` !!(! !"""""""""|"x!'"<'0!'د$ !p!$ ET $4 P,<("D  (! (! (!D p @ !@!@!@ !0  !$  '(<'Ȩ!'د$ !!! "0B@$Ԍ@ ! (! !ȎD (!@!@@ !!$ `!'(<'!'௿  !$( (! @@!Ȏ  (!@!" 0B@" ! #@!<4Bb$ #!!!$!@$!@!!@$!8 ! (!$ '( @'(x4  0! @"T T"' $0! ! (!  @ќ  ! @@!!@@@ 쌂@b@CD@ D쌂@b@CD`cbb<@b8 dd'' 8! @@!!$@<C<p  ! @!  !(@0!'8! ! (!    ! P  !  (!Ԍ  ! ?! !' <'H!'@<840 !!!$0! !`(!( +$$  '(8! !@(E  (!@$ ( (p `(! ( $` (! (!"@<840`!'H<'(!'@<840,(X!!!!B$5ќ !@.ќ  !@ "P$ $@ @ $D  ' !P  !P @ ! ȯ` !(!0! $@!!@<840,('H<'!'د 8 ! $ !L&`&0 , !Ҙ@0! $ !b0!  '( '(<'!'D@<840,(X!!!R$N !(!' ,P $#@C$x (! $ $C(CCC C@@p@ !@(!T, @ $0!`(! 8!@@!L@(! @ !$CC,0!`(! $@@!  $ !PD@<840,(`!'H<',!'௿ќ !@ ! DL &H  !P  !!' <'!'䯶௵ܯدԯЯ̯ȯ!!T! ! @!.B @<$c C!B\!@  !쏙p @(!@(!`` !$6W 8!@@!`` !@(!$,8! 't@(!` !0! 8!@4B`` ! (!$I8! t@(!` !0! 8!@4B`` ! (!$w8! t@(!` !0! 8!@4B`` ! (!$I8! t@(!` !0! 8!@4B`` ! (!$*8! t@(!` !0! 8!@菙`` ! (!$ 8!` !@(!`$b 8!` !p @(!@@(!` ! &` (!` !$I 8!@@!`` !@(!$b 8!@$䏙`` ! (!$D 8!@䏙0!` !(! 8! !p$0! $@r  !` !p @(!` !@(!`$t8! @!` ! (!`$8! @!@ p@8! !$E 0!`` ! (!$ 8!@ p@8! !$N 0!`` ! (!$; 8!@ p@8! !$O 0!T !$E0! '@'p ` !@(!@`` !$  8!A'Ű ` !A@(! ! (!@h` !` (!$I 8!@<`@(!` !$D 8!A3` !`$b 8!@5 !p$K0!8! ` ! (!`$ 8!8!$b`` ! @(!` !@(!p 'P@(!` !0!  !$Lp0!$0p !$K0!$ @(!` ! ' ' p !$0! $0XA  !p$0! $0\` ! (!$d' $@C!`C!@8! (!` ! @` !p @(!` !t@(!' 8!$b $$ab4 +`` !4B$0$C 8!@" ! (!@'HT !$0! 'A 'xT !$L0! '@  !   ! !  !$B0B@@ !  !` !p @(!$;8!`` ! @(!` !p @(!t` !@(!' 8!$(ab)(b(b@$)$b 4b$<b.  !ߜ !  ! !  !@ ! ! (!@   !@8 ! | !  !A  !p@(! ` !` !\@(!$d '@ @C!C!@@L  !O !tL !  !@(!p ` ! ! @!` !p @(!` !@(!|(8!$q0 @!<` !ܐ@(!$/ @!&(!ܐ` !$$ &$(!ܐ` !$`$ (!` !ܐ$8! (!` !ܐ$$8! @!(!` !ܐ$A&8! (!ܐ0@9` !$5 @<Q4G(!ܐ` !$d89C 8#(!` !ܐ$M8! ` !@(!`$M8! @!` ! (!`0! @8!(!` !ܐ$8! ` !(!`$8! @!` !(!`0! @8!0B@ܐ@&` !(!$>X8! ` !(!`$t8! @!(!` !`0! @8!(!` !ܐ$: 8!@!` !`(!%$@+(!$>X8! ` !(!`$@+8! @!(!` !`0! @8!(!` !ܐ$: 8!@!` !`(!$t 8!` !(!`0! @8!䏶܏؏ԏЏ̏!'<'!'LHD@<8!$0!` !@! !' @$  !@@@! C@ !௣'0(!`0! ' @!0b$LHD@<8`!'P<'!'xtplhT' !3 ! D<'`@! '0@  !<ܨ`'d@ ! @ !@`(! h  !`&% d`8! xtplh'<'!'TPLH(<$0!$D$"$+0!2 '0(A 0!<$$4 '0(A$0`$%$, 8!($'`%®"$#[ 8!'®"؏(0@ $ "@$c @$C<$<@<$$$$D0!'44 8($0!<'8 $X8(@848C@4$4@4<b$$h0!'<$c @($0!<'@ $($0!<'D $@#؎$%4&'<(D򔯤   !"(@@$"@"%&'h ! "(@.$H$ $(HL  !(#$<$$$@(! 0!(@"@!8$(! &(@ !(!x $$(!TPLH`!'X<'!'|xtplhd`!!!@!$b$"C_$ ! ' @X@ !'0&$@ @(!@P@ !a  ' @!D ' @ !D @! | ' @ ! @(!D ' $C'$󏙓| ' @ !@0!  (!%$ @!+D'  &@ !$(! 'P@$ü&'P (!&@@ 8!@(!'P 0!@'P'P (!5'P0! ' &@'PP8!(!e0!Τ $0''P$  $ $%\$-Y 'TA$T`T& 'PD ' @!$$-$4< '  @ !@p' <'0 @ ! @ !@$$X@0! 'X '0$b'P& '0@ 'P0!'P(! w$@'P''  '0| ' @'@%0! 'P|  !@(! ' D ' @!$!< '  @ !@|\ ' $'\'  @!(! ' '  (!$%ܐ8!$ $@(! 0!& ! 'P$|(!혏x $" !$B" |xtplhd`!'<'!'d`\X!$% $%<8!$ $%`"$/e 8!$@@(!p @T@!Ў$@(! ' '  !'9 $Ű@@(!$%\$:'PP &&@' &(p $ $ !' $R⸏P0!@! (@G@!"@$:`$% 8!@@(!$ '  !' @! $@/@!+@!H&$8 'T$%T $%Ӱ& "@!  !$%`$, 8!A!  !!d`\X`!'h<'H!'Я($ !(! !@!B@3 @ !,@!" @* !@ D| (!( @!F ! (!FGP(!  !8  !D  (!@! ̎D DE$ $B`!($ '0<'!'௿!@@ ! 􏙷@ ! D@ @ !  !' $<'!'د p!쌅  ! ! 0!Џ @(! '( $'($$$$$$$$$$$$<'0!'Я(<8$H$ ' @$ (`!'0<'!'Я(<8$H$ ' @$ (`!'0<'!'Я(<8$$ ' @$ (`!'0<'4!'Я(<8$$ ' @$ (`!'0<'!'Я(<8$$ ' @$ (`!'0<'!'Я(<8$$ ' @$ (`!'0<'0!'Я,($ !4H$Ɲ<! ! !@(!4H@!@$Ɲ|  !@(!4H@!@$Ɲ @@!!,($ `!'0<'d!'840,(!4' $Ɲ<8!! ! @ !4"`(!$Ɲ| 8! @ !4"`(!$Ɲ 8! 8#40,(!'@<'!'د $  '(<'<!'د $  '((0+D!$C`!$b 0!$$E$$C$<'!'Я,($ !4H8!$Ɵ !@!@(!8H@ !$M$@&<$C @ !4H (! $X,($ '0<'!'ȯ40,($ !!$C,b(!@!<$cC!B\!@!'\XTPLHD@!!$<4BHb##$cP@!!$Ӵ8<!&10! 8!!*#`&R*B@$<$L ' 8䏙ܐ$#8! @!8' ܐ@(!$8 `8! @!8(!ܐ$!p8! 8@(!ܐ$-8! @!8(!ܐ$H>8! 8菙ܐ$#g8! 8@(!ܐ$8 `8! 8쏙ܐ$#8! 8@(!ܐ$8 `8! @!8(!|(8!$s 8ܐ$;8! 8@(!ܐ$8 `8! @!8(!ܐ$i8! 8(!ܐ$+88! 8(!ܐ$L$$ 8(!ܐ$,v8! 8(!ܐ$g8! 8(!ܐ$E.8! 8@(!ܐ$-8! @!8(!ܐ$H>8! 8ܐ$:8! 8@(!ܐ$8 `8! @!8(!<ܐ$!\&1!$ 8(!ܐ$L8! 8(!ܐ$,v8! 8ܐ$:8! 8@(!ܐ$8 `8! @!8(!|(8!$t 8ܐ$H8! 8@(!ܐ$g8! 8ܐ$H8! 8 ܐ$H8! 8@(!|(8!$t 8ܐ$8! 8@(!|(8!$t @!8(!ܐ$!\$ 8(!ܐ$d$> 8(!ܐ$/$ 8(!ܐ$8! 8(!ܐ$w8! 8(!ܐ$@A8! 8(!ܐ$$ 8(!ܐ$L$$ 8ܐ$8! 8@(!|(8!$t @!8(!ܐ$d$> 8(!ܐ$L8! 8(!ܐ$J8! 8@(!ܐ$? 8! @!8(!ܐ$8! 8(!ܐ$8! 8(!ܐ$8! 8(!ܐ$(8! 8(!ܐ$;#8! 8(!ܐ$!8! 8(!ܐ$78! 8(!ܐ$ 8! 8(!ܐ$@8! 8(!ܐ$@8! 8(!ܐ$?18! 8(!ܐ$28! 8ܐ$8! 8@(!|(8!$t  84ܐ$8! 8@(!ܐ$!\$ @!8(!ܐ$d8! 88ܐ$z8! 8@(!ܐ$d8! 8<ܐ$8! 8@(!ܐ$Y8! 8Dܐ$,Q8! 8@(!ܐ$$ 8Hܐ$,08! 8Lܐ$,A8! 8@(!|(8!$t( 8$ܐ$8! 8@(!ܐ$!\$ @!8(!|(8!$t0 8(ܐ$8! 8,ܐ$8! 8Tܐ$(t8! 88!ܐ@(!$/ @!'0 !x(! $8(!|($$t8 8Xܐ$(8! 8@(!ܐ$g8! @!8(!ܐ$08! 8(!ܐ$H8! 8dܐ$18! 8ܐ$<8! 8@(!ܐ$88! @!8(!ܐ$8 `8! 8(!ܐ$!\$ 8ܐ$<~8! 8@(!ܐ`8!$8  8ܐ$(8! 8@(!ܐ$g8! @!8(!ܐ$08! 8(!ܐ$H$ 8ܐ$(8! 8ܐ$(8! 8ܐ$>8! 8@(!ܐ$>8! 8ܐ8!$>˯ 8(!| $t@8䏆|(8!$tH @!8@(!0! @8!8菆|(8!$tP 8@(!0! @8!8􏆀|($tX 8!8@!p(! @@!ܐ8(!$8! 8 (!`$m8! @!8(!0! @8!8Ű (!|(8D$t`8! 8@8!0! @(!8T|(8!$th 8@8!0! @(!8X|(8!$tp 8@8!0! @(!8|(8!$tx 8@8!0! @(!8􏆀|(8!$t 8|@! $t8A @!|瘎 $t8@@!(!@8! 0!$ܐ(!$KX8! 8@(!ܐ$C8! @!8(!ܐ$C8! 8(!ܐ$-  8! ! $@!\XTPLHD@`!'`<'+(!'840,($ !!!$|8E􏙧(&t 8!D8@!p(! @@!ܐD8`(!$8! D8 (!`$m8! @!D8(!0! @8!D8Ű (!`!|(D8E$t8! D8@(!8! 0!(D8E&t8! D8@(!0! 8!D8E(&t8! D8@(!0! 8!D8EX(&t8! D8@(!0! 8!D8E(&t8! D8@(!8! 0!!840,($ '@<'(!'௿  B' <'(!'د  ! @!$b$bDH   !D8 (!` $;8! '( $'(<''!'د  ! @!$b$bDH   !D8 (!` $<8! '( $'(<''!'\XTPLHD@(pt'0!!!8(!0!'4 !(@@!4 (!- @0!`8! !@$$'8$0 @!8(@@ ! (!\XTPLHD@`!'`$!<'%!'د ќ!! $ P@ ! P! '(<'%h!'௿ɸ!$ P!' <'%!'௿ɸ!$ P!' <'$!'௿ !$ @!$b$b$DH' <'$L!'௿ɸ!$ P!' <'#!'Я($ ɸ!!! !$QRS!($ `!'0<'#!'د  ! !@!$b !$b X"$ !'(<'"!'XTPLHD@ ɸ!!t ! @!p(!@ ! `0!@! @}$zTT.b@w$b00!p@0@X!pT$'(8 !$80! '8 @ @ !8ܯ (!$ $# T8 !$0! '8 @ @ !8ܯ (!$ $ T !$0! '< @ @ !<ܯ (!$ $  ! (! ,Bܯ@ ! (!$ $ !D8%Dܐ$;8!  @ ! (!@0! 8! A@!X (! @ ! !!!XTPLHD@'`<' P!'د  ! !  ! (!  '( $'(<'!'@<840,( !!!!$$  !ќ @!  !`0!h8!@ (!X\   !P @! @!@<840,('H<'!'@<840,( !!!!$!$ @ !ќ @!  !`0!8!@@(!X\  @!P @ !   !! !@<840,('H<'!'Я,($  !!!$$  !ќ @! !`0!8!@  (!  !P @!@!,($ '0<'4!'د  ! @ !P @!\`@$@\$b$@0 !(!  '( $'(<'|!'௿  ! (!@ ! ' $' <'!'د  !$  !  @!$ !C (!  #$  !b$ @(!! '(<'`!'د  ! ! (! 0!\ @ ! '( $'(<'!'د  !! (! 0!L @ !$ '( $'(<'l!'د  !$  !  @!@!$X !b(!$0b $ '(<'!'Я($ ɸ! !DH@!(! @ @! @ !S(!$HȎ$P(! @@! @ !S(!@P!$P$($ '0<'!'د$  ! ! !ќ !@ !   !@!$b$bB$P  ! !$ '(!<'!'Я($ ɸ!! !$Q !x(!$$ *B@0!  !@`(!$ !($ '0<',!'Я($ ɸ!! !$Q !x(!$$ *B@0!  !@`(!$ !($ '0<'|!'د ɸ! ! 0!ED8  '( $'(<'!'د ɸ! ! 0!ED8  '( $'(<'!(! !<'`!'د T! !@!` ! (!$"$d @!! '(<'!'௿ $' <'!'௿$! !' <'H!'ȯ40,($ ɸ!! ! !@!  $$HC !&%  @!@!40,($ '8<'!'PLHD@<8!<$(! "$<@(! @!&" ( ! &'$" 0!@7"$$<!$@(!`0! '!$< $< 0!@ $4b#$!b$Bb$< &PB*0!'(@!" `0!b+PLHD@<8!'X<'!'௿$!@@ !e !' <'!'௿ (P!$ !! !(BA('p@w$D$ '0 $@(8!@ !`(!0 @!( !(!x $(p'l (!0! '(@X$@@ !' <\$B$$(! 8!(@B$l (!0! '(@8$BC!$BB!@Џ٠'$'0! 8!(@$!B$&C!B\0!' <$B%ܯ$Я$4 8!((C# `!' <'@!'د ќ! ! !@$D   !Pd@@(!$T P  ! !'(<'|!'lhd`\X !!!!!L8H@$<ܐ8! @!" D8T!R!ԌG(! 0! !` 8! @!!T$-#t$b $%|瘎D8%H$t$|瘎D8%H$t AD '( @ $0ܯ'(`8!@ ! (! $ DD% GD8|($t (! @@!&" #<ޤ&$P@ !0!8!  (! @@!$"!lhd`\X`!'p<' @!'د H! <;`(!<@ !4 0!`!``(!b@"*@  !b\'9| @ !'(<' p!H $<' P!'௿b !t$b$ @!$!' <' !'Я($ ќ! ! !!$P@ !"@P\"@00$HHX $$8`(! @@ !9 ($ !'0<' !'<840,($ $4C+!!!!@j$Ӵ8e<0! 8!@!@`@!|d8($t@(! 8!A@!d8$ (!Lќ ! $@G !d8Hܐ$78! d8@(!0! @!A@!$d8 (!(` !@8!(!$'9}T @@!$<b&6Mp@ÏH !#P! @<;`(!<@ !4 0!!DP  ! !<840,($ `!'@<'!'lhd`\XTPLH(X!!! !(@!0!'8&0 $ $4D'00 4(D @(!(@B000L4X@DA/!''(', $ !(! 0! @8!(@w@!,p(( $ !(!`0! 8!(`[H$`T!Ӵ8@0! 8!(8@(!ܐ$;8! @!(8@@! 0! @(!(@!$ (! !( $8H (!(@@!@@!B\X@(!'9|  !(H8X (!(@@!! !$8 @(!(!x(! $`(H!00$dDX'0'0 8!0(b@X$8eH (0 ($+b>0~<0!$G &0 $ $0L@WT&T@C!C!C,b@$b0b@0b!p@A$'h !(!  0!(@ $b 4b!-4+$4$ (! 4(8@ @(!$bh4  0!( $b! 0! '8(@ 48 (!B!`!$ $T44@!0DTќ (@0쎄DE X(0X$8EH (H0 (<;`(!<40! @ !( !P `!( !, @!(0! 0@,$(bK@'<|8P<$t 8!(@<'(|8@(! 8!((! &(@}@!$|8P$t 8!(@<'(|8@(! 8!((! &(@Z$@W$b ! $(4@;0DT5 D(0PDT 0$(b$<Hܐ88! (0@0!܌T  !( 3؏0XTD !,B 8!0؎X ,B4@0DT P ((@!$ď0  !eTgbX` !D'@ (0@ ( 0 `(!(@!0C?T0 Dќ (@@!0$Xb$ $b&P<<  !$B D$菙H $(<0!<`(!@ ! 4B@#0#( !L0 8!(@!P0 (8$ (!Xlhd`\XTPLH'p<'@!'Я,($ ќ! ! !$ ! (!$@ $$'9}T  !P @!@!,($ '0<'!'840,( ќ! !! ! @,$(|$) !$t8!@ !b (!D8H`!  $ L$ $ $@ !(!$$'9}T   !P @!  !840,('@<'!'쯰诼$ !H!'$0 $ $|$8P (!$t8! $8@(!`$/8! @!@@(!$8t'௢0! 8!@܏4c8Bԯ܎$8\(!$5 '䏼@܏4c,Bد܏`$8(!$` 8!@ @(!|$8$ '@4B܏|$8P(!$t 8!@ @(!|$8$ '@4B܏$4 ' @!$4 @(!@!쏰`!'<'H!'tplhd`\XTP0!!@!A'!''8'< 0!$ 8!0@@!8$b<V@ !<(!`8!0! $|D8P'D$u (! 8!0@ (!D ,B|D8P$u 8!0A$d@D8 @(!0@Q$C'HY@|D8P$u (! 8!0@H@$4DLL'L @0DL @(!0@P@ќ  !$0b@P  !0$@ (!@ !'9P `0!@!T0@!"$P ! @0 $ @!$D8 0N!@@@ !$ (!`0!8! ;'9P `0!0@ @!$D8 0,$ @ !0D4l @(!0@@!ќ @ !0@ !(! $d$ $(@ !(!`8! 0!0tplhd`\XTP'x<'!'h|x !! !(!! ! (!@ !$$) @! D8 (!|(8!$u   !T$0!'h @! @ !D8ܐh (! $/ T$'(l !$0! 'l @  (!D8ܐl $` Tl !$80! 'l @ |D8(l$u   (! @!D8ܐ (!$58!   !T$ 0! 'p ApD8ܐ (!$M 8!p@!$ b(!`$b$b$/D8ܐ(!$6D8ܐ$4 D8ܐ(!$/ܐD8 8! T !$0! 'p @<Q돢p4GD8ܐï (!$d89 8# D8ܐ (!$8!   !p @! D8ܐ@(!$#$a 8! D8 (!ܐ$$8!  D8 (!ܐ$A&8!  D8 (!ܐ$ 8! @!T*'8 !$0! 8! @(!D8ܐ$>X8!  D8@(!h  0! T !$0! 8! @9(!D8ܐ$:) !$0! 8! @(!D8ܐ$:8!  D8@(!h  0! T !$0! 8! @(!ܐD8$>X 8! D8@(!h  0! !|x'<'0!'D@<840 ќ( ! @$   ! Dh @!@ $B`@L$(L@H@?'(L$0 ! P  ! P  ! @9   ! ,  ! @  !@ !(!@! $ "@   !9@ ! (! Tv !r$b&LL$0 !B @C#C!` !<4BB@b$0`$0!  @ !L$b=& &C,b@$<$c!C!B\!@$$($P$L$0B &LB! @C#C!@ !<;G4B$0`$0!8b!  @ !L& <,  !$Bw쯢0! (! P !P ! `!D@<840'H<'x!'ȯ40,($ !P!!!8 @!!x !(! $`E@D8Ӵ0! 8!@(!AD~ !D8ܐ$<>L$m 8!`4@!@UQ! |瘎D8E $u0@!BA (!ӴD80! 8!D8B@(!0!  8! & D8  (!@!x !(! $0`8!& &h0 $ $ DD8ܐ$;8! D8r!Ԍg@(! 0!@!P @ !@, @ !B!!$D8D  ! !40,($ '8<'!'@<840 4!Lb!$$bBLCE(DL dDLL'('L $L @ќ @$`@LD0 $L LD8`ED$; 8! A@!@!|D8(($u8 (! `X$Lޤ<$H$ $@ ! 8! @H@!L$ d$ ',`@^`|D8P(!$u@ 8!@!, @aL@@I@L$$B@C#C! D0`<*4c$'`+!<4BB@bD0`0!$L$q" (!<$b $%菼 <֏L`4cP$D00!$ L< $&X PL `!@<840'H<'4!'د $ !b !Tќ@ ! P@ !$ "$T4  ! 0!嬏 @(! '( $'(<'l!'\XTPLHD@<8 @!C!Bܐ!8B8!+D$B!!$<0p 8! $80!@(! @!@!B> @$0 &EL `B>@$B @ ! P @ ! ` @ !@!$ $BP@$"A(!Ӵ$80! 8! "|瘎$8$uH (! $8%@8! 0! $3$BP@)"A 0!"Ӵ$8E 8! "h$8% &F $8&"|P$uP(! 8! @ @(!|$8$ &' " (!  ! $$;ُ`$8ED 8! $8@(!|@! $uX A !$,(! BP@?!C!CBX$b 9  @ ! !C!C$b"@$'($) (h !@(!$ $@!9( @ ! , @ ! @< !YP04C!C$b 9  !@(!BX $!C!C$b"@$',$) ,h !@(!$ $@!9̏,BX ! @(! T @ ! ``!!`!\XTPLHD@<8'`<'4!'d`\XTPLHD@(4!L !'!x !($L@(! !(@P |$$8 ($ ќ  !$( $$>b$@S!C!CC&b,B@$|A3@1'|'0'4 $(! !0! 8!(@"@!4b0bP  !|<(04$  !8! 0!VA$|$$8 (P  !(D@!|b: !>@)p$8 @(!($8@(!\$'8 ($0 &L8(`!<4BB@b$0`$0! (L$$$8 @(!(P  !(!(!@0! `8!(d`\XTPLHD@'h<'ڀ!'Я($ ќ! ! !@5@@(!$L $0 XD &LHd@@(!$T   !P  !$8$ `(!@ @ !9  ($ !'0<'@!,;@<$c!C!B\!@|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bv|$Bvď|$Bv̏|$BvЏ|$Bvԏ|$Bv؏|$Bv܏|$Bv|$Bv䏂|$Bv菂|$Bv쏂|$Bv|$Bv!|$Bw|$Bw|$Bw|$Bw |$Bw|$Bw|$Bw|$Bw|$Bw |$Bw$|$Bw(|$Bw,|$Bw4|$Bw8|$Bw<$ |$Bw@|$BwD$ |$BwH|$BwL$ |$BwT|$Bw\$|$Bwd|$Bwh$|$Bwl|$Bwp$$ |$Bwt|$Bwx|$Bw$|$Bw|$Bw!<'!$ &, @ $,@/!,@$ !,@$$!$7!|$Bvh|$BvT|$BvH|$Bv8|$Bu|$Bux|$Bu`<'!'Я,($ !8! !P*@$P&@(!8!$8 A @!$8ܐ@(!$ 8!@$@!,($ `!'0<'!'ȯ40|!'$(! ,'(P '(!$| ',(@$,@!40`!'8<'p!'د |(!' $4$ 0$(!@'$B0B  '(<'!'د Я'$ (! '(<'Ҥ!'hd`\XTPLH ! !!! !@ !$0!8!$$D8!H0!$;B.B<@$=$Bg.B@$9$B."Bh."B.B=@$$>B."$)$<`!$<$      '"#$%&'()*+ , - . / 01'9!`!$      '"#$%&'()*+ , - . / 01'9!$>}>z`x$WTUVbWTUVbcdge`e  ! !"# dbc$TBQR$@!$<F<C@$ ."@$"$="$9|瘎8 $w|瘎8$w|瘎8$w  !@(!'9 @!8(!P@0! 8!&C@!,b@$b0B/@'!!2.B;.B@$.B @.B@@&B,B@ !B.B@$6.B@$B !B.B7@$*$:B !` ``` !x(! $0 !@<$c"C!B\!@`$x` !(! $08 (!t0!'$ @$$ $B,B@  (!P8& 8!@!$$08, (!(`$K'(8t (!0! 8!@@$(B@$ff$cf*@`0!(|8gb  (!$ B$ $ bo$@q!`o$8t (!0!', @,$ $B,B@  (!P8& 8!@!$O` `(!8G  0!B$@@8t (!0! 8!@6$4$B/@C!C!&`($|8 (!$ `8!@!x` !(! $$`0$`88! (! $KX` !(!x$  @!8(! `0!8 (!\$7b '0@ @(!|8$ &g 0b8\ (!$Ki '0@@(!|8$ &g 0Ԯb4`$P8 (!& 8!8@(!`$98! @!@$8@(! `0!8 (!`$# 8!@@!8t'4(!0! 8!@$|84g8 (!4b4`4\8 (!$0'4 48\ (!bp$7 '4@!4bt8$x$!`}${$8 (! `0!p@!p8  (!8@(!t'8 8!@$'9 @ !8d @ !!$M$@ !'9 C@0!$b!!`8 (! 8!@$B2&$b&R'+*$Cp8  (!8'b !<$!$hd`\XTPLH`!'p<'!'x|xtplhd` ! !!! !@!$!T$!$DTQXLH`#X$ (!$8ܐ$<8! $8u!q!Ԍg@(! 0!$$90$,L*L$$u$$9L$b $9`$8(!$< '@$8U!Q!ԌGЏ@ 0!$$$9$LL$9b$.b:@$=$bk.b@$)$b.br!.b.b>@$>$<b.b.$)'0T!$      '"#$%&'()*+ , - . / 01'98!!&      '"#$%&'()*+ , - . / 01'9!$3+T`>`$8%8! $:@(!T$8$F  '0$(!| 'DD0!| $T(!P $dD$| 'HHT][>$TURBH$ <;`(!<@ !4 0!C!E@$$T!@$$XT,b @6<p0B@!|瘎$8% $w$8@0!P@(! 8!@!@$|($8$w8!(! X$'9 @!$8(!(@0!8! $8@(!@8! 0!~!@$ .@$$u $q|$8((!$w|$8((!$w|($8(!$w 8!X`(!'9 @!$8(!(@0! 8!@!@G@!.b;@C<$c#C!B\!@$8t(!0!'L $@L$ $B,B@ (!'9  !@!@$$8h(!$(!$8@ $$8t(!0!'P $@P$ $B,B@ (!'9  !@!@$$8Є(!0!@!$8$ (!<Q4BBCC#$8(!@8!$$8(!$$$8ܐ(!$KX8! $8@(!P 0!@@! (!$8ܐ'  $7b@@!(!$8ܐ' $Ki(!'9  !$8@(!ܐ$98! @!$8@(!h 0!@~@!4@$#$8ܐ(!8! $8@0!Є '0@!`h(!$8pܐ $0@^@!t$8ܐ(!$7P$8(!@0!$8 (!0! E'9 ` !@ !$ b$ .b @ $.b@$.b@$$ $ b $.b@$$$b$7$b$p @0!$8(!ܐ@0!8!$8!B $$B$(U$B$)y@8!$>ܐ$8(! @!$|xtplhd``!'<'!'<840,( ! !!! !@!$b$b."S$D."H@$ ."@$"D$"@$|瘎D8 $w̏|瘎D8$wԏ|瘎D8$w ` !(!'9 @!D8(!P@0! 8!@!@@!D8t@(!0!'  D@ $ $B,B@$D8 (!@!<840,(`!'@<'!'Я(\8$<ϯ ' @$"(`!'0<'!'Я(\8$- ' @ @$(`!'0<'D!'840,(!(' ! !T @(!T @0!8! @!P  `(!840,('@<'!'TPLHD@<840 !0,!!h !R 3@!Ӵ$8e0! 8!@! h$8l (! $"@$ !P,B?,B@  !@ !90!(! 8! @d &@ !(!0!@! 8! @J$('( '," @d &  ! @!#($9((!0! @8!$8'(؏( (! @@!p@td$TE $T(H, (!tb,$9l( (! @!$$8 (! !!!TPLHD@<840'X<'!'TPLHD@<840 !Ӵ!8%<p!!(0!lt 8!b @@(!4 &9@! e '($|0!8! (!$80! @8! @ @!(B$e$8  $$e$8 (!0$ P !0!Ӵ$8 8! $8A @!$e @(!$rbh@(! 0!eh !! @0! ,T$$$8eN$P 8! @@!܎$8 @(! $B`$8(!$< 8! x$8t@(!0! 8!$ b,b@$`$b (!*b$b $|瘎$8 $w `$8(!$9`$8(!$; 8! @@(!$8 0! $ $b@.$$8 @(! .(#TPLHD@<840!'X<'!'80\菙p @J!C!$PTX`dB $PTX\0!88! '@cb$db $PTX\`0!88! '@ ( $08'@<'!'<840 x!!!(! ! $ $ && &`&(< $ $#,b @$b0Bp@'(h@ ! (!$ $ @(8B4ch&@ ! (!$ $# @4B#$b%,bh@ ! (!$ $ @4B@h&0@ ! (!$ $ @4B#,b@-$b0B p@)&h@ ! (!$ $ @4Bh', (!@ !$ $ @ B,,@,b4B<88B 40+$B'@<'H!'Я($ !!$8% $$8%$ 0$8%$ 00i A(!Ӵ80! 8!"|瘎$8$w (!$8%@8! 0!"A(!Ӵ$80! 8!"|瘎$8$x (!$8A |瘎% $x@ $8Ԏ%@8! 0!|$8P&"(!$x 8!@ @(!|$8& &' |$8%P&"$x 8!@ @(!|$8& &'  !($ (! '0<'!'د$ @-!|瘌8 $x D8@(!p @@!pD8E @@!D8@(!0!  8!D8Ű@(!$ ŰD8 (!$ '(<'!'Я($ !!!@! 0!Ӵ8E 8!8Ԏ@8! 0! $$8 $ `(! &  0! !($ (! '0<'!'௿!4   d   d & !񐏿 ' <'!'TPLHD@<840 !!!!hlp|$$ !@0! '( @$x((! $ (@ !4<$E$2$'R @($ @$pD$H$}L&&&$&,$$$,<(08 $<(&$$B' (!0! 8!( @ (@d $ ( @(!h(!\$d) ! @0! (@WQ#$(! ! @0! (@K0!x (!   (!($$\$\`b$p&C0B#$PK( !$( @0! (@% 0!x (! (!(G$D$<$<@b8!( !(!@0! $4 (@4PT  $t!TxX$TPLHD@<840`!'X$b$@!$80!<$@@$p`D$H(!%(L@!!<'!'௿$! !b&$`\b!$,@@C! `1$bd(! $$@ $`d(!@b!d!$B`p!' <'!'௿@E!(!$d ! $$!' <'x!'|xtplh!!!<$ ! ''( !x(! $0$ ",#'X4T0 ! `(!B`@!!Ed'(!0! $$` !@0!Ed(! $$@&0B`&1"*@B`"$!|xtplh`!'$@!8!b$$ pltx| !!<'!'د$ $!bd$`@[!!d$'8!$(! $&Rü@F(!d ! $@@ dX !$$ $@ dP !$(!%0!d !$$ $@d !$ $dT혏H(!$ $@ dPX !$(!  $`B*@&10$h$ !$ !'(<'!'د$ $!b>$`@!!d(T(! $d&R8 ! $dXP !$ (!`B*@&10`  !$&$H$&$DF$CĬ`8g<$e@`$ !$ !'(<'!'௿$b!   !!' @<4B$C+@@@!<5E0+$! 8+<4B! +@ $ !5!+!@$`!<'!'ȯ0,($ $!b5!,$,r !$0"&3S,$r*` !9$$b C$B $ !b$e $"S$,0,($ '8<'d!88$<`$<@8bC<@G <'!'<8408!@M!"$&%$E"h@ &<$<@8D!"h@8 $$2$Č8bC& ' C$d@C!# !$&D ' @ &<$$&#$$8@< h %$D8B0B@ ! (!<840'@<'!'௿XTbD0B@!D PXX ! ' <',!'d`\XTPLHD@(|x048!!!!BD@(!BX@7@!Cd$b $$b,C&Dd(!BdChdxDQXbC$ !&F &H< $ $@ ! D(@ ! &%E"t!u!$Bb*$(`P"t!U!d#C*@=`  ! $D(! `0!(S! (!  !$D 0!(T!  0 !$D 0!(U!D+C%D4`4BD8@$Bl@ @ !( $ @ !(|BD@r(!d`\XTPLHD@!'h<'H!'tplhd`\XTP(!ߨ(!!0'00Z$ 2r(0 ! (!(@! !@(!0 @!(D$PH'< !T@! !$89L`! ( !T ':(@ !T '@( !'8$  $$H'J I(@ !T 'L( $ !'H$ (,Btplhd`\XTP'x<'D!'Я($ !!(!$ߨ' !  !  (!@ !@$ !($ `!'0<'!! (!yt $ Ge ` !! <'T!DT@ P<'(!'LHD@(45404B501! !('20DT '8(54H0B4B5 !(<4B@<0!`(! @ !(` !P (!($$ @ !8!'0 $(LHD@'P<' !'ȯ0(0BC!$$$  $(0'8'P@!0bx' P!` !@ % e(yx$L ,P'X!$ Y| @ !gE <'!'HD@<8(T$1!!0'2$ !('4 !  (!($$7 ` ! 8!'0 $(HD@<8'P<'4!'TPLHD@(T$1!!0'2$! !('8 !  (!($;T'< $($>$  ! 8!'0 $(TPLHD@'X<'D!'TPLHD@(T$1!!0'2$! !('8 !  (!($;T'< $($>$  ! 8!'0 $(TPLHD@'X<'T!'TPLHD@(T$1!!0'2$! !('8 ! @(!(;'$  ! 8!'0 $(TPLHD@'X<'t!'د !DY$ D @ !$B $b ! $BT ! P (!ᰏ  '(D0B@!%$L%$H!!$ED+@$$ $ $ kJ(b@` +lkBj+0@0 @k(b@` !lj%%%!Bb!h$bC!a%b$C8! 0!$*$B@#U !`S0!O$P+$(*@GB0B@0b@!bcC!1"!bcC!0"!0b@!bcC!"!bcC!"!!$B0B@0b@ C!$B C!$B0b@00cC!$B0cC!$B@#0!!+@b$<'!'TPLHD@<840@\ !\ 0 $DE\@!bD$(0B@$,d<  !@ !$(! $B$L\  !@D$@< !(!$ !(!0! \bD0B@$qL&$qH\bb!$BD"+@$$e(b@$` bK$b0@0 @&0e#(b@$` bI$b&$"Bb!$r#0@ !l  (!"#BJ"#C!$R# h  !2!D$E0 !@!"#C!&00 ! '&S*`2!& &3~䏦$(! $$~ #C!x!b$R# !H &d` !0 @!@!$#*@$$D'$@'b@;t &d &dH @! !(!| @0!'b@$  !(`D0 $E"&TDP$ (P !<$B P'*@r! l  &  &1 !(!0&0$*@B0B@0b@%!bcC!!$RbcC!!$R0b@%!bcC!!$RbcC!!$R#(!x !0 &'#$B0B@$0b@$ !C!!$BC!!$B0b@$ !C!!$BC!!$B"!B0B0 @00b@"# C!$R "#C!$R0b$#@00cC!$R0cC!$R#r&  !L(!"#C!"!q$Q(!H&$ &0 H0&$ &0H)&$䏦$ ! 8!#B0B@ 0b@"# C!"!I$Q 0b$#@00cC!"!=$Q00cC!"!6$Q @!p@p$B$l & PX$B`l  !$,2!䏦$ !(! $$$ @ `!\b$$c$\b!$\DD0@ 0@ X@  !,TPLHD@<840'X<'}!'@<840!ܨ%4'' $$d$D $p@J!%4@D$ @ !%4,B@9DB@40b@2$#d#C!C!#0R ! @0!@ @!%4 !$ @0!@@!$%4$B ! @ !$b$b`  !@<840'H<'|0!'ȯ0,($ ! !0 !cD 4 '@!! !D  (!Q` ! &% 0!@'D  !@! !0,($ '8<'{@!'840,(!! ! 0G&Q?$$0!b $&0 $ $ H$ ! <<`(!<@ !4B@ 0! <d4BD b$Pl@''  8!@ (! $$C\Q\D`# 840,(!'@<'y!'ȯ0,($ !$B@SDP &%T#X` !bD0B bD%D "ᰮ D$B" @ !"$B"&3  ` !#%4D  '@@!D  @(!D`(! $ 0!@'D  D  (!"&$\$BC"\#`dD0,($ '8<'x!'௿ !B@ !@  (!Cyt $F Ge ` !!! !' <'w! P 0!BLPC8B<C#Db!BD<'w!'Я,( !$TDP D (!4@ !!   ! @!0!`<`!<4BB@bP  T,(!'0<'v4!$TDP <'v!X@ <'u!'௿!$TLDP DP $bP 8!@ ! 0!b ! !!PH$ 0!Lb  !! !'   !T ' 0""""""C%$C!D!$$C!E!C!<'t0!'D@<840,(!\،T!P$@ ! !@!@ !@!xPTX ' @! '$ ! 0! 8!@@!\ `$XQ +b!u(*XB!\@!`@$\b`@!D@<840,(`!'H<'r!'D@<840,(!@،8!$4$@ ! !$S@ !@!&$,BC,$b$b$(!|dP$x| '\ @@(!\$ bdܐ$$ 8! @ @(!Fhd $` ABD B @DP ! !D!t $0 @W|瘎d(! $x A @!$IB B0B@AB@2$` !@(!&F $ @d!x'( !(! $0 F$` ! (!G 0$`'X & $ќ ! ! @@!  (!Fd $0 B ! !B B0B@$  @ !y@(! @ ! @0!` ! @(! , @ ! @` !` @(! DP $!|xtplhd`'<'JL!'د$ !!8<+!$b$bJ$B,B@N@J>$,B@B$>$b0. 0B@3'$b$D $b&$b"d `$$% 8!@ !$bC@  !(!@0!$  '($ '(<'H!'ȯ40,($ !!!`1!$b.$r-$ 0B@($ܐ(!$%h $$ " ${" $"$}R$}"$u" $dܐ(!$88!b$b $"8!`  0B@ 0B@$8!ܐd(!$%h 40,($ '8<'G!'840,(!P$ !!!$${$$}$b{$}"y$u"w`s$bq$b$"m 0B@haD ' BD $8! D$  $G0@$b0$"0@ $b$$b;$b $" |D($B$x |($BD$x `(!A$$b@ !(! $ $ ECDB$%&'$@$b$840,('@<'D!'ȯ0,($ $!!(!!$$"XA@/"\@+dܐ$& 8!@!@!&XĎd @(!$"X@'\(!d@ 0!d%\$ $"\0,($ '8<'CT!'Я($ d!ܐ(!8!!@$@̌ @@(!$d $d($ '0<'B!'Я($ `!ܐ(!8!!@$GM @@(!$` $`($ '0<'B,!'<840,($!!(!!!(@$$,B@f$b`#($b\"@"@$|dP$x ' @!$ bE$"  d\(!$/V '$@$+"d\(!$,v '$@$,B" "@"@$T  !@!b@  !y@(!0! ! @! ! (!<840,('@<'@!'\XTPLHD@<8 !! !!p !c0$ b`$cb $ |瘎(! $x`(!$% 8! p@(! '( |( (! @@!Ӵ0!8! , (@!',(! @8! @c, ` !d @! 0@5$cb1$/0@-p (! @(!p @! (! @!  (! @!@!$ $b bPp@  !`(! $ `b <4cC$4BBb  ` !  ! @!  ! @!$@(!` !$ 8!@" ` !  ! @!ď(0` !$ @! ` ! (!  !  (! $ (! Ű(! @@!, ` ! @C$$cb`\XTPLHD@<8'`<';!'HD@<840,(! !!!` !d(!|@! $x@B@(!b@>pd+d'    ! ! @!y̏ @0! !(! @! ! (! !  (!d@(!Ű @!,@  ! @(!0!t@8!HD@<840,('P<':8!'840,($ ! !!!P !D(!`$GM8! @!@)@!BЏ@%` !  ! @!Y(!0!8!` ! @!` ! (! ! (!840,($  '@840,($ '@<'8!'840,($ ! !!!P !D(!`$@8! @!@)@!Bԏ@%` !  ! @!Y(!0!8!` ! @!` ! (! ! (!840,($  '@840,($ '@<'7!'TPLHD@<840 !!( !hlp ! `K@! b 0B@$b@@rќ ` ! @k ` !  ! @! ` ! @!ď(8! (!` ! @! ` ! (!  ! @(! ` !TPPLHD@<840 'X@  !@(! ! 0!8! @!  !(!TPLHD@<840 'X@` !TPLHD@<840$ 'XTPLHD@<840'X<'4!'`|x8!(!! !@! $x !(! $' !x(! $0$'Hx$ !(! $0@T$BF0!X&'`$0!### D 쏥$", ( B `b 0B®"b 0B"b 0B,B"7 #$"(# , )4L0! ! '0!&'0'x $ $0!322 2 2( ,4 %L !0!(! 0!&'`'H $ $p(!  !@Џ $$܏ !|x'<'1!'ȯ40,($ !!!$!$!@!@!! @ "@!.s !!@!ќ$"  !@5  !`@!B@B@@@D ! (!@@  @ @@ ! (!P  !`C 0b@@ "@B@RD4b@B 2@ $B   !@(!  ! !  (!BP@BP!@40,($ '8<'/t!'ȯ0,($  !! !@!B@  ! ! @!y(!@8! ! @! !  (!8,  !@1b@ 0B@  ! ! @! ! @!y@(! ! @! ! (! !  (! 4B ,  !@`$bM  ! !ќ @!@0 !  !, @!@b@ 0B@ ! y@(! !0! @! !  (! 4B P  !(!  !@7  ! @!0@#$c4`)   ! ! @!y@(! !$ @! !  (! ! (! b !y@(! $,  !@$0,($ '8<'+H!'௿  !&4&d$@! @@0!h8C+@$$!`!' <'*!'د   !@J@!,$bF` @  $,6'9`  !@.A'$ d$ $ d$ $, '(<')D!'௿ќ ! @ ! DTL & ! (!P  !!' <'(!'௿ќ ! @" ! DTL &%,B@ ! ,$L&`b0! P  !!' <''!'@<840 X! O0M@K$$ !'(BE(!  Ҙ !@6 !(`! ($T $ ($T`<*4c$$b0!  (ќb` ! 0!@(! ! s ((!, 0! (P @<840'H<'&8!'د$ ќ !@   !@!" 0B@ 0ќ  !@$,b$b ! (! $P  !# <4Bb$# " 0B@0ќ  !@$,b $, !(! $P  !# <4Bb$# " 0B@ 0ќ  !@$,b$b ! (! $P  !# <4Bb$# LDT &%hP  !$ !'(<'#!'@<840,( ! !@!$ !"! $" $ќ @ ! @$B,$B,B@'!$ "<4Bb$<<4Bb$<C% h@ !T`! 0! hP @ !h ,B|#ќ  ! @< 4Bhb$<b%  T`!! 0! hP  !h @$B8@LB,@&P`E !0!8!  (!Ҙ$ 8! @B$B,$C,$b,@ @ ! @ ! @!(!@ !0!&G0 @! @ ! (! @! $B` LD &E0 @$!P @ ! `$$@<840,('H<' t!'PLHD@<8(!,!$,B@!c($b$r@!c`$bKc(b&,dq '4(4 !(!@0!8! ( ! @(!&01$Q(!49Z$c+$ &e0&f`0!$u$D$ @!$(b?`97 !dq !` (@$d !` (@$ '9` ` !(A qq&, !@0! $(@! !c,$b$b,!$`d (@$$`(! 0!(^@!,B@$r@ $ !`(! 0!(@$`PLHD@<8`!'X<'!'D@<840,( Xќ! !! 0 @  !  !ќ @! @@(!  !`  !@!$ BU   ! N@!"PJ$HF,r $L, !&` 0! b$dT& , dT<͏`4ce!$c4 0! # 0b@4b" `&` !  (! 0!  ! % ` ! $(! 0! P  !  !DP@<840,( 'HD@<840,('H<'!'x|xtplhd` $!b!!@!X\$! ! $  ! @!T8 P&@"$@$ , $ @$$'(', '0 ,Ў% ! &', @!@$ '4" R+@M$g$4  `$%%$Ӵ$0! 8!@!"菼 @'8  !@!84C!T !90! `8! X ! (!  48$F0!`(! @8! \X$b $$ `(! $8%\@X`$$$8`(! 4(!8! !'9T@  8B#s@(d$ , $'<'@ 'D  ,A$d$ , $'H'L 'P ,$88|xtplhd`'<'!'䯾௷ܯدԯЯ̯ȯį ќ!@ !! 0 @U @ !  !ќ @! @ (!@ !  (! @ ! @ !@!$    ! `o@!$$C,b$b/B  !BE Bd B@@BB  !E @d @C,$be$B,@$  ! @ ! @!  ! @!$(! ! @!  ! `(! @ !  (! @B@{$B,PwVu7$\@(!*@$Y$i$S$cBW_C,d $L$B, !&E` 0! b$T&E B, T<͏`4ce!$c4 @0! B 0b@4b  ! @0!B @B8@@ `@0! ! (!  ! @(! @ !(! $,B@'̯$' !'' @8! @j  ! | !$x @! @@(!\ !$\ ' @  !|@(! '(- B%@0,  ! @)  ! @ ! @! @ ! @!$(!  !  ! `(! @ !  (! $ $ @@$@$,  ! @z$ ! @0!}, @ ! @x$C,pt$br$b,B  !BE Bd B@@BB$  !E @d @$EB,@B@ @ ! P,@ ! @!F (!@ ! @! @ ! (! #@, @ ! @$B,@ ! $@ ! 0!B @$B@$$B, ! @(! P @ !  !P 䏾܏؏ԏЏ̏ȏď'<' !'840,($  !! !D(!<$$  @!@! $|瘎D$x (!@!` !@ !(!0!  8! !,  !@@ !(!`0!  8!,  !@@ !4(!`0!  8!,  !@ @ !`(! 0! `8!,  !@  0B@ !@(!0! `8!] !,  !@ 0B@ !D@(!0! 8!G !,  !@@ ! 0B@ $$b @ !(!0! `8!,  !@ 8!,@ !(! 0!,  !@ @ !\(!0! `8!,  !@  ! @ !(!0! `8! !840,($ '@<' X!'tplhd`\XTP $(!!!0!'(',4D !''0 `8! @HD($)m8 ! `(! @o'4g(H(8'88+ ! `(! @@!4@ ` ! 4ќ @! @!` ! @(! 4<($  $4 @! ! / @!@_4@[$WT &e @4C4 ` ! @!@!(4'<'@'D !  4 (! @! ` ! @(! 4$(<8,@`(!  ! 4, @<4 D 4 b 4Bb z4 4B ì( ` !4 I, @B4 @! @(4 ` ! @! ` ! @!,(4$ (!  4 (! ` ! @(! 4,$ !C$ @( !t4 `0!!4@ ` !@! @ ` !@!,((!` ! 0! ` ! @(! XP4 !.b@  !,`(!0!$'9T@4$c(b@$,b$T@0!0! !$ "b@ b@ b@b @b(@$ $88,$( ! `(! $$( $ H@$, ` ! @e$ !Ҙ `0!@, ` ! @:$c,b6@%b@!$p$c(b ` ! p,` ! @!f (!` ! @! ` ! (! `, ` ! @$b,` ! $ tplhd`\XTP'x<'8!'840,($ Pќ!@ !!! 0@  @ ! h@!$b@9Q @ !$@! @!"R !"@ y(! !0! @! ! (!P !1@ ќ  !@ !(! @ !b@nB@j$C,pf$bd @ !P,@ ! @!yF (!@ ! @!@ ! (!J@$1*@$$$ ` !>B,@:$LD&E`0! B, !Ҙ @0!@ !(! $B@#0!@(!$'9x C($b` !@(! 0!B,$B,B@$B,` ! @(!P@ !840,($  '@840,($ '@<'!'d`\XTPќ!! !@D,,B@ @t $0@~$!&f$' &hT $ $Pd(' $ 8!c`#D @ D @!Dy(!$0$ @!D (! @!C$bD#@&$ P؎ , @ !EL $0 B@D@$$,b$$ , C 0b@4b@0b@4b@B PD d`\XTP'h<'!'ȯ0,($  !!0B@2!$$b- ! @!B c4B !`"B  @ ! @!y(!@ !$ @!@ ! (! ! (!0,($  '80,($ '8<'!'|xtplh !!!X$(!e$ '(  !`(!'( $ @#X !(!'X 8! @J$Xp`(!  Xќ X$,(! 0! , @ ! @-!ќX @&!H$(!8! , $@!'\'` 'd  ,X$ !@8!0!'9x  PX !|xtplh`!'<'!'XTP!!(!$'  $ ! (!' $  !$Ҙ0!@8! !XTP'`<'!'`\XTP!!!$#$쏥x '  $(!ȯ' $  !@@!$E , ! , !p `(!@!`\XTP'h<'!'XTP!!(!$'  $ ! (!' $  !$Ҙ0!@8! !XTP'`<'@!'ȯ0,(d! !,T '@$.@$$$  $ !!!"$0,(`!'8<'x!'h|xtp !H!!!n$$$0!$0 $ $ pd  (! @@!cb!b$Ўd'( @(! @$8d (!@! @$x@ !(! $ $"(t '( @00!'(&hT $ $0y $ !(!0! '( @!$"$'( ! $ s$Àd$ $@(! @ "'(` !0! 8! b@$ќ  !   !@!"y0!,B'( !(!   ! (! P  ! $"% ! $ -$cdLD!$c !c'(0! Q t '( @'Xd|$'hh0 0!  ! '( 0d'( @(! 0!Űd@(! !@!@!$ (!$d ! @0cX$b}{d  μ  @H$pd (! @9@!d@(! '( t '( @&f$0'(&hT $ $0d  '( @@!hd@(! '( Űd @(! @@!$1` $Ԏd  @(!$%`pd! @@!d  (! '( '($` !(!0!  d@(!h0! &1 dŰ@(!`!|xtp'<'D!'௿!-$\@ TЎ\T $T$C!DЮ $D!@``(!X@  !' <'\!'௿}! l       | T    &Td, d &d &|  !!' <'4!'|xtplhd`\X(!!! !$p0! 'H(@!xH(! $p(H !4<$E$(&FIdT|U@@, @T(H !<<$$ &( (H&( <$$  !(H !($ 0!(H@&<P$(8$l@(! $H"(@pa `@V!^!^!$S<$$(L`(! $H(@  !(H@(! $,b@8!q0bV@0b @2!$$-b$ (!8,B$! $B,B@!$ $b,B@$b!$l\$# '$@!c$C&,T!D@<840,('H<'*!'ȯ0,($ !'! !$B&0" @@@$D !lB$$@ $$b$" @$@$(@ !$P 'S $D !$4k $$B @ !  `0!>$$B@$$$ ,# $b($&&B,B@#"D &%  ! $ 0!D # b $B D  !$4l $0,($ !'8<'((!'Я,($ <!DD$30!' &00!<'A$4$DD A$$(@C#C!$   ,($ '0<''D!'ȯ0,(!<$(!0!8$$4!$ $ $$$ $!!d'  @!  $ "!0,('8<'&t!'\XTPLHD@<8 $!!!,@!D8!$ 4j A !(!0!'9Wt $ !@{$pDl(! $ Dl@(! @! P@!\Dl(!$#'(  (DlP"',$(H(! 8! @!,$&%D , !D8! $ @B@!Ô ! $ P1 ! $ 0! *#p`-$b!+# p(b@$`  $w$b$$p $  !(!0!'9Wt 8!  !0!$D&0 (!$ bh$0DD` &'<<0! $4 A $ $<0! $4( A$<$$@D#D!b#@`(!$ < GH!5JXGÏD`$[ 0!8*8! @!  @(!DlP',%$(P(!8!  Dl'0P$(X(! 8!0 @ $,$ !" $ $}D (! p$$!D8! !$ $" Wr!$o" b$',DlP(!$(` 8!,@!$ bm! @g7 D &%  !$  0! X'9[  !MpN# ,b @I<$c)C!B\!@$($<$$ !(!" $  ,!@$!$ $ -$$*! !(!$ "  !(!$'9] @!$" (! !'9] $! @!@  !0!$ !$!\XTPLHD@<8`!'`<'!'XTPLHD@<8 !!$#!#$b$ b$  0! 0@ !$ '( @  0!(@ !'9Wt8 , @!G@ C ,b @A<$c)C!B\!@$#$(b$bT8b(,Bl%\$B$\ ', A &Vl% ܐ $\ , <@ ! $4@ l@(!Ӵ0! 8! l'0!@(! @! @ !'9\  (!@! @0 ` !<4BB@b`$[@0!  @ !$B D%'9Rp ` ! !P(!#$ b` !&'9U (! @ !'9\  (!@! ~$!1#$!b-dlԎ(% 0! @ !'9\  (!@! e$!#$b&` !'9U (! @ !'9\  (!@! L$!dl%$$dl%$zt" @p#$(b$bjdl%\$2 '0 @0 F (!@ !'9Yt $ @]@!$B $XL#$bHdlԎ(% 0! @ !'9\  (! @B@!$?B 3" @/ @@ !(@$P '4 @@ ! 4 $  @$  0! $B F@ ! (!'9Yt $ %@ ! 0! @!dl%$$ !$!XTPLHD@<8'`$@!@$`!<'P!@$Dl <' !'ȯ40,(`$! (!0!8! ! !p @(!@(! !t' @8! @(! !ܐ$8!  ܐ !@(! 8!@!!40,('8<',!'840,(p!$l(! !$l@(! @!$B,B\(!$#@ ' $l c C@!$@!840,('@<'h!'௿$! $ b&  !' <'!'د$ <!DD$4P 0! 'A$d$@C#C! '(<'|!'840,(p!$l(! !$l@(! @!$B,B\(!$#@ ' $l c C@!$@!840,('@<'!'௿$! $ b&  !' <'P!'د$ <!DD$4\ 0! 'A$d$@C#C! '(<'!'840,(p!$l(! !$l@(! @!$B,B\(!$#@ ' $l c C@!$@!840,('@<'!'௿$! $ b&  !' <'!'د$ <!DD$4h 0! 'A$d$@C#C! '( <'!'ȯ0,(!<!$ !0!8$$4tb!$b!'  `@!  $ "!0,('8<'h!'ȯ40,(p(!$l !$l@(! @!$(!P8!C$(p$l'   $b$b@!$@!40,('8$, !$$$ b ``<'\!'ȯ0,(!<$!0!8$$4x!d'  p@!  $ "!0,('8<'!'@<840,(p!dl! (!dl@(!@! !@(!'  ! @!$(!P8!$(xdl'$ $$b$ T$b! $b!$!@<840,('H<'!'840,(!'  !(!$#`8!@($Dl Dl@(!`$]8! @!Dl@!P'$(!$(8!  $D` !  8!c `@ !$$b$b 840,(!'@<'!'Я($ p!l!(! !@(!@$l @!$4@ !`(!b 0!` ,d $@! @!$@!($ `!'0<' !$$@@(!l <' x!'Я,($ <!$D& $4|0!' @0!'<A$4$d$D@C#C! BA,($ '0<' !'ȯ0,(!<$,!0!8$$4!D'  @!  $ "!0,('8<' !'LHD@<840p!dl! (!dl@(!@! & ! (!'  @!$B!@.!.B@*$dlP'$(!$( 8! R!$$B,B@!$ b!dl\(!$# '( (C!$!LHD@<840'P<' !'د$ <!DD$$40!  'A$d$@C#C! '(<' !'ȯ0,(!<!$d !0!8$$4b!$b!'  X@!  $ "!0,('8<' T!'840,(p!l(! !l@(! @!@!$b' `",b@  (!$#lP (!$( 8! $db$ l\ '$c$C@!$!@!840,('@<'0!'LHD@<840!$$!$&E! !@ !(!'  !@U$$'$.@$$`(!?$('(;$瘎$l $( @ !$$*$lP`(!$(8! $l@(! $($$lP`(!$( 8!( @ !$8! "P@0!  @ !@ !LHD@<840`!'P<',!'Я,($ p!$l!(! !!@$܎$l @(!$C@0!@,B@$B @ C !P@ !(! `8!@!$!,($ `!'0<'<!'LHD@<840!$$!$&E! !@ !(!'  !@U$$'$.@$$`(!?$('(;$瘎$l $( @ !$$*$lP`(!$(8! $l@(! $(ȏ$$lP`(!$(Я 8!( @ !$8! "P@0!  @ !@ !LHD@<840`!'P<'8!'Я,($ p!$l!(! !!@$܎$l @(!$C@0!@,B@$B @ C !X@ !(! `8!@!$!,($ `!'0<'H!'LHD@<840!$$!$&E! !@ !(!'  !@U$$'$.@$$`(!?$('(;$瘎$l $(؏ @ !$$*$lP`(!$(8! $l@(! $(菼$$lP`(!$( 8!( @ !$8! "P@0!  @ !@ !LHD@<840`!'P<'D!'Я,($ p!$l!(! !!@$܎$l @(!$C@0!@,B@$B @ C !@ !(! `8!@!$!,($ `!'0<'T!'د$ $!$ b& $$ !$$ 8! $ !'(<'!'840,(`!l$# 8!l@(!`$]8! @!l@!P'  (!$( 8! ` !D@8! $840,(!'@<'!'@<840,(!$$! & !$!.@$$@(!B$)'$>$瘎$l $) !$$$+$lP' @(!$)8! $l@(! $) $lP@(!$) 8!$ !$$8! !! @<840,('H<'4!'د$ p!l(! !@!$܎l @(!# `@0!$b $$$l ! @(! $,B@ !$ @(!@!$ `!'( <'D!'ȯ0,(!<!$ !0!8$$4b!$b!'  @!  $ "!0,('8<'!'ȯ40,(p(!$l !$l@(! @!$(!P8!C$) $l'   $b$b@!$@!40,('8$ $b !<'!'ȯ40,(! ! !' @0!p !$ @(! !0@'$E  ( !$@$$`!  $l (!$ 40,('8<'!'@<840,(!!  !c@!$b,B@$$db$b ' p' @ !`(! 0!$p@ !`(! 0!$ @@!Q0e@ ! '$@$cb$($  (!@!$l  $!@<840,('H<'`!'LHD@<8!! '02 $B&3$3.@$!|A!x0Rt ! $ 0! !Ô $@g!c $$, !'(  $g  !D$ $Op 0$b ! $ 0!0RA ! $ 0!:!0$b$0 !$ '44@ BR ! $ 0! 0$b!D !$4 $@$@b@$$,( $ ! ' !LHD@<8`!'P<'!'D@<840 !` ! ! B&Pܐdl$ @!  0!$Bp'($(!@ !  @ ! @! @ !03', $ (( !$A$dl (! ",`! @!,@@ ! @C`` @0!<4BB@bd  B$B T @ !! D@<840'H<'!'௿ $$@ $$b @8!!' <'!'HD@<840 !` ! ! @!'(p !$(! @0! @! !@>&4 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @`H`  0!<4BB@bd  "$" T  ! !HD@<840'P<'!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @#`H`  0!<4BB@bd  "$" T  ! !D@<840'H<'P!'௿ $$$!@$$b! @!l !!' <'!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @#`$`  0!<4BB@bd  "$" T  ! !D@<840'H<'!'௿ $$$!@$$db! @!l !!' <'h!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @#``  0!<4BB@bd  "$" T  ! !D@<840'H<'!'௿ $$$!@$$b! @!l !!' <'(!'Я($ !L$$  $$ !$$b8! "P ! $@0!  ($ !'0<'t!'Я($ !L$$  $$ !$$b8! "P ! $@0!  ($ !'0<'!'Я($ !L$$  $$ !$$b8! "P ! $@0!  ($ !'0<' !'ȯ40,($!!,@$$$/$+ '  X& ' @ !%0 '$ @0!($ $$Dl $40,('8<'!'`\XTPLHD@!$!8&T&E! !@X!$"."@$$"`(!B$")'<>$瘎l $)(@ !$$$+lP'8$)08!`(! l`(! $)88lP`(!$)@ 8!<@ !$$8! @!$$b@ !:C 0! $$"."@$$"$$$" $8 @ !$' $04(,$8$ $4$0$(,@ !' $ @! @ !$ 0!@ !`\XTPLHD@'h<'!'د$  !$`L!(b@H$bH!$b$b,B@ @$(f$8  !,@!$b%$b"$  !@@!$B @$b !8 $ !$  0!!$!$ '(<'!'ȯ0,($!!,@$$)$%$ '  X& ' @@!0% ! '$@$($  $@!`!0,('8<'!'\XTPLHD@p!$l !l@(!`$]8! @!l@!P'8$)H@(! 8!8$"$b @ $D8!` !$ $@!$;b "8@(!\l$#'< <8D` !8! $$D@!@$$b$0(,' ` !$  4$$$ 04(,` !' $ !c $!\XTPLHD@'`<'߈!'د$ p!l(! !@(!@$l @!$֜@ !b (!` ,d $@! @!$@!$ `!'(<'޼!'௿ $b (b@$`%$"b$$b$@  $b $@ $$' <'!'ȯ40,($!!$,@$$$/$+f f'  eX ' @ !0 '$ @0!($ $$Dl $40,('8<'ܸ!'\XTPLHD@`!$ld8!(! $#$l@(!`$]8! @!$l@!P'd(!$)P8! d !D$ @8!$@!&U!@$$b$dbi@e<$@ $4$$4 !0 ($l@(!Ӵ0! 8!$l@(!\$'8 @!$l8ܐ`(!$ $l@(!`$6= 8!@!@@!$lܐ`(!$6=8! $l@(!@8! 0!`$l(!$ 8!@@!$lܐ`(!$8! $l@(!@8! 0!ܯ4 ! ' ) 8$  !$' $40(,$80 $$$4(, !' $  !$  0!! !\XTPLHD@'`<'D!'@<840,(p!l!(! !l@(!@! &TC $e+@8!(b@$`-$b+$)'$\l (!'  $#l'$P (!$)X 8!$ 讅B@ ! `0!C$@ !(! `0!@ !@<840,(!'H<'!'@!<@!$4 !$l@(!Ӵ0! 8!$l@(!`0!$0'9r @!$l`(!`$9 8!$l@(!ܐ$98! @!$l8!0! @(!$l`(!`$ 8!@@!$lܐ@(!$' 8! $l@(!8! 0!`$l`(! $/' 8!@' |$l@(! $@ @8!$lܐ' @(! $/'`$l`(!$ 8!@@!$lܐ@(!$8! $l@(!8! 0!'<'Մ!'LHD@<8!<@ !$4 !$l@(!Ӵ0! 8!$l`(!\$'0 @!$l0ܐ@(!$ $l@(!`0!'9r $0ӏ$l`(!`$+ 8!@@(!$lܐ$+8! $l@(!0! @8!`$l`(!$$p 8!@@!$lܐ@(!$`8! $l@(!8! 0! `$l`(!$/' 8!@' |$l@(! $@ @8!$lܐ' @(! $/'`$l`(!$+ 8!@@!$lܐ@(!$+8! $l@(!8! 0!`$l`(!$+ 8!@'|$l@(!$ 8!@ @8!$lܐ@(! $+`$l`(!$ 8!@@!$lܐ@(!$8! $l@(!8! 0!LHD@<8'P<'!'@!<@!$5 !$l@(!Ӵ0! 8!$l@(!`0!$0'9r @!$l`(!`$9 8!$l@(!ܐ$98! @!$l8!0! @(!$l`(!`$5 8!@@!$lܐ@(!$*8! $l@(!8! 0!`$l`(! $ 8!@' |$l@(! $@ @8!$lܐ' @(! $`$l`(!$ 8!@@!$lܐ@(!$' 8! $l@(!8! 0!`$l`(!$ 8!@@!$lܐ@(!$8! $l@(!8! 0!'<'h!'\XTPLH!Pdl$)`&P'8 !@$ҏ8b$b$ҏT$d $0` !(!'< (<@ !4 ' 8$b$bJ$ @ !$ 0!$ $'@0@ !(! (@@ !'  4@ !$Ô @!<@` !$ $0(!'D (D@ !4 ' (@!(! 'DD@ !D$ $dlD$  !$ (!@ !'@( 0@@ !4 ' @!P  !\XTPLH'`<'!'`\XTPLHD@p!$l! !$l@(!`$]8! @!@!$&U"! @ !$ 0!@ !Ô $@ $ 0(4@ ! ' D`8!@ !$ $D@ D@ !$$ `8!@!A$$l\(!$# '88$$$'&$ $@ !' 40(, $@ !@ `(!$ $4$$0(,@ !'  $!C !`\XTPLHD@'h<'ʤ!'@<840,(p!l(! !@!!@2$܎l @(!l@!P' @(!$)h 8!$"$ ."@`! $ @$ $ $b `! ! (!@!$`!@<840,('H<'\!'<840,($ $!!$b$ $/*@$!ym$u!@p$`Dl$ 8!A Dl%gܐ $b$Bb@% ` !Dl%$K@!@" $gDlܐ%$+ b$Bb@% ` !Dl%$ @!$+" @$(P& (!` ! 0!@!$!瘎Dl $)p` !@ @(! @!Dl$ !!<840,($ '@<'!'D@<8!L$$ & $b3$B8! !$@$ @!$b !" "P $@0! D8$$$$ '  !$40( ,"P ! $@0! D@<8!'H<'Š!'د$ !L$D  $$ !$$b8!  $ !'(<'!'ȯ0,(p!l (!l' \@(! $## 0,(C&,B'8<'Đ!'௿$! $ b&$b  !' <'!'Я($ <!D@ $5$0!' $Q0!'<A$50$dD@C#C! "A$d( @C#C!"$'0 <'8!'ȯ0,(!<!$e !0!8$$5<b!$gb!'  Ϙ@!  $ "!0,('8<'Œ!'ȯ40,(p(!$l !$l@(! @!$(!P8!C $)$l'   $B,B@@!$@!40,('8<'!'LHD@<840$!$' !! !!@w$$"#."@$$"l$"Gh$ &El`(! $) @ !$h $O &El'$P8!`(!$) l@(! $)$ @ !$h 8!P@,@ @ !0! $%! &El'(P`(!$)8! ( @ !$h 8!P@0! @ ! $@ !LHD@<840`!'P<'X!'HD@<840!$$!$&e! !(!` !'  !@V$$B.B@$$B(!K$B3'(G$瘎$l $) ` !$g $5$P$l'$8!(!$) $l@(! $)$ ` !$g 8!` $lP(!$)8! ( ` !$g 8!$b !HD@<840`!'P<'X!'Я,($ p!l!(! !!@6$܎l @(!@0!$-@!),@'$# b(b@$`$@!b@!@!#$gb ! 0! $@! !p !(! `8!@!$@!,($ `!'0<'!'<840,(! ! !@!' p !@0!$ `(!@! !0@#'$2be$ " ( !$A$l (!!$`! @@!c$eb$" !<840,('@<'!'D@<840 !` ! ! @!'(p !(! 0! $ @Z@! !   !0', & (A0!$dl $ =(, $ @6@!,  ! @/$gb#`!<4BB@bd`0!  $#`!<4BB@bd`̰0!  $ T  ! @!D@<840'H<'!'௿@:! ,b@5<$c*C!B\!@$eb $gb%$$e$fb l$$hb   @!l$$ !$!' <'!'د$ !L$D  $$ !$$gb8!  $ !'(<'$!'Я($ !L$$  $$ !$$hb8! "P ! $@0!  ($ !'0<'p!'ȯ0,($ !'! !(!$@$)Ȏ$l @ !D@8! `0!@!$eb$B @ 0,($ `!'8<'!'ȯ0,($ '! !@! !0@'e $( !$@$`! @!Dl (!# $b$" !0,($ '8<'!'840,(' ! !@! !0@'$e $ ( !$@$$`! @!Dl (!# $b$ " !840,('@<'!'\XTPLH!'8! !!@j$瘎dl@(! $)Џ8$D$4( 0@8! ! 0!A@!Q$R& !@$bF!J& !,'  '<@?@!08 ! '@<@!0!(@ $@/@!$g%$*" &'<,'  $ҏ@@!08 ! '@<A0!$dl $!(@ $@@! $g$$" !\XTPLH`!'`<'!'<840,(p!l!(! !l@(!\$#'  @! lPB'$ (!$) 8!C ,b@/<$c*C!B\!@$$eb$g@ !(!`0!$eb@ !(!`0!$g$$fb@ !(!`0! $f$$hb@ !(!`0!$h <840,(!'@<' !'ȯ0,($ !Xf' !@! !0@'e $( !$@$`! @!Dl (!# $b$ " !0,($ '8<'!'௿!@3! $(@$+$'!$l ! @$$g @$hb !bA @!$!' <'!'840,(p!l! (!l@(! @!$ (!\$# H!lPC'$' $) 8! $ub$$sb $c ! C$$C !840,(!'@<'!'Я($  $!,d$C&& &$ !$ 8! $b$$  &  ($ $'0<' !'<840<!DD $5D0! 'A&0$d<@C#C!DD"$5P0! 'A$d<@C#C!DD$5\0! ' A$d <@C#C!DD$5h0! '$A$d$$<@C#C! DD$+$$5t0! '(A$((<840'@<'X!'ȯ40,(<!DD&0$50!'  0!'<A$5$dDD@b#b! #0!' <A$5$d$+ $@C#C!DD 0!'$<A$5 DD  A$$$4$,(40,('8<'!'ȯ0,(!<$+!0!8$$5!$t$.!d'  \@!  $ "!0,('8<'@!'ȯ40,(p!l (!l@(! @!$ (!\$# H!lPC'$' $) 8! $+b$$tb$.b$-b $/ ! C$$C !40,(!'8<'(!'Я,($ <!DD$50!' &0!<'A$5$"DD A ,($ '0<'x!'ȯ0,(!<!$u !0!8$$5b!$,b!'  h@!  $ "!0,('8<'!'ȯ40,(p(!$l !$l@(! @!$(!P8!C$)$l'   $ub$,b@!$@!40,('8<'!'\XTPLHp!$ld (!$l@(!\$#'8 @!$l' l(! $* @ !$/ $&@  &El'$P8!(!$* l@(! $* $ @ !$/ 8!B $!D@<840,(`!'H<'!'D@<840,($!$' ! !&%$&5@B! $(!.CB$*(`3.F1'$8!l   !$- $$Pl(!$*0 l@(! $*8$  !$- 8!$" $!D@<840,(`!'H<'!'D@<840,($!$' ! !!$@I&T$&E".#`@.&> l(! $*@ @ !$. $&@  &El'$P8!(!$*H l@(! $*P$ @ !$. 8!B $!D@<840,(`!'H<'8!'HD@<840 !!&` ! !. B`4&U<$c*0C!B\!@C Fp'(@ !(!$ +@! @ &10$@ ! ', (@0!(,  (!@!$ " , @ !dl$ $ C $b!$B Fp'((!@ ! $ @@!0@ !$Fp'((!@ ! $ @@!0@ !$ ', (@B0!(,$Fp'((!@ ! $ @@!0$@ ! ', (@*0!(,$ @!Fp'((!@ ! $ @@!0$@ ! ', (@0!(, $ ,@ ! $ @!dl$ $Fp'(@ !(! $ @0$@ ! ', (@ 0!(, $ @r$$dl i$<@` ! $5쏼 dl@(!Ӵ0! 8! dl@(!(8!$*X @! $` !  (!p@0!@ !$ B @! @ ! 0$0@ ! ', (A0!$dl $ !(, $ @@!, @ ! @`@0!<4BB@bd`,  BT$B  @ ! !$!HD@<840`!'P<'!'HD@<840,(p!l$!$(!! !@ !(!'  @!&T!@n$$.@g.@e2 &E$tb@ 瘎l (! $*`l@(! @!A@!$u$$B bC B  $@ ! $/ &E$$$ '$lP (!$*l 8!@!瘎l (! $*t$ @ ! 8!P@ @ @ !0! $!$!HD@<840,(`!'P<'`!'D@<840,(!pl!(! !@!&t$ S$܎l  (!@0!$' H@!,@D$.lP (!$*| 8! $ub` !|(! 0!*$sb,@!D` !$$s$b,b/@$/$+b $-b $b $tb ` !x` !` !` !(!8! @!$@!D@<840,('H<'!'Я($ !L$D & $$ !$b8!&  ($ !'0<'!'Я($ !L$D & $$ !$$-b8! $" ($ !'0<'\!'Я($ !L$D & $$ !$$.b8! " ($ !'0<'!'Я($ !L$D & $$ !$$/b8! " ($ !'0<'4!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @#``  0!<4BB@bd  "$" T  ! !D@<840'H<'!'d`\XTPLH !!$B,B!!$@[$ '8@T$pDl(! $Dl@(!\$#'< @!!'د$ <!DD$6< 0! 'A$d$@C#C! '(<'> !'Я,($ <!$D$6H0!' &0!<'A$6T$d$D@C#C! A$d,$@C#C!B ('0<'=,!'ȯ0,(!<!$j !0!8$$6`b!$ob!'  `@!  $ "!0,('8<'<!'ȯ40,(p!l (!l@(! @!$ (!\$# H!lPC'$' $+ 8! $jb $$o ! C$$C !40,(!'8<';!'D@<840!' ! !@$P $+$$b$ $b$$ &E$@ !$$k 8!L$$b$ P $$ &E"P@\$R $b $B,B@N0$$b-$ $B,B@'$"P@A$$ &E@ !(! '$$$0b#@ !(! '(@*$(T&@ ! (! 0!$$$b$ &E"P@$ @ !$ 0! P @ !$ 0!@ $D@<840`!'H<'8!'Я,($ !! &%$B$P  !$0!`"  $ !$$p $ B  !P $@0! ! $,($ '0<'7!$(D <'7!'Я,($ <!$D$6h0!' @ &P0!<'A$6t$d$D@b#b! C0!'<A$6$d$D@C#C! A$d$(@C#C! ,($ '0<'6!'ȯ0,(!<!$k !0!8$$6b!$nb!'  @!  $ "!0,('8<'5!'ȯ40,(p!l (!l@(! @!$ (!\$# H!lPC'$' $+ 8! $kb $$n ! C$$C !40,(!'8<'4!'Я,($ !' !@$ $b$BC $@&$  $,($ `!'0<'4@!'د !$8$ $&<  '(<'3!'ȯ40,(p!l (!l@(! @!$ (!\$# H!lPC '$' $+ 8! $$p ! C$$C !40,(!'8<'2!'840,(!D!&e !(!` ! '  (!p@ $Dl Dl@(!`$]8! @!Dl(!\$#'$ @!$ Db` ! 8! $p@!840,(`!'@<'1!'840,(!D! &e !(!'  ` ! (!8!P$@$+Dl'$ Dl@(! $+$ ` !$k 8!@!840,(`!'@<'0!'840,(!d!&E !(!'  @ ! (!$@$+dl  $@ !$k $@ !840,(`!'@<'/!'@<840,(!$$!$&E! !(!@ !'  !@8$$`(! $+ȏ$P$+8!($$l  @ !$j$$l'$ $l@(! $+؏$ @ !$j8! @ @ !@<840,(`!'H<'.d!'Я($ p!l!(! !@(!@$l @0!$$ ,@  !" `(!@@8! @!($ `!'0<'-!'Я,($ <!D$60!' &20!<'A$6$dD@C#C! "A$d, @C#C!B ($'0<',!'ȯ40,(p!$l (!$l@(! @!$(!\$#' C !$l C C&,D40,(!'8<'+!'840,(!!&% !lp `(!@(!@#$l @(!8B'  ! ,R`(!$@$+l $@8! !$ $l !840,(`!'@<'*!'840,(!!&% !lp `(!@(!@#$l @(!8B'  ! ,R`(!$@$+l $@8! !$ $l !840,(`!'@<')!'840,(p!l!(! !l' P8!$+@(! "$@&'# $8 !`(!b @0!@ $# D !`(!b@0! @@!840,(!'@<'(!'Я,($ <!D$60!' &Q0!<'A$6$dD@C#C! "A$d, @C#C!"@ $('0 <''!'ȯ0,(!<$,!0!8$$6!D'  @!  $ "!0,('8<''@!'ȯ40,(p!l (!l@(! @!$ (!\$# @!lPC'$' $+ 8!@ ! $B,B@ $ !! C$C$ !40,(!'8<'&8!'HD@<840 !$$!,&E ! (!@ !'( &P! @b$p$l `(! @[$܎$l @(!@!$ b,b@L,b@J',$8!瘎$l`(! $, (@ !$n $ `!<4BB@b$`@0!  &BP$l`(!$,  $l@(! $, ,(@ !$n8!  @ @ ! $ 0! @ $@ !HD@<840`!'P<'$!'hd`\XTPLHp!$l!(! !$l@(!@! &W$CS$$lP'8(!$, 8!8$pb!C $b(!`0! @ !@ !$ 0! @!y!$pbv!C $br!P$l'<8!$, (! $l(!瘯@ $,(<$p$4'@ $(,0@ !'  $@!@GP P  $h(!0! @ !@!$9B 8!h(!0! @ !@!@ ! $ 0!(@ !0$ 'D@!8!P P$l$,0 $lp @(!D@0!`@ ! @@ $l$ @!$!hd`\XTPLH'p<' !'`\XTP !'@ ! 8!(!P&q$,8@6$Dl'D  HD瘎Dl(!$,@ " $p&  ',0 ! $ (( !$A(!dl (! ",`! @!,@ ! @`` 0!<4BB@bd  $ T  !  !HD@<840'P<'!'HD@<840 !` ! ! @!'(p !$(! @0! @! !@>&  ',0 ! $ (( !$A(!dl (! ",`! @!,@ ! @`` 0!<4BB@bd  $ T  !  !HD@<840'P<'T!'௿!@$$lXb$ @0!$ $mb! @0!!`!' <'!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A(!dl (! ",`! @!,@ ! @#`H`  0!<4BB@bd  "$" T  ! !D@<840'H<'$!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A(!dl (! ",`! @!,@ ! @#``  0!<4BB@bd  "$" T  ! !D@<840'H<'!'HD@<840 !` ! ! @!'(p !$(! @0! @! !@>&  ',0 ! $ (( !$A(!dl (! ",`! @!,@ ! @`` 0!<4BB@bd  $ T  !  !HD@<840'P<'!'D@<840 !` ! ! @!'(p !$(! @0! @!@> ! 2 ',0 ! $ (( !$A$dl (! ",`! @!,@ ! @$#" `| 0!` !<4BB@bd  "T  ! !D@<840'H<'P!'௿0!@!$$j 8!b $ @ @!l! !' <'!'ȯ40,( ! @!' @!! '   !0@'$%  ( !$@$$`! Dl (!$40,('8<'!'TPLH!'8 !(!p@:$$l $l@(!\$#'< @!<$lPB'@$,H(!8! $l(!`$] 8!8@D@ ! @8!@!$$@ !b ' $ү0($4  ,@!TPLH`!'X<'p!'840,(p!l!(! !l' P@(!$,P 8!  !$B,B4`(!@0!@$ @!840,(`!'@<'!`$ <'x!'840,( ! @!' !@$! '  $0 !@'$  ( !$@@(!$`!  dl (!$ 840,('@<'h!'௿@$nL $ H!$ 0!b  !l!  $b$ @0!!' <'!'D@<840 !@!'( $#@! `!<4BB@bd`H 0!  "$ " '(  @! $',0E  ! (@(!(, (!@!B @!  !$ 0!dl$ $ !D@<840'H<'P!'PLHD@!'8 !(!p@0$Dl Dl@(!`$]8! @!Dl(!\$#'< @!<8D` !$kb  8!@!$$` !b ' $ү0($4  ,@!PLHD@`!'X<' !'<840,( !!@@ $ ' @! '  @!" @$$"   !E0 '$ @0!($ `(!@!$b!  !$ 0!l$ $!<840,('@<' !'ȯ40,( ! @!' $@!! '   !0@'$%  ( !$@$$`! Dl (!$40,('8<' !'<840,( !!@ $'  $@!$B '  X(!0! ' @!$@ @ !0e '$ @0!($  (!@!$l $$"! e@ ! 0!!<840,('@<' !'TPLHD@!'8 !(!$p@0&tDl Dl@(!`$]8! @!Dl(!\$#'< @!<8D` !$j  8!@!$ʬ$` !b ' $ү0($4  ,@!TPLHD@`!'X<'T!'<840,(p!$l!(! !@!f$܎$l (!@ !$C,@,$$V`!@S$C$\$l(!$#'   $lPB'$$,X(! 8!$$jb@ !$obD@ !(! `0!+$b,B@)$`$l(!$] 8!$@ !D@8! $E $$D@ ! $D d$$D@ !$ @!`!<840,('@<'D!'௿ `8!$$obʬ !$ob!@ $Dl $$ktb$pb$ @8!!' <'P!'Я,($ L$!$ &($lEP8!$,` $lp @(!$l@(! $,h !@8!D$ $o$lE$ $B,($ !'0<'P!'\XTPLHD@!pl! (!&U!@s$܎l @(!C @!$b&E<&E8  &E@ ! (! '8@T$$b.b@C.b@A$n5$<@ ! $6̏l@(!Ӵ0! 8!l@!(& $,p (!$ $@ !$$o $@ $$n $,40($l  (! @ $ $40C ($,$@!T@ ! ' @!!\XTPLHD@`!'`<'!'TPLHD@<8 !@ ! ! DlP@!'($,x 8! @&3|Dl(@(! &'$ b@$$p', !(!0! $ @X@! ! 5 '00  ! ,A(!$Dl $ =(0 (! @6@!,  ! @/b@c`!<4BB@bD`ր 0!  b$$c`!<4BB@bD`̯ 0!  b $" T  ! !TPLHD@<8'X<'!'௿0!@!@&$ $$kb$$nb @T !(! ' $$l $!4t$! b $$l  $$o!  @!!' <'@!'`\XTPLH!'8 !&@g$瘎$l$, (!$l@!P'<$,(!8! <8D$b(p@8! ! $nPF@!$lP'@(!$, 8!@ |$l@@(! &$<@ ! $6̏$l@(!Ӵ0! 8!$l@(!ܐ$8! @!$l&$ܐ'D@(!$" $$ T$ү0($4, ! ' @!`!`\XTPLH`!'h<'(!'D@<840,(!pl!(! !@(!&V!;$܎l @!$" 0`!."@-`!pl (!l' P@(!$, 8! $kb$n @ b`!B $B,B@ `!ـ@ !(! 0!@!`!D@<840,('H<'!'د$ !L$D $ !$$n 8!  ! $ 0!$ !'(<'!'د$ !L$D $ !$$p 8! $ !'(<'!'د$ !L$D $ !$$j 8! $ !'(<' !'د$ L!$D $ !$$k 8!$ !'(<'!'Я,($ !L$$  $  !$$k $"P ! $@0! $B $"P  !$@ 0! B&8$ ,($ !'0<'!'د$ !L$D $ !$$l 8! $ !'(<'(!'د$ !L$D $ !$$m 8! $ !'(<'!'د L$8! P ! $@0! L &% !'(<'!'ȯ40L!$$dl 8$$ $b$ :$#$b7!D ߴ @$"@ !$ $' 40($,'9@ !  (!$ b$F!'9  @!$dl% $!!TPLHD@'X<' !'Hp!l!(! !l@(!$ &u@!Q$p  *@$$` !` !(! 'p@$p$$cb$q$$&ex |(!` !'t !@s$$B.B@$P$i!B'$ @瘎$l$, (!t` !$ $R!Mr $ $$$0(,a`!<@ ! $7$$l@(!Ӵ0! 8!@!瘎$l(! $-@*@!`$l@(!$0 8!$l(!\$'xx @!$l@(!|$ '8@(!$lܐ$08! $l@(! 0!$lܐx'8@(!$쯢 ` !' '9 4@!$뮢p$l (!$l@!P'|$- (!8! $l(!`$, 8!|$lP(!$- 8!t` !$ 8!` !(! 'p@$pQ$ cb$q$$&e (!` !' !@$ ` !P,.B@$U(!$BW$$瘎$l $-` !$  $"P@` ! $ 0!"P@e` ! $ 0!]$` !'@@TPHD'9 L@$D` !$ $p$l (!$l@!P'$-$(!8! $l(!`$, 8!$` !'XXh`\d'9 l@$D` !$ $$lP'(!$-, 8!` !$  8!T`  ` !!`!'<'!'@<8!$LD $ $ !b ' $ $'9Я0($, 4 !$D4@ $  !$$ 8! @<8!'H<'!'<8!L$D  $Ô !b)$ $ !@' $ $'9Я40($ , !$D4@$ $ !$$  8! <8!'@<'!'<840,($!!$,@$$$$$$f' $f'  @! $eXF' $ @!"  ` !E0 '$ @0!($  (!@!$"` $` ! $l$ $!<840,('@<'`!'D@<840,($!!!$,@$$$K$GF' $F'  @! $XEf' $ @!'$0e  ! @(!($  (!@!$l $$ P@$  !$ 0!$B @$ !D@<840,('H<'Ơ!'௿ ,b@z$<$c*C!B\!@@l$$ b_$1@ $ $b^$ @57b$ bQ$$@J$$bF @B@ $b8$$ b3)b.$ @ $ b&$'9pA$yp$$yp$@$$b$B,B@ $'9@ @0!$!' <'Ā!'Я($ !L$ # $b !P $@0! $ ! $$  8!($ !'0<'!'tplhd`\XTP!|'@ !!&Q!!@$`l(!$# 8!l@(!`$]8! @!l(!\$#'D @!l`(!\$'H lH|@(! ' @ ' @!&W (!!B @$@@ !D$"$0$(,'($<8'9 4{@! | $D@DB`8!"@ ! $ @W@8!C `$$bP8$HI$" >A<'($$ @ !(!$'9询(04< 8$ (!@ !(<8'9 0C $b$$P@@ ! $ 0!@ $$ @ !'($(8,04'9 <$$G $$! (!P@@ ! | $@ !tplhd`\XTP`!'x<'!'TPLHD@ $!!$,@$$$$$$A !<@ $74 $l@(!Ӵ0! 8! $le\$ '0 @@(!|$l0 '(  '( B 8`F $~| '(  '( $leܐ'(@8! $쏼 `$le$0 8! A$0Ž$leܐ8!  $l'@(! 0! F !`(! '4C@! `!<4BB@b$`$0!  $ F'4 EXf '4 @! 4 !e0 '8 4@0!(8 $ @!$$l $ !TPLHD@'X<'!'௿ $@!f8!(b@$` S$b0$bO$L@H$bD'9 :@:$$b6 @$$b$,A$ !(!'9@$F @$$ b$A$ !(!'9 @ !$!' <'0!'lhd`\XTPLHp!l!(! !l'8P@(!$-4 8! $b$(b@$` !b$b$ $8$ b.b @&b$b !,B@ !(!`0! !(! '<&!@$`Dl (!$# 8!Dl@(!`$]8! @!Dl(!\$#'@ @!@!Zm$v!T*.@$/$($+!I!*/@$P!A*l@$n$gh*h@$h$R$T#!1$j!+*n@d$pS*p@*$t!"h@ 9h@ !0! 8!` !䏙@ !E '8  !b ` b`!<$6"x@ 9x "|@ 9| @ !D  ' ' < $@@!"@  9@ !0! `8!`!!D  ' ' < $@̏@!"@  9@ !0! `8!`8D  @ "L@! '9L@ !0! `8!@!(B@s!`$o!$ @(! 0! !䏙h$jB$$ [䏙h8! !$$  !@ '8  !A!<$6` 8"@@6! 9@@ !0! `8!@!(B@'!`%8D( @("D@!P'(!$n0@ ! 8!@@ !|@(! ' '9D!"H@!P'(!$n8@ ! 8!@@ !|@(! ' '9H@ !0! `8!8  !<D $6`ì@,"P@! :l,c9P@ !0! `8!DH ' ' < $@菼@!"@& 9DH ' ' < $@菼@!"@  9@ !0! `8!u@HDD ' ' < $@@g!"@  9@ !0! 8!S@D !(! 8!I@!"@E 9 "@;! 9@ !.0!"@- 9" @" 9 "@ 9"`@ ! 9`@ !0! `8!!Џ̏ȏď'<'!'840,($ !!!P! '8 !' 8!@@!t@(! 0!q$C,b@<$c?C!B\!@< ! $7@ !Q< $6@Q < ! $4@ !Q< $4@!< ! $4@!< ! $4t@!< ! $4x@!< ! $4@ !Qh< $68@ !uQT< $5؏@m !< $38< ! $5<@V[Q$< ! $6`@ !tEF  !FC,< $6@6;Q4< ! $6< ! $7h@$+!< ! $6 @ !QD< $6 @QH< ! $6(@ QL8 ! $!`!840,($ '@<'~!'|xtplhd`!'`!(!$n@ ! (!@!$!.0! ! '  $ '0p !$0!$0b!  !p$0! $0p' @0! !$$@ (! !Ű &R@!`(! !$0 8!@ !@0! ' ' p !$0! $@!|xtplhd`'<'|!'د$ l! !!\ !@ !`! l@ !@0!  (! A@!$ !@!!!$ '(<'|(!'   p!! ! @!' t' 8!` !@(!  ` !< @(! @ !$ '( '(< $쏼 @ '(|'8` !@(!$ 8! (!$<\ $ d@ !<0!H$&(! 0! < $ @$'| 8!` !@(! $  !0!( !@(!Ӵ0! 8!( !@(!(8!$n̯ @!(""4h$+$$ (%"4@ '""($ '!(!D (d <@ $5쏼( !@(!Ӵ0! 8!( !@(!(8!$nԯ @!("h"4@`$u0! 8!(@(!" "(" '"(%"4@ '"(" '""(D"8E ("4h$4b0! 8!b((!$Bb"a@`䏙@"4E" "(" '"("4쏙@E '"(" '"b(@B" "y @ !@!(@6$4@(!8"4 b(@,@(!b@ "! y!@ ! '"("$\쏢!tE  !(b!<@d $Bu\b$> ``( !@(!Ӵ0! 8!( !@(!(8!$nܯ @!($h$$+ ! (!D (d <@ $5쏼( !@(!Ӵ0! 8!( !@(!(8!$n䯠 @!( !䏙h$uB0!8! (@(!b@e! !y@ ! '"(@$䏙@"4E '""($ '!(! $(!D <쏙@"4 '""($ '""(B`@w'!"4(! "( !< $B(@6$h"4$$ (! ("D (d <@ $5쏼( !@(!Ӵ0! 8!( !@(!(8!$n쯠 @!("4$u䏙h0!B8! (8@(!b@3! '"('"'"'"<!y@ ! 0! $B((@$"@$!tD\"EF h"4"㯢b@@(!! y!@ !'" '"(@@!"@$"h"4$.$ (%"4@ '""(@$<@d  $5쏼( !@(!Ӵ0! 8!( !@(!(8!$n @!(""4h$u0! $(@(!쏙@"4E '""($ '"ď"Ďd$(C`! "Ўy!@ !'" '"̏(@$"@!䏙@"4% '""($ '"Џ("Џ $(d <@ $5쏼( !@(!Ӵ0! 8!( !@(!(8!$n @!(""4h$u0!$ ("̏"4h$/$ $(R(!P$b@K! y! @ !(A@(!b`@<! y`!@ !0! $(0@(!Ӵ !(!0! 8!@!(! !ԌGt0! (!("4h$T$ $!(x`@(!$b!( $(@(!!(D $(@(!!@!""""쏴"菳"䏲""܏"`!'#<'8H!'@ \%o%#oL m JkoB)oc(,048<@D!!! !@! !!'H !(! 0! @t !$@0!' @! @(! $x $ @ !<<$E$B4$+0QR @t @ !<<$$B< $+X @ !<<$BD$  $BP ``0!<$F< $Bp Џ<$B$ 0! B@A$8` ! $ @:@!<@ !$B0! ' A< !$B0! 8! @$8  ! $ <$B$ 0! B@ $` !0! $ @.@!D D <0!8! $Bԏ @(!@ ! @t  +!'(D  $ '8D  $ $쌥0! ! @ <t<$B (# <$C 0! !'<'3h!'௿<!$C(>0!  D @@ ! @@ ! < ! $C<d &d &d &  ! t !' $!`!<'2!'Я($ !<!8!!$x0!$CH$  !(!x $*B ! `(!@@0!$  !0!< $C!($ '0<'1$!'د$ !<!8!!0!$C$ @ !(!x 0!*@ ! &%x@0!$  !0!< $Cԏ!$ '(<'0L!'Я,($ !<!!!$C0!8!1$ $$8 (!@!@ !x(!@$ $ (!( 0!@!$T|P  ! !`@8!p쎒Q<  @!<@ $74 $  !@(!Ӵ0! 8! @7@!  !$F '(8` $~|  '( '(ܐ !@8!(! $쏼 Qh@ !(!$$d$8! @!< !$F `0! `!TPLHD@<840'X<'X!'ȯ0,($ T!! !@ !0!<@! $Fȏ쏙@E '@' @ Db< ! $F菼0,($ !'8<'X!'د$ T !@ ! 0!<@! $G$ (!@<$ $4t@+@!<$ $4x@@!<$ $4@!$(!"|$ @<$ $4@!<@ !$G, 0!!$ '(<'!'ȯ40,(T! !@ !0!<@! $GL$ T0! '  $<b$4 @!<@ ! 0! $Gx !40,('8<'!'TPLHD@<840 T`!!hl !@! R 8!<$G!<$B!<$B!<$B<$G` ! 0! @ !'(<80! $G @@! @ ! @!䏙t(F  @ ! @ !<@ $8(  !@(!Ӵ0! 8!  !@(!ܐ$.8! @! `@(!ܐ8!d!f !   ! (!(8!$o`   ! (!ܐ$8!   !@(! @0!  !ܐ (!$6=8!   !@(! @0!  !ܐ (!$N8!   !@(! @0! h($0! 8! @@!x (!L 0! @@!d(!` ! $ @!<` !0! $G! TPLHD@<840'X<'p!'LHD@<840,(T!!!` !@!R 8!<$G!<$B!<$B<$H` ! 0!@ !' <80! $H\@@!䏙tF   @ !@ !@!<@ $8 !@(!Ӵ0! 8! !@(!ܐ$.8! @!@(!ܐ8!d!f !  !( (!$oh 8! !ܐ (!$6=8!  !@(! @0! !ܐ (!$8!  !@(! @0!h $0! 8!@@!x (!L 0!@@!d(!` ! $@!<` !0! $H`!LHD@<840,('P<'8!'LHD@<840,(T!!!` !@!R 8!<$G!<$B!<$B<$H|` ! 0!@ !' <80! $Hȏ@@! @ !@!䏙t F  @ !@ !<@ $9 !@(!Ӵ0! 8! !@(!ܐ$.8! @!@(!ܐ8!d!f !  ! (!(8!$op  ! (!ܐ$#8!  !@(! @0! !ܐ (!$6=8!  !@(! @0!h $0! 8!@@!x (!L 0!@@!d(!` ! $@!<` !0! $H!LHD@<840,('P<' !'LHD@<840,(TT !!` !@!!R 8!<$G!<$B!<$B<$H ! 0!|@ @ !@ !@!<@ $90 !@(!Ӵ0! 8!@! @,@ !<8$4'  0!@#䏙t f  Į (!@@ !<8$4'  0!@ tf  ܐ ! (!$08! Tܐ4@(!d!f ! 8! !ܐ (!$8!  !@(! @0! !ܐ (!$$p8!  !@(! @0! !ܐ (!$58!  !@(! @0!ܐ ! (!$"*8!  ! (!(8!$ox $h0! 8!A@!$ !  (!< !`0! $I@`!LHD@<840,('P<' !'د T !0!@ !<@! $IT< $5< !0!< $Ix !'(<'\!'X!!!y$T $@ ! 0!<@! $I$$ ' ' < $I@ ' < $I؏@!D  2@!<@D  $: !@(!Ӵ0! 8!c$$h$g @!<@D  $:̏ !@(!Ӵ0! 8!c$$h$h$ $bh$$$(!$8! @0!@ !<@! $I!'<'!'د$ T !@ ! 0!<@! $J$< $6`@@!<$ $6@@!<$ $6ď@!<@ !0! $J@!$ '(<'!'HD@<840,(!!!!$T $D  @!@ !`0!<@! $J`b(@f' <8D $J| `0!@]@!䏢 t&e@ ! b(D <@ $; !@(!Ӵ0! 8!8! !ܐ@(!$- @!E  ! @0!8!(!ܐ !$, E  ! @0!8!(!ܐ !$,ί E  ! @0!`(!ܐ !$,ޯ " h$j0! 8!@!<@ !$J 0!!HD@<840,('P<'!'840,(T !@ !@0!<@! $J$ ' <8@0! $6t@@! Ef b h4tD4$0! 8!@!< !0! $J!840,('@<'!'LHD@<840,(!!!! d$T D  @!@ !`0!<@! $JԏD ' <8`0! $J@@!䏙t e @v@!< @D $;P b8 !@(!Ӵ0! 8! !@(!($$o @!8! !ܐ(!$! E  ! @0!8! !ܐ(!$-P E  ! @0! !(!ܐ$28! `E  @0!$0($BH$o  0($BH$o !(! 8!ܐh(! !$,  h$l0! 8!  8 <@ !$@ 0!!LHD@<840,('P<'<!'D@<840,(T!!! l$ D  @!@ !`0!<@! $JD ' <8`0! $Jt@?@! e @@5@!< D $;P b8 !@(!Ӵ0! 8! !@(!($$o @!8!(!ܐ !$! E  ! @0! h$m0! 8!  8@@ ! <@ !0! $K!D@<840,('H<'!'@<840,($ !!!!$T D  @! !`0!<@! $K,cx$b &e0< !$KH $x$<8$ $K` `0!@g@!䏙td0e $ <@ $;@ !@(!Ӵ0! 8!@!V$ܐ8!(!@ !$2 X%  @0!8!(!ܐ@ !$-P %  ! @0!8!(!ܐ@ !$-j %  ! @0!\(!ܐ@ !$, (!@ !($$o d0h$n0! 8!@!< !$KH 0!!@<840,($ 'H<'@!'840,($ T!!!m$ D  @!@ !`0!<@! $Khcx$@<@ ! 8!$;b$< $KL$D !  !@(!Ӵ0! 8!@!@(!ܐ !$-j8!8$ 8!(!ܐ !$-j E  ! @0!(! !($$o d4$o䏙h0!B8! d @!@ !0!< $K!840,($ '@<'$!'د$ T !@ !@0!<@! $KD< $7h@! !<@0!@$KȮ@@  !$ '(<'h!'<840,(T!Y$ $D  @!(! @!@ !0!<$@B$K x$b3' <<8$L@-0!D  t@$@! f@ ! <D $<@@ $: !@(!Ӵ0! 8!c h$i0! 8!A@!@<@ !$L  0! !<840,(`!'@<'!'د T!$ @ !0!<@! $L <8@@ ! << !$L< 0!! '(<'!'د T !0!@ !<@! $LT< $6 @! !<@0! $L|! '(<'P!'د T !0!@ !<@! $L< $6 @! !<@0! $L! '(<'!'LHD@<840,(!!!!d$$T @!S 8!<$G!<$B!<$B<$L ! 0!`@$H@` !<8$6 '  0!@@! ` ! 䏙tf @! ` !<@H $= !@(!Ӵ0! 8!8! !ܐ@(!$6= @! !`(! @0! !@(!ܐ$8! @(!H0! ! 8!?&4\$(! $@(!($o,<\$AD $@ !(@(!$o 8!&@0! `(!<\(!$AH $@&  !@8!($o ! @(!`@ @8!ܐ !@(! $&g !ܐ@(!$+8!  !`(! @0!h` ` !hܐ@8! !@(! $:l@  !ܐ@8!@(! $./䎄Hhb$P0! 8!@@!x (!L 0!@@!d(! ! $@!< !$M(  0! !LHD@<840,('P<'!'TPLHD@<840 !!!!h$T @! R 8!<$G!<$B!<$B!<$B<$M< ! `0!bH @$@ !<8$6 '( `0! @@! @ ! @!(䏙teF (@ !<@bH $=  !@(!Ӵ0! 8! 8! !ܐ@(!$6= @!  !@(! @0!  ! (!ܐ$8!  @(!0!H !8!  8! !( (!$o   !@(! @0! ܐ ! (!$&g 8!  !ܐ (!$+8!   !@(! @0! l` ` ! lܐ@8! ! (! $: p@  !ܐ (!$./ 8! dHhb$P0! 8! @@!xd d(!L 0! @@!d`(! ! $ @!< !$M 0! !TPLHD@<840'X<'!'LHD@<840,(!!!!$$T @!S 8!<$G!<$B<$M ! 0!H@` !<8$6 '  0!@@! ` !@! 䏙tF  ` !<@H $=( !@(!Ӵ0! 8!8! !ܐ@(!$6= @! !`(! @0! !@(!ܐ$8! @(!H0! ! 8!?&4\$(! $@(!($o,<\$AD $@(!( !@(!$o 8!&`(! @0!<\$AH $@&  !@8!($o ! @(!d@  !ܐ`@(! $䎄Hhb$Q0! 8!@@!x (!L 0!@@!d(! ! $@!< !$M 0!!LHD@<840,('P<'!'LHD@<840,(!!!!$$T @!S 8!<$G!<$B<$N ! 0!D@` !<8$6 '  0!@@! ` !@! 䏙tF  ` !<@D $=P !@(!Ӵ0! 8!8! !ܐ@(!$6= @! !`(! @0! !@(!ܐ$8! @(!H0! ! 8!?&4\$(! $@(!($o,<\$AD $@(!( !@(!$o 8!&`(! @0!<\$AH $@&  !@8!($o ! @(!d@  !ܐ`@(! $䎄Dhb$R0! 8!@@!x (!L 0!@@!d(! ! $@!< !$N@ 0!!LHD@<840,('P<'|!'Я,($ T!!!$%! 0!@ ! !@(!Ӵ0! 8! $+䏙hcLD  D @!<@ $? !@(!Ӵ0! 8! $.䏙hc0D  D @!<@ $?p !@(!Ӵ0! 8! !@(!ܐ$7-8! @!'$ !ܐ@(!$" $ $t䏙hB0! 8!@!<@ !$S 0!!840,('@<'@!'Я,($ T!!#$ @ ! 0!<@! $SЏ$X@(!䏙h0!C$ 8! !$<!A$S $,($ `!'0<'d!'Я($ T! !0!@ !<@! $T< $3䏼@!@ !<@0! $T(t !($ '0<'¨!'<840,(!!f$T @ !@0!<@! $TDBp@' <8d $3 @0!@$U䏙t FE Bp $U4~$d  @ !(!Ӵ0!8! @!Gt !@(!0! @!䏙h B(!0! 8!Cx@!$bĎD (!@(D $<` !$T\ 0!!<840,('@<'!'د !<!0!$Tp!$8!<$G %  ! $@(!8@@!$  @!< !$T 0!! '( $t!$t!<'!'Я($ t!! 8!'@ !f! $ Qle @' ($ '0<'!'ȯ40,(lT!! @@! @!B؏@  ! @ ! (!0! '  40,(`!'8<'4!'\XTPLHD@<8!!!(!0p!8 @!@!<8 $4'0 @0!@0䏙tF @@!   @!<@ $4@ !@(!Ӵ0! 8!@! !ܐ !@(!$(8!  !`(! @0!@, !ܐ@(!$("8!  !`(! @0!@t`$T' 4` !$80! '4@  !($p@@(! $x@ !-$ܐ@(!$6K8! xH@(! ! 8!  !ܐ@(! $\@@!$b,B@ 8gܐ !,@(! $2ᏼ@!|@$($ !0!䏙h0b 8!@x (!L 0!@ !d(! $ A!  !08 !0l\XTPLHD@<8`!'`<'$!'د$ !$!B\@ !  8!@0!<@ !$T @!Y\ ! (! 0!@ ! 0!< $T  !$ !'(<'L!'840,(! !'90(!'  !@!@@$Bl@<D  D @!<@ $3菼 !@(!Ӵ0! 8!#l8!d䏙h$c0! @! @x`$ $PL `0!@!@ !d (!@$  @!840,(`!'@<'!'<840,($ !!!!P$h8 @h쏙tdE Sl@6@!   ! !@!<@ $>P !@(!Ӵ0! 8!@!@ @!dh$0! 8!@!!LDP 0!@@!d !@(! $ @!8d !<840,($ '@<'!'<840,(!!(!` !' '90 !@@!Bl@@$D  D @!<@ $3菼0! !Ӵ@(! 8!@0!@ @!dhB$!0! 8!@! @`!`x$ $PL 0!@@!d@ ! (! $ @!`!<840,('@<'!'<840,(! !'90(!'  !@! L$"l@R"h@@!?$d  d @!<@ $3菼 !@(!Ӵ0! 8!@ @!䏙h@ !B$0! 8!@! @`!`x$ $PL 0!@@!d` ! (! $ @!`!<840,('@<'!< $4<'!'d`\XTPLHD@ !!!!(8x!$8 (!@! `$ ` ! w ! `(!X @%0!<$U$`8!  !   !X'(@(! !0! `8!  !`0!<@8!$Uh @! ( ` ! @  ! @(!@ !\$\',,0 @! ,@(!\ !$2'0 + @0,Q&1<0!$U`8! ! 4   !;(,c܏('4'8@ !(!`8!  8@!<$U ! `0! A4@@4 48 @!<@ $>,  !@(!Ӵ0! 8!  !@8!ܐ@(!$2 @!  !䏙h(!B$$  @  @@!!,l ` ! @$T ` ! !d`\XTPLHD@'h<'!'D@<840,(! ! !@ !(!p@! $ !@(!`$] 8!@!b؏@@0!<$U8! ` ! @ !y@ !@(!0!'   ` !<@0! $V, @Q!8Dh   !CP'$$pHCh(! 8!$$b䏅<@d T $7p !@(!Ӵ0! 8! !@(!(8!$pP @!8! !@(!  0! EtD0! ! D(! Bl !$ (!!D@<840,('H<'L!'840,(!!'9` !(! @!@ !!@b$ "`0!<@8!$VP@# !  ` !@ ! @!9'  !@0!`(! @8!@! !<@8!$V @0!/ ,@+@ ! @$0   ! !@!<@ $>P@(!0!Ӵ8!  !@@!$ h0!8!@ @!clBd @!T @ !!840,('@<'H!'840,($ !!!! !P'9 !@!B$ !  !@!b@&$<$Bpb!b$W 0!8! ` !  !y ! (!@0!8! ` !0!<@8!$W< @!$!A $􏂺hC$$ 8!!840,($ '@<'!'ȯ40,($ !!@N!< $;, !@(!Ӵ0! 8!@!@$` !`(!$- 8! !@(!ܐ$-8! @! !@(! 0! 8!A$` !`(!$, 8! !@(!ܐ$,8! @! !@(! 0! 8!A$` !`(!$, 8!@!< $$P'8$p '<@3$| !@(!$ ' @!@)$D!!!D$.$B.t"!B&sD !' 0! @$D&&1$.b!@&R&&$$!\XTPLHD@`!'`<'!'د @!$ D($B.pb8!Df!$B/b!$$pЌ (I H#  !'(<'!'\XTPLHD@!<!!!>$P'8$p '<@3$| !@(!$ ' @!@)$D!!!D$/$B.p"!B&sD !' 0! @$D&&1$/b!@&R&&$$!\XTPLHD@`!'`<'!'HD@<840,(p !!`d !@!@!$*@$ ' w.$O' qP$p@ !(! 8!@z$ Ua_$P' $p@ !(! 8!@d@(!@ !@0! 8!@JH$x'  !(! $P@ !$p(! 8!@G@(!|@ !$  8!@B@0!U+ (!@0!  !!x !(! $P@ !$p(! 8!@%@(!|@ !$  8!@ @0!U  (!@0!  !@$Ű(! @ !@@!`y$ 0!`$$$0!HD@<840,(!'P<'!'د 0! ! !H@0!%  !@$z%  '( '(<'0!'840,(\$ !' 0 !@! !@0!'8!  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'!'840$' 8!$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'\!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'D!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'!'<840,($ $!!!(@$$6$$$0$$$\@ ! ' @!# 8!@ @ ! 0! @ @! (!`8!@ ! 0! @@!$@ ! (!!@ !(! 0!<840,('@<'0!'840$$ $!!((@$$'$$$!$$$'  ! 0!@@!Џ  !'$ '(@$$@(!"840`!'@<' !'Я($ 0! ! !0!T$>@@!<%$BYp @!($ `!'0<'! <'! <'h!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'P!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'!'د$ l؎@@ ! "@@ ! B@@ !  @$ !'(<'!'௿< ! $Y ! < 0!$Yď@b!  ! x'  !(! $ 0!$ (!@.$(` !@(!$q@8!($q 8!@$` !@(! 0!@! $($q $($q $@!0,($ `!'8<'!'@<840,($$!!!XR$P' $q  '$@!@F$$$:|b)(b:}@$m$,Qb+$;b$z b#$5x'  !(! $ !@|(!$  8!@ !@#@!$ (! `8!$B $$` B| !(! `8! @@!! @<840,(`!'H<'0!'د 8!($$q( (B# '(<'!'Я,(!P8!$q,  $'  @$ !,(`!'0<'d!'ȯ0,(0#$!(' 8!!$$$ $"$  !@(! 0!@$ @@!!0,(`!'8<'!'Я,(0#$!P' 8!$$$ $"$ @$!,(`!'0<'4!'ȯ40,($ !!`$$8!!HL$ @(! !0! 8! $HL40,($  '840,($ '8<'p!'ȯ0,(0#$!(' 8!!$$Tu $"$  !@(! 0!@$ @@!!0,(`!'8<'!'Я,(0#$!P' 8!$$Tu $"$ @$!,(`!'0<'@!'ȯ40,($ !!`$Tu8!!HL$ @(! !0! 8! $HL40,($  '840,($ '8<'|!'د !($$q0 (B# '(<'(!'Я,($ !!!$P8!$q4  !@(!|8!@ $F @@!B!,($ `!'0<'x! <'\!'௿l!ӴE0! 8!(C#' <'!'Я($ !!@6$$(@$ $-$$'($q8($q@ 8!@$ !@(!  0!@!($qH($qP $@!($ `!'0<'!'840,($$!!!P;$P' $qX '$@@!@/$$$:|b(b:}@$m$,Qb$$b$z b $ B$H $$ |F` !(!  8! @@!@! B840,(`!'@<'!'Я($ !!@K$,@H$<($cW`C!B\!@ !8+$q`3 !$qh !$qp !$qx ! $q !$q !$q 8! !$q 8!A  ! 0!($ @(! '0$ (B#($ '0<'$!'840,(!! !PR$P' $q '$@(!@F$$$Vb-(bW@$y,$9.b6(b9/@$CY$b$6b$2b*$(by-@$y;$yb$(b $$yHb $! * $$$$ |F` !  8! @ @!$@! B840,(`!'@<'~|!'ȯ0,(!HL>$#$B"$$o|&$ (@$ $.$$'($m$($:|$'  8!@$ !@(! 0! @!($z ($,Q$8! ' $@!0,(`!'8<'}<!'@<840$!,(!X\B$$o|#P $$c&'($'," ' @@!@/$,$:|b(b:}@$m$,Qb$$b$z b $(B$H($$ |F 8!` ! (!(@@8!@8!(B@<840!'H<'{!'ȯ0,($ !!!HI$$%(@$ $@.$1$:x'  !(! $ 0!$ (!@*$(` !@(!$q@8!($q 8!@$` !@(! 0!@!($q($q $@!0,($ `!'8<'zL!'@<840,($$!!!XR$P' $q '$@!@F$$$:|b)(b:}@$m$,Qb+$;b$z b#$5x'  !(! $ !@|(!$  8!@ !@#@!$ (! `8!$B $$` B| !(! `8! @@!! @<840,(`!'H<'x!'د 08!($$q (B# '(<'x8!'Я,(!P8!$qԯ  $'  @$ !,(`!'0<'w!'ȯ0,(($L0#$ $"!' $8! ! !@(! 0!@$ @@!!0,(`!'8<'w!'Я,(0#$!P' 8!$$L $"$ @$!,(`!'0<'v!'௿!ӴE0! 8!(C#' <'v@! <'v !'د 0! ! !H@$%  '( '(<'u!'د 0! ! !H@$%  '( '(<'u@!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'t(!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'sl!'د$ ! '@@!!$ `!'(<'s!'@<840,($!00 !f$0 0!@!^ !x@(! $@!V !\ ' @!N$*@  ! 0! @6@! (!`8! ! $ @+@! !@(! 0!@@!$ " !\  ! ' @!$$)@  ! 0! @ @! (!8! ! $ @ @!$ !(! ! !@(! 0!@<840,('H<'q!'LHD@<840$$$!! (!F$`$L 8!@!@>$' @ !@(!0! $*@2@!Џ @ !'$ '(@#$$"$$($ ((!@ !0! $)@@!Џ @ !'$ '(@ $$Q$(!LHD@<840`!'P<'ol!'<840,($ !!0!s$0 0!@!k !x@(! $@!c !\ ' @![$@ b(! !0!$~ !0!$  @3@! (!`8! ! 0! @(@! !@(! 0!@!3 !\$  ' @!*$*@  ! 0! @ @! (!8! ! $ @@!$ ! (!@(! ! 0!@!!$  ! !<840,('@<'m8!'HD@<840$$!!`$$L8! (!4$ ' @! !0!$~@)$@(! (! !0!$*@$$ (  !'$'(@@@!  @$$$b(@!HD@<840!'P<'k!'@<840,($ !00![$0 0!@! !x`(! $@!} !\ ' @!u$,@  ! 0! @]@! (!@8! ! $ @R@! !`(! 0!@(@!\$  ! ' @!N$*@  ! 0! @6@! (!8! ! $ @+@! !`(! 0!@@!$ " !\  ! ' @!$$+@  ! 0! @ @! (!8! ! $ @ @!$ !(! ! !`(! 0!@<840,('H<'i8!'LHD@<840$$!$! (!c$`$L 8!@!@[$' 0!` !@(! $,@O@0!Џ ` !'$ '(@?$$B;` !(0!" $((! $*@2@0!Џ ` !'$ '(@($$2$(!(0!$ (` ! $+@@0!Џ ` !'$ '(@ $$Q$(`0!CLHD@<840!'P<'g(!'@<840,($ !!0!Z$0 0!@! !x@(! $@! !\ ' @!$@ b(! !0!$~ !0!$  @Y@! (!`8! ! 0! @N@! !@(! 0!@!Y$\  ! ' @!P$,@  ! 0! @2@! (!8! ! $ @'@! !@(! 0!@,@!\  ! ' @!*$*@  ! 0! @ @! (!8! ! $ @@!$ ! (!@(! ! 0!@!!$  ! !@<840,('H<'dP!'HD@<840$$!$! (!V$`$L 8!@!@N$'  !@(!0! $~@ $"0! $( !(! $,@2@0!Џ  !'$ '(@"$$"(!(0!$ ( ! $*@@0!Џ  !'$ '(@ $$Q$(`0!CHD@<840!'P<'b|!'@<840,($!00 !h$0 0!@!` !x@(! $@!X !\ ' @!P$,@  ! 0! @2@! (!`8! ! $ @'@! !@(! 0!@,@!\  ! ' @!*$*@  ! 0! @ @! (!8! ! $ @@!$ ! (!@(! ! 0!@!!$  ! !@<840,('H<'`l!'LHD@<840$$$!! (!F$`$L 8!@!@>$' @ !@(!0! $,@2@!Џ @ !'$ '(@#$$"$$($ ((!@ !0! $*@@!Џ @ !'$ '(@ $$Q$(!LHD@<840`!'P<'^!'@<840,($!00 !h$0 0!@!` !x@(! $@!X !\ ' @!P$,@  ! 0! @2@! (!`8! ! $ @'@! !@(! 0!@,@!\  ! ' @!*$*@  ! 0! @ @! (!8! ! $ @@!$ ! (!@(! ! 0!@!!$  ! !@<840,('H<'\!'LHD@<840$$$!! (!F$`$L 8!@!@>$' @ !@(!0! $,@2@!Џ @ !'$ '(@#$$"$$($ ((!@ !0! $*@@!Џ @ !'$ '(@ $$Q$(!LHD@<840`!'P<'[ !'د 0! ! !H@$%  '( '(<'Z! <'Z! <'Zx!'840,(\$ !' 0 !@! !@0!'$)  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'Y`!'840$' $)$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'X!'840,(\$ !' 0 !@! !@0!'$*  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'W!'840$' $*$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'V!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'U!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'T!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'S!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'S(!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'R!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'QT!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'P<!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'O!'د 0! ! !H@$%  '( '(<'O! <'N! <'N!'840,(\$ !' 0 !@! !@0!'8!  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'M!'840$' 8!$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'M!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'K!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'K0!'<840,(\$ !' !! !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$(! 8! 0!@(!! ! @8!<840,('@<'J !'ȯ40,($' !$$! 0! ! ! 8!'$@ @(!  @(!$$b$40,(!'8<'IP!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'H8!'840$' $$! 0!( ! !'$'(@@(!  @$$$b+(!"840!'@<'G|!'840,(\$ !' ! !@! !@0!'$  @! @8! ! !0!$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'Fd!'840$' $ $!(0! ! !'$'(@@!  @$$@+!"840`!'@<'E!'د !$Bw !FD)$$B/8(!&1 !*#%`P '(<'E !'Я($ D!!&"/8BT !(!D0! $/H@*$&"/8BX &"/8D@(!$/X 0!@$&"/8B\ &"/8D@(!$/h 0!@$&"/8B` &"/8D@(!$/x 0!@$&"/8Bd &"/8D@(!$/ 0!@$&"/8Bh &"/8D@(!$/ 0!@$&"/8Bl &"/8D@(!$/ 0!@$&"/8Bp &"/8D@(!$/ 0!@$&"/8Bt &"/8D@(!$/ 0!@$ &"/8Bx &"/8D@(!$/ 0!@$ &"/8B| &"/8D@(!$/ 0!@$ &"/8B &"/8D@(!$/ 0!@$ &"/8B &"/8D@(!$0 0!@$ &"/8B &"/8D@(!$0 0!@t$&"/8B &"/8D@(!$0( 0!@f$&"/8B &"/8D@(!$08 0!@X$&"/8B &"/8D@(!$0H 0!@J$&"/8B &"/8D@(!$1( 0!@<$&"/8B &"/8D@(!$18 0!@.$ &"/8B &"/8D@(!$1H 0!@ $!&"/8B &"/8D@(!$1X 0!@$"&"/8B @(!D$1h 0!@$#$$bb!($ `!'0<'?!'X`8!!$E ! !@(!|$'@ $ @(! 0! '@!`!'<'?L!'Я($ D!!&"/8B !(!D0! $0X@f$&"/8B &"/8D@(!$0h 0!@X$&"/8B &"/8D@(!$0x 0!@J$&"/8B &"/8D@(!$0 0!@<$&"/8B &"/8D@(!$0 0!@.$&"/8B &"/8D@(!$0 0!@ $&"/8B &"/8D@(!$0 0!@$&"/8B @(!D$0 0!@$$$bb!($ `!'0<'=$!'X`8!!$ ! !@(!|$'@ $ @(! 0!H '@!`!'<'<!'Я,($ `!!8!$.! ! !@(!T$ @8!@!!(B@C !@%!C !!&b*@$c!``(! !$'; 8! !@(!T8! $@!$b$$$b$$$,($ '0<';<!'LHD@!!$u !@j`@(!@ !$'J ''`@ ! $E@ !$QK ! '  !@ !'$ @!@ !'('9N @!@! $,B@$$*$ ($Ꮲ$$B,B@"$`!,B($B,B@$Ꮩ`@ !$( 8!@ !'@ !@(! 8!@! #$B,B@44,B@$$,B@$ $#$@$ $ ! (!$u @ !@`@(!@ !$E ',,'0`@ ! $E@ !$QK ! '40 !@ !'8 @!,@ !'<'9N @!v@(!4$,B@$$+$ )$8$B,B@#$!<$B,B@$`0@ !$( 8!@(!4!$B,B@$$'@ ! 8!@!C% $ ,B8$b$,B<$b$(`0@ ! 8!@(!!'@ ! 8!#4C$,B@$$,B@$ $#$@$ !`0@ !$( 8!@(!!'@ ! 8!4C !LHD@`!'P<'6!'Я,($ @!!#&*!@$ !B@(!b`0! @!&0*@ !$,($ `!'0<'5!'ȯ40,(!!$u !A! (! !A$u @B$`8!@(! ! $(@ !(!x$ @! !(!\$';'   @(!TF8#$  ! !(!\$.'   @(!TF8#$  !(! !\$$B'    !TF8#@(! $$B!40,(`!'8<'4D!'<840,(x!! !' $$!A ! 0!8Bȏ+1@#(!@!  !\ @ !@(!|$  8!X !@0!&XC  @@!P !(!0!@$@$ $ȏC$@!<840,(!'@<'2!'840,($ Px!!! !(!$T !a  !(!0! $E8Bȏ\ $@ !|`(!  8!"@0!@ ! &@X@1$0! !(! $$ȏC&$,G  (! ! 0!@(! !0! $@!$ʏb8bȎ@$8b+ 0#@0!B \C$840,($ !'@<'0!'PLHD@!! !<0!l' t !0!$ @!'8`(! p'  $  !`(!0!$ @! 8Bȏ+#PLHD@`!'X<'0!'D@<840,($ \!P!\X` ! !(!L @! !@(!\$E{`8! @!@!\ !@(!$9 &gAP !(!$)bh#A#b*` (!P ! $ $ȏC$ !cbc$b*@dP !(!$  8Bȏ+ # !D@<840,($ !'H<'.!'d`\XTPLHD@ \!l!|x ! @ !(!\$'J8!8(, @!  !@(!\$$,8! @! ` !ب@0!(!  8! @k@ !\ !@(!$>m8!  '8'0ԯ@0!` !(!  8!@!$ b ` !܏l0! 8! E@ !`C` !8b" b0B@9 !bd@ '(` !0!@8! (! @)@ !8@` !0!8! (! @@ !,@8b(bܯ$0 ` !(!" '0 8!8Bf +0  #d`\XTPLHD@!'h<'+P!'xtplhd`\X\!!! !@!@ !\"<'P @!(!$'J8!T@P !(!@0!$ 8! 'P@(!$ ! `0!'8`(!' @,@!D9<P'T  !(! $u$8! !|@(! $(!'  $  !(!@0!$ @! 8Bȏ+#xtplhd`\X`!'<')!'d`\XTPLHD@ \!!!| ! @ !(!\$'J8!8(, @!  !@(!\$$,8! @! ` !ب@0!(!  8! @h@ !\ !@(!$>m8!  '8'0ԯ@0!` !(!  8!@!$ b` !xܯ(!0! 8! A@ !`?` !8b" bB0B@4 !bd@ '(` !0!@8! (! @$@ !8` !0! (! @@ !,@8b(bܯ$0 ` !(!" '0 8!8Bf +0  #d`\XTPLHD@!'h<'&!'د @@!<0B8@x !@ !x !D ! (!@! $ $'(8  ! '(<'&0!'௷ܯدԯЯ̯ȯį \!!! ! @!\$ !$E8!   !@(!''9N @!$ b$b$,B@ (!$u,  !  !@(!`$G8! @!  !@(!|$ '( @(!'( ' $B,B@4B` (! !$ 8! ' !|@(!$  8!ADfY4''@(!'  g'(!0!@ !'9e @!$ b@ !(!`0!$  ` !@ !(!`0!$  8Bȏ +#܏؏ԏЏ̏ȏď'<'#x!'d`\XTPLHD@ \!l!|x ! 8(瘯,$u4@ !(! @!@! A !\ !(!$'J 8! @!$\ ! (!$$,8!  ` !ب@0!(! @8! @u@ !\ ! (!$>m8!  '8'0ԯ@0!` !(! @8!@!$ b@ ` !܏l0! 8! M@ !`K` !8bB b0B@@ !bd@ '(` !0! 8! (! @0@ !8@X` !0!8! (! @@ !,@8b(bܯ$P ` !(!B '0 8!8Bf +P  #d`\XTPLHD@!'h<' d!'d`\XTPLHD@ \!l!|x ! @ !(!瘯8$u<(, @!  !@(!\$$,8! @! ` !ب@0!(!  8! @l@ !\ !@(!$>m8!  '8'0ԯ@0!` !(!  8!@!$ b ` !܏l0! 8! F@ !`D` !8b" b0B@9 !bd@ '(` !0!@8! (! @)@ !8X` !0!8! (! @@ !,@8b(bܯ$0 ` !(!" '0 8!8Bf +0  #d`\XTPLHD@!'h<'!' d ` \ X T P L H D @ \!!! x | ! (!@ !\$E8! 0 @!  !@(!' ('9N @! ($ b$$ 0b 0 !$uD `(!  !@(!`$G8! @! '@(!| !$ 8!  !@(! ' ( ( $B,B@ 04B 0`@(! !$ 8! ' (@(!| !$ 8!A , 4 , 44' ,' 0(!0!' 4   !`(!\$?t8!  '(@(!| !$ @8! `(! !`$E8! < @!Dܐ !$B/8GP(!$E  ' 8 !(!'( $@! `%8!' < 0 8 !'('9e @!$ b !(!0!$  ` ! !(!0!$  8Bȏ +# d ` \ X T P L H D @' h<'0!'d`\XTPLHD@ \!!! ! |@ !瘯8$uL(,< @!  !@(!\$$,8! @! $ !ب@0!(! @8!@!$ b !`` !\ !`(!$>m8!  '8'0ԯ@0! !(! @8!@!$ b$ !xܯ(!0! 8! _@ !b 90 0!$ (! '< `O` !8` bB b0B@B !b<"\0B@9 !"d@ '( !`8!(! '0 @)@ !<|'0 !(! 8! @@ !8` ,@b(bܯ$ !0!(!P 8! B 8Bf +P  #d`\XTPLHD@!'h<'!'(ԯЯ̯ȯį(\!ܯ䏳 !(@!$<` $bYE DBcYdhX$`lPT\!7!l@ !(! '(@@!8 /(!0! 8!(&B0B@#B瘏$uT @ !(@ !@(!|$  '0($  !0!'0'9U8 (@ !x(! $ (B0B@ *@!&bP0B@$瘏$u\ @ !('@@(!|@ !$ 8!($8! !0!'9U8 (@Z !x(! $(0B@ +@!'b`0B@HB瘏$ud @ !(@'Џ|@(!@ !$ 8!($8! !0!'9U8 (@' !x(! $(瘏$ul @ !(@'|@(!@ !$  8!($ 8! !0!'9U8 (@ !x(! $ (B0B@!b Ű(!Q%b $ @ !(A*@!`\@ !$ut `(!(A @!\@ !$'J 8!(@!\@ !(!$>m8! ('p܏ԯ'@0! ! `8!(@40!0@ !$  $( @'$(@ !L $(@H'x$ 0!(@, 0!$ (!(@$\C$4B\b 0B@% !䏙,'0쏦ܯ  8! !&!BP䏙|쏦ܯ 8!(@bb B0B@b 0B@%'@䏣\쏦ܯ  ! 8! !'!B`䏙d쏦ܯ 8!(@2b 0B@b 0B@8!䏢h'Џܯ' $  !(@b 0B@ !ܯ0! $8Bȏ(+#$ԏЏ̏ȏď'<'!'د x !< !8  !(!@! $ <  !'(<'x!'840,($ \!!! ! !(!L @!@!$.@$$ $b$$\DܐG1̏D$B0HDܐG1D$B0Dܐ$B/8GP DܐG1ďD$B0( !@(! $E8! !ܐ@(!$E{D /0 !ܐ@(! $9 !ܐ@(! $$,gX &bXܐ !@(! $>m/0<4c$(!d!b#@C#C!@ #/0840,($ !'@<' 0!'鐯lhd`\XTPLH !|!x (! @!\$8 <@!$0B 4@@$$U($u|($u| ! 8!0x @C$4<4Bb$#%440b@ @B0B@~B\ 0\@ !$8! @! @@!p@ ! @(! @@ !ܐ0$8!  @ !@(! 0! (0$u@ !8!  @!(!DDܐ&1/8'X$B/X@ !$E  (!@ !ܐ$'J8!   !(!@0!'9}X $ (!@ !ܐ$E8!  @!'Dܐ@ !$B0h(!$鯢  @ !(!ܐ$5b8!  @ !<ܐ(!$Bd$'D $` 04B0B@\ '( 0@ !(8!$u @! @! (!DDܐ&/8d$B/` !$E   (!` !ܐ$'J8!   !(!@0!$'9}X @!  (!` !ܐ$E8!  @!Dܐ` !$B0h (!$鯢  ` ! (!ܐ$5b8!  ` ! (!<ܐ$'D$Bd$`  '@(!` !0! $ @@!'0'(! !'9|䯢  ܐ` ! (!$'D $`  !#40B@\ '@!D @@@$(0$u !8!  @!(!DD !'4/8Xܐ$B/X$E  (! !ܐ$E8!   !@(!ܐ$E8! @!  !(!@0!$'9}X @!  !`(!ܐ$5b8!  (! !ܐ$8! 4 @!'(! ' 0Bܐ@  !D&0x`(! $鏼  D&0`(! $鏼 ܐ !@(! $GЏ B0B@  !Dܐ$b/8GpD@(!$B/ $GЏ @ @(!ܐ !$ 0ܐ$BH@(! !$8! `(!<ܐ !$B[$?t $ `(!%40B@\ !@!D  @@@$(0D$u@ !8!  @!&"/8GdDܐ@ !$B/(!$E  ܐ(!@ !$E 8!@! @@x $ 'Џxf@8! (! @!ܐ@ !(!$E8!  `(! !@0!$'9}X @! @ !(!ܐ$5b8!  @ !(!ܐ$8! @!4 ''(! '  0Bܐ@@ !D&1/8'&0x(! $鏼 ' D&1/8'&0(! $鏼 'ܐ@ !`(! $GЏ B0B@ @ !DܐG1D`(!$B/ $GЏ  @ `(!ܐ@ !$ 0ܐ$BH`(!@ !$8! '@ !(!'( $ @%@!' 'P'( !'9e  @ !(!ܐ$?t$  @ !(!Dܐ$EG1D$B/  !# 40B@0B@\$B D@! @\'(@X` !(0$u8!  @!` !DDܐ&/8T$B/H (!$E  ` ! (!ܐ$'J8!   !(!@0!'9}X $  (!` !ܐ$E8!  @!Dܐ` !$B0X(!$鯢  ` !(!ܐ$5b8!  ` !<ܐ(!$B[$'D $`<4B b$4cD@)$(0$u` !8!  @! (!Dܐ` !$R/8DG\$E$B/h   (!` !ܐ$E8!  ` !@(!ܐ$E8! @!  !(!@0!$'9}X @! ` !(!ܐ$5b8!  (!` !ܐ$8!  4@!'(!'  G` !Dܐ(!&0$鯰  G` !ܐ (! $GЏ B0B@ ` !DGpܐ$B/ (! $GЏ @  (!ܐ` !$ 0ܐ$BH (!` !$8! ` !<ܐ(!$B[$?t $ (@ !L$ 0! @(!(0$u` !8!  @(!` !DDܐ&1/8'x&/$E @! @(!` !ܐ$E8!  @(!` !ܐ$8! @! @(!` !ܐ$5b8!  @(!` !<ܐ$?t$BZ$  D@(!ܐr` !$E8!  'x@(!ܐ` !$E @! X&Xܐ@(!` !$>m  @(!` !ܐ$(8!  @!&ܐ` !@(!$';$  &` !ܐ@(!$.$  &/ܐ` !@(!$$B $ (!%x@B@!xܐ0 !$8!   !@(! &1$*# `&A؏|'  !'( $ @b@$ < $d'(0!'9U8  @8x'( !(! $ "@$< $['(0!'9U8  @8! @!@(! !ܐ$E8!  !@(!ܐ$w8! @!gP@(!ܐ !$Kޯ  (! !ܐ$!8! @(! !ܐ$8! d|`(!@0! 8!@! !$ @(!t@ ` !` ! @!t !`(!$ @!` !  (!P ` !!840,($ '@<'B!'D@<840,(T! $t @ ! ! @!@! `_$ќ  !@X!pӴe !0! 8! !@(!ܐ$$+8! @!8!@(!ܐ !$Eʯ  ! (! 0!@! !$  (!'bt@# !$ ' @@! @ !@ ! @!yt !@(!$ @!@ !  (!$ !P  !!D@<840,('H<'@!'840,($ T! !@!$[$ќ`X ! 0!Ӵ@P8!pe  ! !@(!ܐ$@8! @!@(! !ܐ$L8! P !ܐ@(!$C @! (! !ܐ$w8! 8!@(!ܐ !$w d@(! 0!|@0!8! (! !@(!$ @!P  ! !840,($ '@<'>!'Я,(`$ $G8! ! !@(!`$t 8!' t !@(!0! 8! ,('0<'> !'௿`$8! ! !`@(!$r8! ' <'=!'LHD@<840,(<!!!`d !(!` !p@! $!@! A` !$t@(!'  8! $=tbW(b=u@$T$/4bJ(b/5@$3$xb/$(b5(!\bW$=^bAVb(bT@$_$ObH$Qb>Kb>(b_@$|$U[b Bb(!><$:$p ` !@!2$p(! ` !@!*$p ` !` !@(!p $@!<$$Rk<$$Rk<$$Rkԏ<$  $Rk<$ $Rl<$ $Rl8<$ $Rl`@ !t` !(!'  8!  !0! 8!X@(! 0!$LHD@<840,('P<':!'D@<840,(<!!!X ! !@(!Ӵ0! 8!@!`@ ! $@8!( !$w `(! !$(! 0!`8! @!P`@(!T  ! !T @(!' t@(! !0!8!  !(!`$" 8!  !P@(! 8! !@(!`$(8! @! @!`(! !$BA 8!'®\@ !`@(!$=t 8! !@(!`$Lo 8!@@8!(!(!@8! !  0!@! !$ `(! !$$ ! `(!$D@<840,('H<'7!'840,($ !!PD!B@>$"` 8!@7@!p@ ! @(!@!@!!`(!@ !$R 8!'@ !|@(! 0!(!@ !Ű&s &1@!u*@u*@V!@@ !(!840,($  '@840,($ $'@<'6p!'D@<840,(<!!! !@(!$$  [$YW0!Ӵ8!S ! $@! !@K@! @8!( !$w @(! !(!$ 0!@8! @!(!TS ! $ !T @(!' t@(! !0! 8!`(! !$Nb 8!  !P@(! 8! !@(!P$ 8! !$ @(!!D@<840,(`!'H<'4p!'Я,($ $ !@ !$T &t @ !@S `DE$8! @!$@(!`$F 8!'®S@,($ '0<'3|!'د  !T @ !t @ !Y&%  ! @!"$@@(! $""0$@@(! $"0 '(<'2!'@<840,(! !@ !T &t @ !CQ`$c@!$ (!$ !C$ay 8! !@(!`$r 8!G !ܐ@(!$j @!&䏙ܐ !`(!$\ (! ! ' @B@!B A !Ӵ(!0! 8!B ĎE `0!  ! @,$` !$ 8! !@(!`$u> 8!'$t0!8! !@(!  ! & $9@8#88!$`L8 ! 0!B$<!@<840,('H<'08!'840,(! !@ !T &Qt @ !@!B(!\' @k$jd # &E Cb@ !y $@ !B< @ @ !b @0@ !  @ !@ ! @! @ !@ ! @!y @(!$  ! @ !@ !  (! @ !, @ !@@ !  @ !T @ !840,($'@<'-!'<840,(! !@ !T &Qt @ !@!B' \(!@n$jp  !# @ !Cd&E y $B@:$d@' 0!@ !  ` ! @ !` ! @! @ !` ! @!@(! !  0! ` !@ !@(!  ` !, @ !@ @ ` ! ` !T @ ! 4 0 , ( $  $' 8<' @!'D@<840,($ !!!$ќ $@@!T ! $t @ ! ! @!@{@!$Sb@v$Ӵ !0! 8! !@(!(8!$x @!g@(!ܐ !$j @!(!ܐ !$! 8!@!$.@$$  !6$ !0ܐ(!$yUܐ(! !$x8!ܐ(! !$*Uܐ(!$r` 8!ܐ !@(!$U篠@(!8!$?  !(! 0!@! !$ (!@$8P  !@!D@<840,($ 'H$8<'L!'840,($ T! !@ !t $` ! @!`@!A$ќ ` !@:@!@00!Ӵ ! 8! !@(!ܐ$ay8! @!@(! !ܐ$r8!  !@(! 0! 8!@@!H ! (!@!$ ! (!P ` !@!840,($ '@<'!'840,($ T!! !@ !t $@@!`/$-)$ќ ` !@"@!<ԯ$lt ! 8!@@!<8! ! @0! !@(!  0!P ` !@!840,($ '@<'P!'Я,($ T!! !@ !t $@@! )$'`#$ќ  !@!(!`0!  !@@! ! @(!D(!$ $P  !!,($ '0<'$!'Я($ T! $t @ ! ! @!@!$ќ@ ! P@  !"@30 `!($ '0<'D!'D@<840,($ !!!X\ ! !@!T $t @ !@!@T$q@A@!`e !$ 8! !@(!`$r 8!@!4$`0$ќ  !@*! !(!$d `8!@&D@!!$Bd@$c@ !(!`0! 8!A$`@RP  !!D@<840,($ 'H<'!'د$  !@ !T @!t @ !@@!@($ќ @ !@!$@1$  !$0$  !$0P @ !$$ '( 8< 0! $<$b0!!<'!'د !! !($E !`0!`$# T @ ! ! @$EF& ! '(<'!'ȯ40,($ ! !T @ !t @ !PE` !$8! @! !$F`8! @(! !$`A>8!%  !$r叙`8! @(!@! !Ӵ0!@-8!%  !@(!ܐ$ay8! @!@(! !ܐ$r8!  !@(!0! @8!@! !H@ (! @!$ !  (!`!40,($ '8 ! $ <'!'ȯ40,(!`$ !  !$ 8! !@(!`$u> 8!' t !0!8!@(! 9@ ! &E 99@8#88!@ !@0!$`L 8B 40,('8<'!'د$  !@ !T @!t @ !@$$ @@ ! @ ! @!  !@(!0! @!@ !  (!$$ `!'(<'!'د$  !@ !T @!t @ !@$ @ !@ @ ! @!  !@(!$ @!@ !  (!$$ `!'(<'!'840,($ T! !@ !t ! ! @!@! \$ќY ! 0!Ӵ@Q8!  ! !@(!ܐ$$+8! @!@(! !ܐ$L8!  !@(!ܐ$C$' @!(! !ܐ$w8! @(!8!ܐ !$RM$ 0! ! @(!@(! !$ @!  !P @ !`!840,($ '@<' !'Я($ T! !t @ ! ! @!@!$ ќ` ! @ @ !B bP @ !$($ '0<' !'Я($  !T @ !t @ !@!B@-@ !  @ !@ ! @! @ !@ ! @!y@(!$  ! @ !@ !  (!@@($ '0<' !'Я,($  !T @ !t @ !Y&%D !R @!'9  !@ !Ӵ0! 8!@ !@(!($x8! @! !(!@0! $@ !(!,($  '0<' h!'ȯ0,($  !@ !ќ @!T@L@ ! t @ !Y` !&eDQ @!c@$Ӵ !0!b'8!  !@(!ܐ$@8! @!8!@(!ܐ !$G ` !(! 0! !$ (!` !$b` !'9 P @ !0,($ $'8$@ <4Gd+,B$BC#<C !!<4B!#g$@(!(*$<'8!'@<840,($ !! !@ !T &V@t @ !QEӴ@!.$B !0!8! Td !@(!(8!$x @!@(!8!ܐ !$lO$F @ !(! 0! !(!$ @!7b@3>@ !  @ !@ ! @! @ !@ ! @!y.$0#@(!  ! @ !@ !  (! @ !@<840,($  'H@<840,($ 'H<'!'HD@<840$@ !T @ !t @ !@!(B@ ' '9@  !H``r &d\dH `` <Ӵe4B@ !0!8!@@$ @ !@(!ܐ$ay8! @!@(!@ !ܐ$G*8! @ !ܐ@(!$n% @! (!ܐ@ !$t  !$B (!'$ @!@ !$  (!2$@-$`e$ @ !$G8! (@ !@(!`$u> 8!'(t0!8!@ !@(! y ! &D(y9@8#x88!8 ! 0!$@HD@<840'P<'!'@<840,(! $@T @ !t @ ! !Q'9 @!eӴ@ !0! 8!8! !(@(!$x$ @! !(! 0! !(!$ @!b@0! 8!@(!( !$x08! @!@(!$b$lO$Fܐ8! !  !8B,Bd$(!'  `@! !$ (!@3@! @-$`e$  !$G8! $ !@(!`$u> 8!'$t0!8! !@(! y ! &$y9@8#x88! !8 0!$@!@<840,('H<'!'Я,($ 4 !@ !T &@t @ !QE`@ !$G8!@ @@!@(!4\ !$tA'4$24 $B4` !B (!$F 8!'B,($ '0<'!'௿ !T @ !t @ !Y !&D ' <'!'LHD@<840!! !@ !&@T $t @ !@!@,B@$rA&d\H'  ``dH `` <4B $  `q$Ӵe@ !0! 8!@ !@(!ܐ$ay8! @!@(!@ !ܐ$G*8! @ !ܐ@(!$n% @! (!ܐ@ !$t $ ! (!'$ @!@ !$  (!=!$@-$`e$ @ !$G8! (@ !@(!`$u> 8!'(t0!8!@ !@(! y ! &(y9@8#x88! !8 0!$ b !'9  !@!!LHD@<840`!'P@HX`Lb!<'!'@<840,(! !@ !&T@T !t @ !Q(!\ !$t'  @! \ ! (!$n% &GTC@$d`$p$bC!@5b(@1D@ @ ! @ !@ ! @! @ !@ ! @!y(  ! @(! @ !@ !  (!U'9 @ !N@!y&ED @ !'9 @ !8@ !8'9,@ !'9 0!e$ ` !$G8! $ !@(!`$u> 8!'$t !@(!0!8! $y9@8#x88!8@ ! @0! P@@ !'9@@ !'9 !@<840,('H<'!'ȯ40,($ ! !@ !T &V@t @ !P (!` !$)8! @!$F !`@(! 8!'&ED@ ! ŽS@$(!@ !b$$'9 B`C$bB8B,B5@ !$B``6@@  @ !@ ! @! @ !@ ! @!.f0# ! @(! @ !@ !  (!'9@  @ !40,($ $'8<'T!'௿ !T @ !t @ !@@0!$ !b &D  ! '9$b !'9@$b'9 $' <'h!'௿@$b` ,b@ '9@'9 $' ! $D<'!'ȯ40,(!`$ !  !$G 8! !@(!`$u> 8!' t !0!8!@(! 9@ ! &ED 99@8#x88!@ !@0! 8BD40,('8<'!'Я,($ T! !@ !t $ ! @!@! $ќ@ !  !(!H@ $  !P @!`!,($ '0<'!'ȯ0,($ T!! !@ !t $ ! @!@! $ќ@ !  !(!H@ 0!  !P @!`!0,($ '8<' !'Я($ T! !t @ ! ! @!@! $ќ@ ! P@ !`@ @d,S$S# ``!$($ '0<'!'<840,($ !!! !@ !@!T !t @ !@!(! ! @!b,@@ !  ! @!y, !@(!@0! 8!<840,($ $'@<'!'௿$$ 0!$' <'!'௿$(! 0!$' <'P!'840,($ T! $t @ ! ! @!@!e$ b ! $ !ќCZ$ 0!Ӵ@R8!0%  ! !@(!ܐ$@8! @!@(! !ܐ$L8!  !@(!ܐ$w8! @!@(! !ܐ$R!8! $ (!ܐ !$C 0!` ! @(! !@(!$ @!` !$0!$ bP  !(!840,($ !'@<'!'<840,($ T! $t @ ! ! @!@!o$  !@!$f$ќ  !@_!c$b0!P  !S$Ӵ@ ! 8!@ !@(!ܐ$@8! @!@(!@ !ܐ$L8! @ !@(!ܐ$w8! @!@(!@ !ܐ$8! $(!ܐ@ !$C ` ! (! 0!@!@ !$  (!` !v(! 0!P  !!<840,($ `!'@<'!'hd`\XTPT! $ ! @!@!S$P ! $ !tCH$  !ќ @! !@:' Q E !Ӵ0! 8!8! !(@(!$x@ @! !@(!0 ' 0!` ! (! !(!$ @!` !$0!$ bP  !(!hd`\XTP!'p<'!'د$ ! !T @ !t @ !P@(!`8! ! $kA !&&p @(!$" !$ 0!$ $'(<'!'Я($ T! !t @ !@ ! @!@@!  $B@$ќ @ !@!`8!&& $ $P @ !!($ `!'0<'!'Я,($ T!! !t @ !@ ! @!@@! $B@$ќ @ !@!`bP @ !!,($ `!'0<'!'840,(! !T @ !t @ !R(!p@ ! @!t@ !@(!' 8! @! $i%bu(bi&@$t$4b(b4@$h$]b{$nbo !b+(bh@$i$bXb| !bg !bn(bt@$}$tbM(bt@$t$sbC !b@ !bw(b}@$6$tbm !xb^ !t !0!(!k$\(!$J'$ $\"@ !(!$tw '$$"b8@W  !@ ! @!y8'&@ ! (!D0!(!=$ !0!(!7$  !0!(!1$!0!(!,$"0!(!'$# !0!(!!$$ !0!(!$%0!(!$&0!(!$' !0!(! $(0!(!$) !0!(!$* 840,($'@<'$!'ȯ40,(! !T @ !t @ !P (!p  !t !@(!' 8! @! $b<(b@$FO$b (b@$$b@ !Bb#@ !>b(bFP@$i$,ob+@ !5b$o]b*@ !/ 0!(!'$+@ ! 0!(!!$,@ ! 0!(!$- 0!(!$.@ ! 0!(!$/@ ! 0!(! $0 0!(!$1 0!(!$2 40,($'8<'!'840,(!! !T @ !t @ !P (!p  !t !@(!' 8! @! $H,b8(bH-@$[$1b((b1@$D$/b4$/b8@ !dbU$EbN@ !^b3(b[@${$[Cb9$[ib2@ !Sb9(b{@$J$_ bE@ !Jb @ !F@ !`(! 0!=$3`(! 0!8$4@ !`(! 0!2$5@ !`(! 0!,$6`(! 0!'$7@ !`(! 0!!$8`(! 0!$9@ !`(! 0!$:@ !`(! 0!$;`(! 0! $<@ !`(! 0!$=`(! 0!$> 840,($'@<'p!'840,(!! !T @ !t @ !P (!p  !t !@(!' 8! @! $6b(b6@$<$4b@ !b$Bb@ !`(! 0!$?@ !`(! 0! $@@ !`(! 0!$A`(! 0!$B 840,($'@<'!'840,(!! !T @ !t @ !P (!p  !t !@(!' 8! @! $Rdb!(bRe@$}J$"b"$Cb@ !1b"(b}K@$}}$Rb@ !(b@ !$`(! 0!$C`(! 0!$D@ !`(! 0!$E@ !`(! 0! $F@ !`(! 0!$G`(! 0!$H 840,($'@<'8!'௿@!81$$$ bP H!#8!0bJ$@C%# (C`@8!$!' <'׬!'<840,($ T! !@ !t $ !S @!@!U$S$,B@N,B@Iќ  !@B !  !$C4` !Ӵ0! 8!` !@(!(8!$xH @!` !ܐ@(!$J @! (!8!ܐ` !$tw  !@(! 0!` !@(!$ @!P  ! !<840,($ `!'@<'ՠ!'Я,($ T! !` !@! !`@!#$ !$ќ ` !@! ` !$C$$""BC,D#"$P ` !!,($ '0<'Ԅ!'쯶诵䯴௳ܯدԯЯT @ !t $ ̏@$`@$ќ @ !CR$bbd@@ !P $ӴE0! 8!@ !@(!(8!$xP ' ȏx` !(! $ ܐȎ0@ !$ 8!&@!&1T@(!ܐ@ !$j@@8! $ d !0cbE%p @ !$`,@!0&&1T@' $b@!0Uܐ(!C$@ !@ $j쯠 c!d0BUD%bŰ(! @ !@!p@ ! !@!$@$~`!$wL !$7 '@ !$7 'x$(ᯠܐ@ !(! 8!@! @@ !(!@ !E$ 8!A*$<  @0!`$e`@ !`$=t 8!@ !@(!`$Lo 8!Ab`p@(! @ !@ !(!<@0!@8! `@ !(!$j 8!@2(!p @ !@(!t@ !' 8!$(b(!(b(@$|$xb b$$$˸ ' ܐ@8!@ !(! $j쏼`A@!`b0@@!@ !ܐ(!$_8! @ !@(!@0! 8!@ @ !Gܐ(! $؏,B@#,B@@ !ܐ(!$t 8! @ !ܐ@(!$J @!ܐ (!8!@ ! $twx' !(! $$(@$L 0!@8!(B@$ܐ@ !(! $j@!A`bx@ @ !Gܐ(! $j@!t  !@T@ܐ@ !(!$KR8! (! @!@ !(!0 0!-`-b@B,@@ !ܐ(!$KR8! c@(!Ԍg,@ !@0!b,@@ !ܐ(!$KR8! g,@ !@(!@0! t  !@$@ܐ@ !(!$K 8! (! @!@ !(!0 0!-`-b@B(@@ !ܐ(!$K 8! c@(!Ԍg(@ !@0!b(@@ !ܐ(!$K 8! g(@ !@(!@0! Ű(! @ !&@!*&&@:' I@>p @ !$`6@!p @ !@!$@"$s|c\(!@ !$j'&1C&s (!ܐ@ ! $jŰ(! @ ! @!Ű(! @ !&@!&ԏ̏ 0!@!$ @ !P  !쏶菵䏴܏؏ԏ'<'Ȥ!'9L $<'Ȅ!'9L 8!<'d!'840,($ !!P!$@$t PEӴ !0! 8!$B.b6@.bI.b+@.b@.b*.q s !$ay@@$J.b?@.b8@bw.bJ@e$Kb$Lb !ܐ8! B@(!ܐ !$%x 8!@(! B<ܐ$chC!B\!@ !$t2{ !$Fv !$q !$,l !$cig !$0֯b !$0鯠] !$0X !$aS !$c-N !$aI !$`䯠Dܐ$d>8! B@(!ܐ !$% 8!&c@(!,b@ 8! !@(!ܐ$9fBܐ !$$+ 8! !@(!ܐ$8Bܐ$@ݯ 8!B !ܐ@(!$8 8! B$  !$$!840,($ `!'@<'`!'<840,( ! !@ !T @!t @ !@!B (!\$j@'' p  !  (!`$c8! ! p@ ! @!@ ! @!y@ !8!@(! 0!@ !  (!<840,($'@<'!'<840,(! !@ !T @!t @ !@!B(!\$j@0' P  !#h# !b&%lY `(!$d>8!  !` ! @!` ! @!Y@ !8!`(! $` !  (!<840,($'@<'!'<840,(! !@ !T @!t @ !@!B(!\$j@0' P  !#h# !b&%lY `(!$!8!  !` ! @!` ! @!Y@ !8!`(! $` !  (!<840,($'@<'<!'<840,( ! !@ !T @!t @ !@!B (!\$j@(' p  !  (!\$c'  !p @ ! @!@ ! @!y@ !8!@(! $@ !  (!<840,($'@<'!'ȯ40,($  !@ !ќ @!T@X ! t @ !Y@! !R &lb@ !Ӵ0!@>8!e @ !@(!ܐ$@8! @!8!@(!ܐ@ !$b 0!(!  !(!$ @ !  ! ! @!y@ ! (!$ $ ! (!P  !40,($ !'8<'!'HD@<840,(!!$$  !T @!t @ !@!|$ќ  !@u!ch<4B$c0cbӴ0!@ !8!b!ch &vh@ !@(!ܐ$ay8! @!@(!@ !ܐ$bi8! gh@ !ܐ@(!$j @!8!(!ܐ@ !$c @ !@(! 0!` ! (! ' @!@ !$  (! @$ \$b'$@ !$ ` ! &el$9@8#88!` !8 `0!P  !!HD@<840,('P<'P!'<840,($ !$!g$d  !T @!t @ !@! !ќ`P$ 0!Ӵ@H8!qe  ! !@(!ܐ$d>8! @!@(! !ܐ$bv8! p !ܐ@(!$j @!(! !ܐ$d>8! d8!H@(!0! 0! ! @(! !@(!$ @!P  !!<840,($ '@<'H!'<840,($ !$!g$d ` !T @!t @ !@!` !ќ P$ 0!Ӵ@H8!0%  ! !@(!ܐ$d>8! @!@(! !ܐ$b8! p !ܐ@(!$j @! (! !ܐ$!8! 8!@(!H0! ! 0! ! @(! !@(!$ @!P ` !!<840,($ '@<'@!'LHD@<840,(t! !@!m$@i$<ԯ$l ! 8!@!@\@(!X@(!@S!!ܐ !(!$D 8!@@!bB@<`!!ܐ !!C H!@(!b x8!@$C ! @(!@, !!BF  ׀!`0! ! ' $ !<@(!C 0!  @@(!׀!&!B@&sb@'(!LHD@<840,(!'P<'!'LHD@<840,(<!!!`d !(!` !p@! $!@! A` !$t@(!'  8! $=bH(b=@$T$b)(b@$($b:Ob($3bHIb(bT@$_$Pb;$Qb1>b1$}hb(!86$p ` !@!.$p(! ` !@!&$p(! ` !` !@(!p $@!<$$Rl<$$Rl؏<$  $Rl<$ $Rm<$ $Rm@<$ $Rml@ !t` !(!'  8!  !0! 8!X@(! 0!$LHD@<840,('P<'!'Я($ p ! ! ! 8!@(! $ ($ $'0<'!'D@<840,($ tLPTX !P``LLHPDBTL  !\@!b*@P$W!@&q`G!PL& ! 8! !@(!@! !@!w!!@(bPC!P& !(!8!5! !\@(!*T !*$\@`$ w! *b&5!2 !W!*@`$`$D@<840,($ `!'H!lph<'P!'௿ !T @ !t @ !Y !&l ' <'!'D@<840,(L ! !@!T !t @ !@!@h$ќ  !@a!L S@ &E\$ L` !$f1 'L"Ӵ` !$B0C#E0! 8!'` !($x`@(! @!@@! !(! ' @!$` ! (!Y !  (!# @LY9@8#88!$d8 ! 0!HD <`(!<@ !4B@ 0!$" #P  !!D@<840,('H<'x!'840,(! !T @ !t @ !S (!\` !$j'  @!` !Ӵ0! 8! ` !(@(!$xh @!@!@ ! (!@0! @!$` !  (!!840,('@<'D!'<840,(! !@ !T &t @ !D@!\(!$j'  y (!  !# CAbH@=d <4B@<`(!0! @ !" ! b# @ ! ! @! @ ! ! @!y@(! 0!  !  !@ ! @(!<840,($'@<'l!'Я($ ! $@ !ќ @!T@- ! t @ !Y@!` ! (!B@ !  ! @!Y@ ! (! $ ! (!P  !($ !'0!<'(!'د ! $T @ !t @ !Y ! (!  '(<'!'D@<840,($ !(\!!8!$x(!X !g @!ܐ@ !@(! $-gܐ@ !(! $jb@ @ !Gܐ(! $؏b0@@ !ܐ(!$_8! g0@ !@(! @0!b4@@ !ܐ(!$w8! g4@ !@(! @0!b @@ !ܐ(!$K 8! g @ !@(! @0!g 4$C+@(!ܐ@ ! $YebH$U@ !ܐ(!$m.8! gH@ !ܐ@(!$JpI @!ܐ (!8!@ ! $twbJU@ !ܐ(!$m.8! gJ@ !ܐ@(!$JpK @!ܐ (!8!@ ! $twb8@I(!ܐ@ !$j8! @ !@(!(8!$x @!g8@ !@(! @0!g< &b@ܐ@ !(! $3vg@ܐ@ !(! $bD$B,B@(!ܐ@ !$p8! dD@(! ܐ$cx !8! @ !bL@%@ !ܐ(!$( 8!@@(!8!@ ! @0!g(X@ !(!D@<840,($ $x 'Hb@B$A@!p$(!ܐ@ !$KR 8!@ !@0!8!D@<840,($ @(! 'HD@<840,($ 'H<'!'hd`\XTP`!!!` !(!8! $KR@?@!p` !@(! ' @L@ @ !@ ! @!L$(@ ! @(!@ ! (!, @ !@B,A` !Ӵ(!0! 8!B,ԎE,8!` ! `0!` (!` !$K  8!@@!p` !@(! ' @g,`$b_H@[ @ !@ ! @!H$( !@(! @!A@ @ !@ ! @!@!L 8B,B !@(!'0 @ !  (!, @ !@ BX@@ @ !@ ! @!FX !@(! @!@ !  (!B(A` !Ӵ(!0! 8!B(ԎE(` !8! `0!hd`\XTP$'p<'\!'쯶诵䯴௳ܯدԯЯ!BL!! Q|@j!` !$j(! '@a瘏$x ` !@B8A` !Ӵ(!0! 8!B8ĎE8 ` !瘏$x ` !@t@(!` !' 8!$Wb$$~b$$Bb$$BD`` !$ '@ &B@t` !0! 8!`` !$3v '@ ` !|$ &G@B<@<@@`(!` !$Q 8!` !@(!`$$!'د$ t! !$P< !x(!$`@$ ."a 0!  !@@(!$` !$ `!'(<'=|!'د$ t! !@! !x(!$`$ .Ba@0!  !@&<$` !$ '(<'<!'Px!$' $Bx@d$BxCtDxC!$C!Y$hlDx' j$@ !p|xt T @ !t @ !D8 (!@,@! @ !@ ! @! !$ @(!'0!' $ $ 0@ ! (!!'<':!'Я,($ !! ! !T @!t @ !@! )$ќ`& ! L@@ ! @!(! !P !`  !$@! $pPT|  !!,($ '0<'9!'Я($ T!! !@#$ !ќ  !@$0|  ! @B` @ !bP  !$($ '0<'8!'ȯ0,($ T !@!ќ@Z@ ! @U&ElD|yp e !Ӵ0! 8! !@(!ܐ$@8! @!@(! !ܐ$b8! GP@(!ܐ !$5 D|8! 0! @(! !$  (!bl@@ ! @ ! @!yl@ !@(! $@ ! (!P @ !0,($ !'8<'6!'Я($ !! !@!  ! @!Y (!@ ! `0! !(!($  '0($ '0<'6(!'@<840,(!! !T @ !t @ !@!y$\(!@ !$5'    ` !@! g$ќ  !@`$0! !  (!#\$bP !ct@(!C! 0!C!Y$$"\`8! ,  !@9b$Bb"L@1@ !Ӵ0! 8!@ !@(!ܐ$@8! @!@(!@ !ܐ$W^8! 'P@(!ܐ@ !$5 ` ! (!0! 8!@ !$ (!P  !$@<840,('H<'3!'<840,(!! !T @ !t @ !@!' \$5`(!@<$D    !@!@ !ќ -$ 0! (!@$@ ! Bl !@3d  ! @!Yl@ ! (! 0! ! (!P$ ! "d$<840,('@<'2!'<840,(!! !T @ !t @ !@!(!\' $5@A$D   ` !@!@ !ќ 2$ ` !@+&%lY @ ! (! 0!Bl@ !  ! @!Yl@ ! (! $ ! (!P  !$<840,('@<'0T!'<840,(!! !T @ !t @ !@!(!\' $5@A$D   ` !@!@ !ќ 2$ ` !@+&%lY @ ! (! 0!Bl@ !  ! @!Yl@ ! (! $ ! (!P  !$<840,('@<'.!'<840,(!! !T @ !t @ !@!(!\' $5@A$D   ` !@!@ !ќ 2$ ` !@+&%lY @ ! (! 0!Bl@ !  ! @!Yl$@ !  (! ! (!P  !$<840,('@<',!'ȯ0,($ t!!! !@!0! 8!@$ed 0,($ '8<',h!'د T! ! $ !@ (! ! `!'(<'+!'ȯ0,($ T !@!`{$y4 d8  (!ќ  !@k$2|௠@ ! '@)@!ќ @ !@@ QQxQxtQtP  !@ !Ct@ !C!C!Y4  (!y@ ! &%hy&%l @ !'9H  !%""@E @ !  !P  !$0,($ '8<')!'Я,($ !!!$, @|}$ T @ !t @ !@! i$$b6|2t@.T@$0cb(b@$$b b$$0cb(b@$$b b$$Ԭ؏  !@!"<@ $  !9<@ !8!(! `0!bl  !@(!  !$b !#$b!'9H  !!,($ '0<'',!'D@<840,(T! $@!`$ќ @ !@!C\$qV|b%BT@# !Ӵe0! 8!GP !($x@(! @!@ @! !@(!0! 8!@!$ ! (!{BT@y$bg !Ӵe0!8!  !@(!ܐ$d>8! @!@(! !ܐ$WG8! t@!C! !C!Y @(!0! 8!@@!GPܐ(! !$5  !@(!0! ' @!$(!  !%BL@ $ @'$\e$$" !$ y ! &Eh$y9@8#88! !8 @0!Bh$B\BT@ BL@ @ ! $ 0!P @ !!D@<840,('H<'#!'840,(!! !T @ !t @ !@!(!\' $5 =$$   @ !@!@ !ќ.$ @ !@'&h9  !(! `0!\ !$B,B $@ $$ \ !$  $P$ ! \$840,('@<'"L!'HD@<840,(!! !@ !$T $t @ !@!$\(! !$5'     !@!@}$ќ @ !@v! !0! @(! !Ӵ0! 8! !@(!ܐ$d>8! @!@(! !ܐ$#8! GP@(!ܐ !$5 0!8! ! @(! !(!$ @!$\8!` ! (! !p @(!t !@(!'$ 8!$$cяb(bc@$x$abb$$$ $`0!@ !$ B\@ !$  $P @ !!HD@<840,('P<'X!'@<840,(!! !T @ !t @ !@! L$2\(!@ !$5'    ` !@!:$ќ  !@3$ !0! (!\$b$b@ ! $ !\$ $ !$  $ ct0!C!(!C!Y($ \P  !$@<840,('H<'!'LHD@<840!! !@ !T $t @ !@!m$\(!@ !$5'    ` !@! [$\@ !(!$! '$@$G$b$ќ  !@E$` ! &%h ! (! 0!#\$b (!b($Bb` ! '(@@! $ !$0! \ !$  $` ! (! $0! !$ "\ !$  $P  !$LHD@<840'P<'$!'<840,($ |! !! !T @ !t @ !PEӴ !0! 8! !ܐ@(!$d>8! @! !@(!ܐ$Wy 8!GP !ܐ@(!$5 @! (! !ܐ$! 8!0! !ܐ@(! 8!`0!8! ! @(! !`(!$ @!$0! @ !B\ $@ !$  $ !<840,($ '@<'$!'lhd`\XTPLH (!! ! T @ ! t @ !@! $$bD$b,B@%$b#A ` !Ӵ(!0! 8! A,Ӵ` !(!0! 8! ` !@(! 0! o!tC!^!Y8  ! ` !(!\$5'(  L  ! @N@!\(!` !$5'(  ` !Ӵ0! 8! ` !@(!ܐ$d>8! @! @(!` !ܐ$Wy8!  (` !ܐ@(!$5 @! (!` !ܐ$!8!  8!@(!ܐ` !$yU   ! (! 0! ` !$  (! $ќ @ ! @$(U|BP`+@T@ ! ,  ! @!  @ !  ! @!@0!', ! @(! @ !  (! , @ ! 0! ! @(! , @ ! @0 8 @(! `` !(!$5U| 8! ` !@(!\$Ye&GX @! ` !\ (!$4 '0 @ ԏ0  ! @Bx@ !$A\` ! (!$aQ '4 @ ԏ4  ! @Bt@ !$aas$`` !(!$d 8! @$BL`` ! (!$( 8! @@!B`A` !Ӵ(!0! 8! B`ĎE`0! ` !t 0!8!C!^!Y'8'< ! `(!<$ b?, @ ! @F`4 !@(! '@ , @ ! @ !LF`@ @(! , @ ! @ !t8C!^!Y `(! @8!CL$ B\`$$ @ !$ P @ ! $lhd`\XTPLH'p<'!'TPLHD@<840!"|Ӵ0!8!!(  ! !@(!(8!$x @!ܐ !@(!$58! @!@!"L@ $ܐ !`(!$d 8!@!ܐ !@(!$(8! '` !@(!0! @!$x@!\$b@(!Pܐ ! $4"xGR !ܐ(! $d$t$\b@(!Pܐ ! $aQ"tGR (!ܐ ! $aQܐ'P !`(!$5 (8!Ct`(!C!@0!C!Y !  !(! $ \ !$  $,  !@2!$| (!0!'   !(!$ @! @$\$$"'$ !$ $| &%h$9@8#$|88!8  0!"h$"\!TPLHD@<840'X<',!'@<840,($ T!!! !@!`$ќ  !@o|qB$B,B@KBt !b!t!y, (! 0!x@C\$b8`A !Ӵe0! 8!`<` !8!  0!x@ C\$bP  !<CtX0!8!C!T!Y< ! @(!B` !$BB (!A $ !$$ \ !$  $P  !$P  !y0 $d8 (!$@<840,($ 'H<' !'HD@<840,(T!!! !@!$ A$`?0!Ӵ<8! @ !@!ќ 3` ! @,! ' 0! 8!@(!@ ! @ !p  (!@(! հ0!8!` ! @ ! (!$ @!P ` !!HD@<840,('P<' !'<840,(T !@@!ќ ` !@d| &ehb\$T ` !c\$bӴ@ !0! 8!@ !@(!ܐ$ay8! @!@(!@ !ܐ$#8! gP@ !ܐ@(!$5 @!(!@ !ܐ$m.8! @(!@ !ܐ$C8! d| 0!8! `(!@ !$  (!d|t\ `(! ' @/@!@ !B\$ќQ% P ` ! !$ $ \$$   !ќ ` !P  !d|`(!c|b$Bb $` !$$ b\` !$  $T ` !P ` !<840,(!'@<'!'د$ T! !@!$$ќ` ! P@ !T @ !Q$ '(<',!'௿T !@$ќ  ! P@ !$ L$`!' <'!'د T! $@$ќ  ! P@ !L  ! `!'(<'!'د$ T!! !@,$ *ќ  !@#$$x@@ B@@P  !!$ `!'(<'!'د$ T!! !@2$ 0ќ  !@)$$t@  @ BP  ! $@@P  !!$ `!'(<'!'د T! !@$ќ  ! P@ ! x$ `!'(<'X!'د T! !@$ќ  ! P@ ! t$ `!'(<'!'ȯ40,($ T! !@@!`y$w*@t$ќ ` !@m$bT@c\$b0!P ` !^$0Ӵ% ! 8! !@(!ܐ$d>8! @!@(! !ܐ$Wy8! gP !ܐ@(!$5 @! (! !ܐ$!8!  8!<ܐ@(!$cj ! ! d|0! @(! !$ @(!$` ! $$ b\` !$  $P ` !$40,($ '8<'|!'د T! $@$ќ  ! P@ !P  ! `!'(<'!'LHD@<840,(TT! !@!$!!@!@$ќ @ !@ !B|pB@$Ӵe !0! 8! !@(!ܐ$ay8! @!@(! !ܐ$a8! GP !ܐ@(!$5 @! ! (!ܐ$\8! Tܐ <@(!$cj !8!  !!0b@B!0B@&0B@&ܐ (! !$\8! @(!0!8!  !D|@(!0! 8!@! !$ (! $\e$b4'  !  D|y &El y9@8#DD|88!8 @0!BlP @ ! !LHD@<840,('P<'!'@<840,(T! !@!@$@6$4*@/$ќ @ !@( !D|@$BTC\@$$b,B@$ @ ! $@ !$  $P@ !$bP@ ! $$$!b$BӴ !0! 8! !@(!ܐ$ay8! @!@(! !ܐ$#8! GP !ܐ@(!$5 @! (! !ܐ$\8!  @(!<ܐ8!$cj ! !  (! !ܐ$m.8! @(! !ܐ$y8! D|@(!`0! 8!@! !$ `(! @(!D|  ' @ $"Ā @ !D|@(!\$'$ !$ D| &Eh$9@8#D|88!8 @0!Bh$cB\b$bY(!]Ӵ !0! 8! !@(!ܐ$d>8! @!@(! !ܐ$Wy8! GP !ܐ@(!$5 @! (! !ܐ$!8! @(! !ܐ$yU8! D|@(!`0! 8!@! !$ `(! $ @ !$$ B\@ !$  $`@ ! 0!@!P @ ! !@<840,('H<'!$ (!<'h!'Я($ T!! !@!.$ќ + ! 8!`@#$\%d  ! !@0!Ը @(!$\8!``  !%d  ! @(!$BbP  !$($ '0<'L!'ȯ40,($ T! $@! T$ќ`Q` ! 0!Ӵ@I8!0%  ! !@(!ܐ$d>8! @!@(! !ܐ$a8! gP !ܐ@(!$5 @! (! !ܐ$!8! @(! !ܐ$yU8! d|@0!8! `(! !@(!$ @!P ` !!40,($ '8<'!'Я,($ T!!! !@!@:$ќ @ !@3 !&0,B@*ԎB@*$@ $*@$$ *@$ $$(!L(!(.. @ !@!SP @ ! !,($ '0<'0!'ȯ0,($ T!!! !@!@!`^$Z$ќ ` !@S !&0,B@$Ҏb@$$%*@ $$*@ 7$2*@$+/$b`,e $b@B$A@(!e$$e( $b@B,A@(!e,$pD 0!@!$0bbP ` ! !0,($ '8<'8!'د T! ! $@   ! "! `!'(<'!'@<840,(௠ '  !@!!!$$ !ќ  !@|$\brT@^@ZGT  !QEӴ !0!8! @! !@(!ܐ$ay8! @!@(! !ܐ$#8!  !@(!ܐ$\8! @!@(! !ܐ$x8!  !@(!ܐ$m.8! ܐ@(! !$y 8!Pܐ !@(!$5 |(!`0! 8! $ !$$ \ !$  $P  ! ! ' v@!$ `(!@<840,('H<'!'Я($ !! !@!  ! @!Y (!@ ! `0! !(!($  '0($ '0<'<!'ȯ40,($,!!@!<$cjC!B\!@\$D,@$<$cjC!B\!@$$$$(!"T t @ !R`p @ !@(!t@ !' 8! @!@t$ $(b(b(@$T$xb $hb(!$|b$b$W$$p(!@ ! "@(! @ !#(!b!N#B(!F(!D" @?T t @ !D $@,T t @ !D$p @0!A(!$JK(!H(!IB$"(!$40,(!'8<'!'ȯ0,( H<$d!$n$$(  @!(!<<$n$@@ !<$Bn$  @ ! ! !0,('8<'<! <' !'ȯ40,($ !! !@ ! @! !T @!t @ !@!B$@ ! Y$8!` !0! (! @! ! (!Y ! 0! Y(  (!$D8 40,($ !'8<'!'د$ t! !@!@ !x(!$<$ X*"= 0!  !@@(!$< !$ '(<'!'د$ t! !@!@ !x(! 0!$ *"= 0! @ !@(!$< !$ '(<'p!'௿t @$C`!' <'(!'د  !T @ !t @ !@! Z$<$bV$8R`@N$bJ @F$(! ! 0!p$ $p @(! ! @0!$$ $$p$ $p @(! ! @0!$$ $$ '(<'4!'د$ x!!!(! $$ '(<'!'د$ $$t<8`d ! !(!h @ !\ @ !Ř @ !B$$B,BQC@@l@C@@x$ '(<'!'ȯ40,($  !T @ !t @ !QE` !$8! @! !$F`8! @(! !$`AA8!e  !$r叙`8! @(!@! !Ӵ0!@/8!e  !@(!ܐ$ay8! @!@(! !ܐ$r8!  !@(!8!  0!@! !H@@(! @!$@(!  !`e !$G 8! !@(!`$F 8! !$HA $40,($  '840,($ '8<'ߌ!'د$ ! !@ !T @!t @ ! ! (!@0!@!@Y  @!$ `!'(<'!'௿ !@  !  ! ! ' <'X!'ȯ40,($ ! !T @ !t @ !$R @!$$#b$` $"  !1@ !Ӵe0! 8!@ !@(!ܐ$$+8! @!@(!@ !ܐ$08! 8!@(!ܐ@ !$+Y  !(! 0!d$ (!l  !%$ @ !$"%$ @ !$"  !40,($ $0! '840,($ '8<'!'௿H $' <'!'TPLHD@! !T @ !t @ !R(!p @ !@ !@(!p @!(!@ !t' 8! @!t@ ! (!'$ 8! $@ݏb(b@@$ay$$+b$4b$d>b<$WG$$G*b$(bG+@$bi$%xbX(b%y@$9V$#b0` !b$EbF` !b4(bbj@$f$W3b$ab&` !b0$rb ` !` !  (!  (!` !(!  0!(!  0!(!  0!t` !  (!` !  (!`(!  0!p@ !  (!t@ !@(!'( 8!($FOb(bFP@!$c-$0bu(b0@$0$bF(b@$,$b` !bF` !bZ(b0@$F$0bM` !b(` !bg(bc.@$i$ab(ba@$a$`b` !sbQ` !obo(bi@$t2$cib&` !fbd` ! 0!(! 8!\ 0!(! $T` ! 0!(! $K 0!(! $C 0!(! $; 0!(! $3` ! 0!(! $*` ! 0!(! $! 0!(! $` ! 0!(! $  0!(! $ ` ! 0!(! $ ` ! 0!(! $ ` ! 0!(! $  0!(! $` ! 0!(! $I$b`(bWH@!$bv$Eb(bE@$GD$%b(b%@$9f$#b`` !bY` !b-(bGE@$Ga$Eb` !b+` !ba(bbw@$f$abM(ba@$a$Wyb:` !bL` !b](bf@$r$bbQ` !b$sb` !<` !  (!  (! ` !  (!,  (!y` !(!  0!q(!  0!j(!  0!c` !(!  0![((!  0!T` !  (!M  (!FD` !  (!?` !(!  0!7 (!  0!0p@ !  (!t@ !@(!', 8!,$`b(b`@$s$%b>(b%@$Fh$b|$"Wbj` !b(bFi@$X'$F!bY` !b3` !bH(bs@$tG$ibv(bi@$sQ$abz` !bS` !b%(btH@$|r$sb` !b%` ! 0!(! $` ! 0!(! $ 0!(! $` ! 0!(! $ 0!(! $` ! 0!(! $ 0!(! $ 0!(! $ 0!(! $` ! 0!(! $` ! 0!(! $` ! 0!(! $~ 0!(! $v` ! 0!(! $m 0!(! $Je$b'(b4@$;$$b (b$@$0$$4b ` !Ub!` !Qb(b;@$E$8b#` !Hb$Lb$wB` !  (!;p` !(!  0!3  (!,`8!@ !  (!@ !p @(!@ !@(!t'08! @!@ !\ (!$C '40$pCb(bpD@!$}$1b?(b1@$RM$/b(b/@$/$bKb` !b<(bRN@$p,$H,b` !b` !b=(b}@$}$|bi(b|@$|$|bB` !b7` !bT(b}@$}$}bH` !b9$Jb ` !4` !  0!4  0!᠏4 ` !@4 ` !4` ! (!4 (!4(! 0!4$` !(! 0!4 (! 4` ! (!y똏4` !(! 0!p4  0!i4` !  0!a4  0!Z昏4 (!S,4` ! (!KctC!C!Y  (!=p` !  (!6ct` !C!C!Y@  (!( 0!(! $K $$GbB(bG@!$b$8b(b8@$<$4b(b4@$6$%bb` ! b` !b(b<@$B$<b` !b` !b3(bb@$s3$Lb=(bL@$W^$Jb` !b` !b(bs4@$y$bb$` !b` !h` !  (!H` !  (!X(!  0!` !(!  0!  (!`$w8!@ !  (!@ !p @(!@ !@(!t'88! @!@ !\ (!$C '<8$Cxb(bCy@$w$b($Cbb` !b2(bw@$}$R!bb ` !~< (!w<` ! (!o쏥< ` !h4< ` !a<(! 0!X`<` !(! 0!O` 0! (!HctC!C!Y  (!:  (!3ct` !C!C!Y  (!%ʐ  (!  (!` 0! (!`` ! 0! (!` ! 0!(! $LTPLHD@'X<'!'ȯ0,($ !! !@ !@!T !t @ !@!@ !@(! `0!ȏ !@(!`0! 8! @!!0,($ '8<'4!d <'!'<840,($ T!!! !t @ !Q8!ܐ !(!$( @!g` @(!Efd줯@8!  ! !  0!(! !ܐ$Q8! @(! !ܐ$4B*P#$cC!"$H&4'8"<L0 D"@X&$ $  # &"H"D#DP&$$4%8'< $@@!DX`(! &<̏ 0!(!D $<&<̏ `(!@!0,($ '8<'C!'HD@<840(DD$b<< 4B+DB<䏂D !@< &%<@!(c !D &<̏(@@!&$< (!(T!DDD菔$!'Я($ !!D$P4C#&@(!X ` !@2< @  ` !< '4C! $$N ,,$,@ <4BC*@$N ,,$B@@4004,@40 ` !@!< 4C#($ `!'0<'/,!'ȯ40,($ !!!!< Z4B#DX(! &=`&b&@` ! @(!@@!\ !`(! &X@ @!@ ! `(!1&=(8 !(! $N @@!!E &T4@6 ! `!@!S+И ! 0!@.cE@ !`q#$! (!`(! !P !E !  !!`!   !E ! @!!0,($ '8<'`!'ȯ0,($ !$X` !! 5!% &24@-@ ! U!@!.И@ !$ (!(! !P@ !%` ! !!`!  @ !%` ! T#!0,($ '8<'!'د$ !$X@ ! !% @ &$4 %@ ! @!!$ '(<'|!'Я($ !$X@ !! !% `(!h@ &$4 %@ ! @!!($ '0<'!'Я,($ !!,!+!$X@' !E &P4 !@!  !S+h  0!`S#E  !!S!! @(!E ! @!!,($ `!'0<'!'د$ !$X@ ! !% @ &$4 %@ ! @!!$ '(<' !'Я($ !$X@ !! !% `(!t@ &$4 %@ ! @!!($ '0<'t!'Я,($ !!,!+!$X@' !E &P4 !@!  !S+t  0!`S#E  !!S!! @(!E ! @!!,($ `!'0<'d!'د$ !$X@ ! !% `@ &$4 %@ ! @!!$ '(<'!'Я($ !$X@ !! !% `(!@ &$4 %@ ! @!!($ '0<'!'ȯ0,($ <0H!$4B1! % !X`! @!@!#"ԏ@ !<$ 4B @ $C$B s +R#s#D#<4B<04P%  !!0,($ '8<'!'<840 !!<0N4CX$  ! @F@!$B2Ԏ"@ %  ! %܏ސ &$1%  ! @,!"@(<$4B,( ! '(( @ @$,@!,(H$ %܏,($؏`8! @0! !<840`!'@<'\!'Я($ !<0>4B$ $܏X ` !@! 0  ! &4@ !܀@@(!   ! @ !$C<04Q@ &ď܏ ` !܏ ` ! !($ '0<'!'د \!$,! !@!<! `!'(<'!@$, (!<'!'د !0! !' @(!@! `!'(<'4! (! f*@ $$$C+@8!!L<'!'TPLHD@<840 !!p!,<0~4C@<0z4CH $ % !X`! @! @l@!&64  ! @@!%܏( !lhWg!$g(+F!$E! t$$$ PT( ! (! @ !܀ (! % ! <044C   %  !"؏ @$!<$4B,( ! '(( @ @$,@!,("܎$؏,(`8! @0! !TPLHD@<840`!'X<'@!'ȯ40,($ !!<04B$,B@<04BX $@!`t"R#b# b " C"@$E܏T$D%L @ ! (! ܀ &D4E܏ &DC! 4(E &D<094B"<$B" E$BB&P$B ! B$P9T E !X @!@!B $BB#$b%"(@!B^%#$" $e!e0+D!F!4#$" @ !  (! @+ (!܀  &D4 <034S "<@ !@E&$, &"< +܀  (! &D4C$ b B@E &Dď `$Cb d@WdC+@QE &DB؏ @$`!<$4B40@ ! '00 @ @$4@!40B܎D؏408! 0! `!\XTPLHD@<8'`!@$`!!!<'@!'௿<0!4BH!@!P!(!<00$ڜ0!$g4Bihj` ` ' <04B$!<'!'௿ ! & ' <04B' <'4!'Я,($ H ! !`!@!B@)(!CBD #!#@+!0!8!!D @H !# +###D#`(!@ !@0!@` ,($ '0<',!'د$ !$<0 !4H!`!!  (! !@0!@@@!@&F 8 !@ @@!  !<@@@! @@!$ !'(<'H!'د !$<0$ !`4B @! !  !@! @! !! ! '(<04B$ !<04B !!!!!<'@!'௿ ! !@!< `4B/!' <'!'௿4 !!' !D$(,048<@<'p!'௿D$ $BD@!< 4PK!' <'!D!`B@<'!(<$$r $@<'!'د$ D< !!4CK&DBD < +X4cK !&EBD@0! !$ `!'(<'8!'Я($ ! !@!@!< 4BK`bp@  ! E0! &Rb&&1 B+@r!($ '0<'l!'Я,($ !!(!`!< 04BKDB@@ DD $BD$Ǝ $CD@!cD+@!@c$B@bB+@!!D(!$CD  !b&1"+@& @!,($ '0<'0!L<$$r $$<'!'ȯ40,($ !!< ^4D?&($$,,4E+@+@#< O4D?H$B$% ! "$d%`(! '''H &3" !b@ `(! 0R@(@ !% !(@0! &' @@!` ! (! !2@&B"$B%" 0!$ $E+@0!`$# @ !C!@40,($ !'8<',!'د < (!! 4B?  %(&$ @!! '(<  4B?!<'p!'د$ < !4B?!$X !@ (! " !B (!!$ '(<'!'Я($ < !4B?! !$X !@(! @<  @D!Be!c$B4S? ! (!`!($ '0<'!'د$ < !4C?&!< +@!4c?$XQ+@ !@(! "#0E  @C!E $ @ !(! !$ `!'(<' !0$,@<$cpC!B\!@<$Br؏<$Br<$Br菂<$Br<$Br0$BH<'!!L񐌄$ @( $@ C!CbEc``!<'!'د !'9` !8!@'! %$0!@ b!d< E0! < b($B(4G7! `!'(<' !'د$ !X' $@@!",@!!B& !@@(!9,&0 *@!$ '(< 4B7 !!< 4B7<',!'د 0!, ! b !@  !T', $A !< 4Q5 ! '(H!$B$$ %  $%(%& $ $!<'!'Я,($ !!!0$P< p4B7XL ` !C $b L ` !< _4B7E'9`  !@E ($` $B( !BC`< b*@< .4Q7C*@2"@$2" @$$E$Bp!d0 %dB@ $EBp!d0 %dQT !'9 (!@@!@(!'9  !L ` ! !,($ '0<'!'d`\XTPLHD@BE(!F!E0CE(0v!!0XL&P !  !'9` (!@@!B@{0$$0'06B8B0c+` !0B@B9$0B@64$0@10B@,$0B@&2 4 !(! '4@4@ A@!<4Bb%<4Bb$$C  !(! ' @2$@$@$b !(! '8@8@"C$@0c$b$" L0  !0 !!  (!L  !xb$Bbx"$B"d`\XTPLHD@!'h<'!'ȯ0,($ H!!a!< 4B7`!! 'H8!` !@(!  0!H@&!0,($ '8<'!'௿ !` ! 'L@!L@2< ;` ! 'P@! !P@1'$Pb+< H A%! C$ P` !b(f $b,B@< 4P; L$BίL 4P;PH 'A!< 4P;!lhd`\X'p<'!'|xtpp< !! ! !4Q;'(@$ !'8 $ !''9 'h@! !p$ !H 'H`!  !Dh '@  ! C$b< 4Q; !|xtp'<'!'௿< 4B; ! A!< 4P;!' <'<!'x|xtplh!!!!<  4S;p !$ ' B`!?  !p$ '00 !d@ !(!0! 8!'P !(!'9 '`@!`ȯ@ !(!0! 8!`@ C$ b< 4S;`!|xtplh'<'}!'XTPLHD@<8t!!p.< C4B;!X ! 8!@!x' $ !(!$ 0'0 !䨯(!0! 8!@@!0 !'9@ 0! @P`!< 4S9 C$ b< 4S;@`!@`!XTPLHD@<8'`<'{!'H$!!$菙ܨ'@ !' $ 8! &@@'<'{\!'Я($ !!!,@< 4B;܌$ !A  C$b< 4Q;@ ! ! `(! !($ '0<'z!'ȯ40,(< !4B; !!!4$` ' $  @< 4Q;4$@ ' $  @ !< 4Q; !40,('8<'y!'Я,(< 4C;$4$'  !$ @!< 4P;!,(`!'0<'y4!'د$ < 4B;,< ,$f~'4B; ! A!< 4P;!$ '(<'x!'\XTPLH$@!!!' x`(!'@< p@ !$'0@4Q; ) !&0 !@ !$$'DA< 4Q;$D$  !0!ü (!` !@@0!@'9@ @! !\XTPLH'`<'wl!'Я,(< ,4B; !< 4$ ' ` 4B;$ @!< 4P;!,('0<'v!DBC<'v!'tplh!!! !p !$ ' $< p'0 $$b !< ` @ !D`$(!$  '`@< 4Q;<  4B;p  !$'@$'P  !tplh'x<'u!'`!!!! !p !$ ' ` !$p '0< I4B;p'@ $` !$p 'P#$b*< <  !@" @ !` !< @!@ @ !d$`(!$# '`@< 4R;< 4R;p !$ 'h` !$p 'x@!'<'s!'`!!!! !p !$ ' ` !$p '0< I4B;p'@ $` !$p 'P#$b*< <  !@" @ !` !< @!@ @ !d$`(!$$ '`@< 4R;< 4R;p !$ 'h` !$p 'x@!'<'q!'Я($ !< $F'4B; ! A< 4P;"!($ '0<'q`!'ȯ0,(< 4B;!!4$'$$ '  $$A< 4Q; !0,('8<'p!'<840< !4B;!!'< x !(!$@4B; $$'(( (! !@ @0!('9@ < 4B;<840'@<'o!'D@<8< !' 4B;!(!!  $(!$!b '00 @ !< 4Q; !D@<8'H<'oL!'Я,(! '@@!!,(`!'0<'n!'<840$!$!!< )4B;'9 @(! !'9 ' @! $b(!< 4B;$'$$ '(@< 4P;(B!<840'@<'m!'ȯ0,(!$!< &4B;'9 @(! !'9 ' @! $b(!< 4B;$$$ '$@!< 4P;!0,('8<'m!'HD@<840!!!!!,@< 44B;< (!' 4P;@| '@@!@ !'( ',@@!@ !  (!@!(! ` !d @< !< 4P;!HD@<840'P<'k!'د$ '8! !8!'P(!0!@@! !$ `!'(<'kD!'Я(l$  $< 4h;$$$(!0!C'  $ $(!$'$ ,B' DP(!bC0! 8!@!(!'0<'j!'<840x'!! !(! $<  4B;< (!'(@4B;$$ ( !@ @0!('9@ < 4B;<840'@!!!<'i!'Я,($ !!!@!  $b@6$$!1/$BdE !(# 0!@  !  !,C$C#p  !"!(!@!$ tb !E (@@@!Bc@,($ `!'0'!!x!$@!H!h!9$@4 +`p!$$?$0bP!%N+@ g$b%f*@"$%*@@!$$BN+@$cy%$ .$ \$ LK%)%)$cj%%)@ +"#@!$b?b*@ H!8$@.0!$$?$ $ .1Y %#$X$$C%0!m$$ .$\$ K$cH(%)$"j%),%)@)+#$X)+@! '!<'e!'د$ (!@ !< (!  !(&1"*@@!!$XB!Dh&1 &Rx"*@@$X 0@!8C!DX &10"*@0@8X `$ '($ 0!$ (*8! $B D#*(!`@*$8!$!K4CDEK (8!$B(!H! "@0! @!"$!CDB%x$ #(E*@` ! !*@$C`#0 0! b D$b#!&43Q`(b@ 'GXܨ(!$0#$\ ` ! @"`C!(C`8`\]C%dC,b*`llhdGXܨ'䯢0# ! (! @ e @ !8!'9>0 0! ldC!F*` lhg $@ !'9>  `b@+d C$D#b!$p "'GXܨ''Я ! (! $ @  (! @ !8!'9>0 0!  @ !'9>  8!0!'9< @ ! @` 'D$@ $Db fLE8!$dL!<'D !'<840,($ H!!!!PTX\`$ !$\bF$b@$c$cb@$.cb$($$BG!$Bb*`$@ 04($C@&d!!(,8(!!`($*@$c0B@!(@$ $$ <@(8"b!DHdDx(!GD&@ !$ D@!  !C0:2p%$BQC@$  ` !@&sb@E&$.bF` !@`!F$\$.bG$b@$c$cb@E(@@H$Db`!&&&R$\$.Gb@$cb$cBb&&&Rb@b@$s@&RW^BCDHXL D !(!d<840,($ `8!@0! '@$@!<840,($ `!'@<'?!'Я,($ x$!!'   !< !@4c[ C%@& "! %p"!< 4C[,($ `!'0<'?4!'@<840$!!!H!X@!(@$!$ '$#Z',' ` !@(!`0! 8!'9K @@!p$&%" $ FCEB$%&'\$ &$ '('9K @@!($"bdxD%" be$dE%" bc@(!C%"$(`0! ' @P<  ' $B,C`$ &$@0!Q' '9K @M@!,$"xC%"' C%" $$,@(!`0! 8!@@!, !C! ,$B,C`$ @0!&$  (!,$x@(!`0! 8!A< 4C[  !$B,C`$ &$ (!@0! !`@!@<840!'H<';!'\XTPLHD@<8!!lpt!H$ !(!$|(BC&D C%0$x0@(!0! ' @!@l&0C!0CD$Bd%鯢0CD0Bd%@ 0 4Q  '  !@(!0!'0'9L & 2!'  !0B@(!0!'0@4#40'9L &`0!l@ ! H$B  @@0!A<4B%<4B$$C*@Hl$$  ! ' \XTPLHD@<8'`<'9H!'Я,($ !!! ! ! @!B!$B*< P (!` ! 4B[ r !$.P(! $!,($ '0<'8t!'<840($!!! !$ $PT@@&"<b*@$"8b!e$'9R '0(@#@!'0$B $ !& D$BS\(!  ! $(@ @! !`0!@8!'9O (<840'@<'6!Ψ <'6!'௿d !' <'6!<<$s$s $H<'6`!'lhd`\X < 4C[H!!&!$$\(! &TP H( L &"H X\\'(t !`(! 0! @!< 4C[lhd`\X`!'p<'5\!'௿< 4B[ !' <'5!'HH!d0!< $4C[$<;4B$$ ((4`44@8@h<4@ '@!< 4C[H`!'P<'4D!'ȯ40 < !04B['(HLP  <;4<0!,( !40'8<'3!'tplhd`\XTP(!!< 4B[$,@$$< 4B[< 4B[$$!$#tL``&bLT$  !D$BO !@!!C$.(b !b<@bB0B@D$BO쯢 (!8!` ! $(]@!&12"#0B"!q*@!*"@P$'0<q# P!$& (!(@ !$.bD$c&b@b*@$b8'PE$ !$'9R @8!(@@!& D$BS\@(! 8!` ! $@(!(@!$! "!```!$b< 4B[4B[tplhd`\XTP'x<'0T!'௿< 4B[! ``' <'0!'௿ @! $`!' <'/! <'/!'௿0 ! !d$  ' <'/4!'௿0 ! !t ' <'.!'د 4$$bBc ' '(<'.!'௿ ! !d$  ' <'.H!'௿ ! !t ' <'.!'د !"$i@!'9\  ! (! '9] '( '(<'-|!'Я($ !!!'9\ $c@  !($ '9] '0  !$C  ! &Y]<  !@ !@ `(!&Y]< ! @(!<  !$C  ! @(!<  !@ !@ `(!@(!&Y]<  !|  ! ! @(!  !$C(D  !$/ !d @!  !@(!0  !$B  !d $/ !0 @(!t !($  '0($ '0<'*!'د !!/$b'9\ d@ ! !'9] @(!  !$:d  !P  ! !@(!'9\  '( '(<')!'د$ !!$kG!'9\ @  !$ '9] '(Ȏ$ 8! !@b@(!!  ` !@(!  !\  !@!B !d@ $:  ! (!t !$  '($ '(<'(x!'د$ 0!(!! !$ !@" (! @ !$ @(! '($ '(<''!'د !$a'9\ ! !@ &@(!  !@  !B$:d@ ! @  ! ! @(!t !  '(<'&!'د $!@@(!'9\ @  !B@@  !  ! @(!t !  '(@!`!<'&!'د$ ! ! ! !$a'9\ @!"$4 !@ $ď%$ '9] '( d  !@(!'9\P  !  !@(!  !$/d  !  !@(!0  !B !d@ $/  ! @(!t !$  '(<'$`!'د$ !!$a!'9\  !@  (!@ !$ @(!'9] '($ '(<'#!'D@<840,($ !&\!$v` ! ! &]` !@! (! p` ! ! $o@` !c@!@  !&Q]<@(! ! ` !  !@(! ! ` !  !@(! ! ` !܄  !$C  ! ` !܄  !@ !@ '` ! ! @(!  !$C  ! @(!  !@ !@ '@(!&Y]< ` !\  !@(!` !&] B@ &\` ! $s'9] ` !d$Y] ` !B@` !'9\ $u'9] ` !B! @!` !'9\ $e@ !'9] ` !* @(! ` !  !@!B` !d@$( ` ! (!` !d $)t ` !&1  !"+ (!p@ !J! ` !$p'9\ @!p !@@  ! ` !'9] @(!+`! @(! ` !  !@!B` !d@$( ` ! (!` !d $)t ` !&1   !"+ (!L@ !( !@(!` !$Y^T 'h` !$Y` 'd (!@!` !$Y\ $t@` !'9]`  !@(!'9\P ` !  !` !@(!'9\ !q$ (!@!` !$Y\ $rB,@@ !E0'9] ` !X !@!@ ! $QcX@0!'(! ! ` !$ d ` ! @ !@ !` @!@0!` !(!' ! (!@ !0@! &@0!` !(!'$YcX $ d ` ! @ !+(!@@ !` ! $t ` !'  !+@ !&  !+@O !h  !@J@!` !'9\ $z@4!(!  !E@!` !'9\P &0` !d$- #0(! ` !#$@'b ` ! ` ! @(!d` ! $ +@@` ! $t ` !  !@(!` !&a ' ! ` !'9c @(!  !+(! !@& ! ` !'9d @(!  !+(! !@& ! ` !'9e @(!$  !+(!Ƥ !@&t` !&gp 'j!$  !` ! @!` !'9\ $m"@$u%` !'9]$$4` !$ $%@$y]` ! (` !$<T  !@(!@ '@(!&]< ` !%$~$$d` !K$$$d` !E$-A` ! ! !@,= @ !@ '@(! ` !` !d $-(! !X &@(! ` !` !d $/  !+(!@ !` !$0 "@ ` !d $/%0 ` !d` ! $ $$  !` !@ '` !&]< @(!` ! ! @! ` !'9]< @(!l  !+(!L !@& ` !B+@ ` !R` ! $t ` !%d` !$Y] !%l` !$Y^T '%h` !$Y` '%p` !&a '  ` !'9d @(!  !+(! !@& ! ` !'9e @(!  !+(! !@& ! ` !'9c @(!  !+(! !@&%t` !&gp '&  !+@(!8 ` !` ! $@ ` !D@<840,($ ,B'H<'<!'<840!!(!'@0! ! !$ '@ ''@"$" B! '!<840'@$! <'@!'د$ b0!$ &&% $@0!1$$ !'(+@ !$c$d!<'t!'௿! $ @!&@(!db@C$e$B!' $! <'!'د$ b0!$ &( &%@0!1$$ !'(<'(!'د$ !! $ @!(!x@$DF  ! 0!@ $ BC"B$cCQQD &D$ !'(<'X!'Я($ !!$  !@!(!x@$DF  0!@$ b3"b@QQB !q$BBD &C($ `!'0<' h!@0! $<' L!'د $!"&$#$B`  0!␏ $  '( '(<' !'௿!@  !' <' `!'د$ ! !&0&%0 @ !&CC @ !!1@!$ '(<' !'د$ !(! !&0&%0 @ !&CC @ !!1@!$ '(<' !'د$ $!!!@PB#$B&$ BD 0! $ !$ `!'(<' P!'ȯ0,($ H!!!:!b% !E!BR$cD!bD##br@"BR "Q@&& !0 (! (!` !P !0,($ '8<' !'HD@<8Ԑ!$0!!)$ B F#"$% &HLGI JK" $(,0@4M-B@&CCC (!&"Ԑ@ !`(! 0! 8!HD@<8'P<'!P <'!'Я($ !$!&( `(!(!P@ ! @!!($ '0+@ !$c$d!<'!'௿! $ @!&@(!db@C$e$B!' <'4!'<840,($  !'P!! !&<(!x$ & !0!0|@8!&%H @ !8!<' &  !&%H|0! @8!@ !8!<' & !&%H|0! @8!@ !8!<' &  !&%H|0!@8! 8!@ !<' &$ ! @(!8!@ !<,' &L@(!  !@ !8!<, 'Ș '@!!<840,($ `!'@<'!'ȯ0,($  !'! !$ !b &p (!@0!|@8!  !@ !8!< 'Ș '@!`!0,($ `!'8<' !'ȯ0,($  !'! !$ !b &p (!@0!|@8!  !@ !8!< 'Ș '@!`!0,($ `!'8<'D!'௿x !&d ' <'!'د$ $!!!@PB#$B&$ BD 0! $ !$ `!'(<'H!'Я($ !$!&`(! $(!\@ ! @!!($ '0<'!\ <'!'د $!"&$#$B`  0!␏ $  '( '(<'!'௿!@  !' <'!x <'!'<840,( !' !P! !(! 0!@8!` ! @ !`8!<`'  &pd !< (!@ !8!<8 ' Ș ' @!t`!<840,(`!'@<'p!'Я,($  !'! !(! !@0! &0d@ ! 8!<` ' !< @(!@ !8!<8 'Ș '@!2 !,($ `!'0<'!'ȯ0,($ !!! ! !T (!@0! `8!0,($ '8<'!'د ! ! ! (!L @0! '(<'! @! `!@! `!|<'$!'௿0!L$ @$$ @$!`!' <'!'௿0!L$ @$$ @$!`!' <'l!'௿L$@$ @$!`!' <'!'௿$@$ @$!`!' <'!'د ! ! !  (!@$! `!'(<'P!'د$ !! ! ! (! @0!@$!$ `!'(<'!'د $$!@ !  !(!ð @0! '( $'(@!(`!<'4!'௿$$@! C`!' <'!@(8+@ $cP$$ `(!<'!ð$$`$ <'\!@$$ @!(`!<'!'௿!C$$` ! D ' ' <'!'<8!0!8`'$~|@$  '&$@0!ð '@!<8`!'@<'! $x<'!|+@ $c$x `(!<'! $x<'! $<'x!+@ $c߈$ `(!<',! $<'!| $<'!+@ $c$ `(!<'! $<'! $<'p!'@<840,($ !!@!` L @!KT @!$bT  ! !| @(!@|$b  ! ! @(!@k  !@d&$ &$@\!u!D<&v!.@d<&L &L@Md&d  !(!@0!@  !@>l $$@3lP@ ! (!@+pt  !@ h@3B@P  ! !(! @0!d @ !@ !d @! @ !@ !P @! (!0!@8!  !5! @ !@!@ $Q !@ @! @ ! !@ @! !@ @! @ !`(!L@0!8!  !@  !+(! !@& ! FEԎ &d@   !+(! !@&"! $P !@ @! !@ @! @ !%@0!@8! &d@m  !+(! !@&R! @!@ !dB !@ p  ! !(! @0!&`! ` ! @!` ! @! @ !` ! @!@(!l 0!8!  !@!` !@&b@   !` @(!@ ! &d+(!@ !t!t  !!@<840,($ `!'H<'T!'د ! ! ! (!  '(<'!'د ! ! ! (!䏿 @0! '(<'!'Я($ !!$  !@!(!@$DF  0!@$ b3"b@QQB !q$BBD &C($ `!'0<'!'ȯ0,($ H!!!:!b% !E!BR$cD!bD##br@"BR "Q&& !0 (! (!` !\ !0,($ '8<'d!'HD@<8!bG!' 0! 8!$ $ $&H@0!`8! $ $'0 0!@8! $ $b@&dDdB@&CCC$@0! (! &b@ !(!`0!  8!HD@<8'P<'!0! $<'!'د$ ! !&0&% @ !&CC @ !!1@!$ '(<'!'د$ !(! !&0&% @ !&CC @ !!1@!$ '(<'4!'د$ !! $ @!(!@$DF  ! 0!@ $ BC"B$cCQQD &D$ !'(<'d!Ќ+@ $c$ `(!<'! $<'!'௿8!$ @$$ @$!`!' <'!'௿8!$ @$$ @$!`!' @!P`!<'(!'د !!ð(!$L0!@$  !@@! P!Q8! `!'(((!@!<`!<'t!'௿$L@! C`!' <'(!@$L <'!T <'! <'! <'!d <'! <'d!'ȯ0,($  !$0 e' !&p !0|0!&EH  8!@ !8!<' &p !&EH|0!  8!8!@ !<' &p ! (!| `8!@ !<' &p@ !  (!8!@ !<' &pd !<  (!8!@ !<8' &p !,  (!8!@ !<' &ph !  (!8!@ !t!'Я($ $! ! !@!@ !@!!  !@(!  @0!` !(! !@$   !`!  !@! !($ `!'0!<'=h!!F <'=@!'Я($ !!$ !@!(!@$DF  0!@$b3"b@QQB !q$BBD &C($ `!'0<'b@d$B~8b!c@$B~4b!'9,0 $c~0!!@" bbD$B'9, b@!$`B!bP*@$cbP$`bU!b6b#0,($ '8C0#$$0$ $ $$C$Bj(b @i$b,B@$$B$a`!$b##$B$B$<'!4 $Dh!$,F# @!dX!8 "*Θh`!P!$8!@ $M D ce䍤4 C譄4PEP<',!'\XTP D@$Bqb!b$C,b@!4$c@C!B\!@t0C#440 ,(,( !Ǭ䌂x¬txtttttttttttp$p$p$p $  $  $ Q!FE 4 0 s00! $H k (! dQ!FE 4 0 X00! $H PQ!FE 4 0 D00! $H <<Q!FE䯦4 0 00<0! $H ( $ !tBd!b䏙 $ lQ!cGEF  @ !  (! h  $ h tl 0# @ !4 $p  (! lD!DH0FGCB,,04(8<  !  $ h `lQ!FE @ !  (! h 0`l$H 0! @ !  (!  $ zh s@Q!FE @ !  (! ah Z0@$H 0! @ !  (! K $ DQ!FE  9 $ 2h + $ $ $ h 4 0PD!DGCB$B|48<0 ! $ 4PD!DGCB$48<0 ! $ Q!H0F GECB,48< 0 @ ! (! @! @$@04  ! @ !  (! h $C$  (! h $C$  (! h $C$  (! hQ!CB< 8<#l $b4L8$0!  @ !  (! hQ!CB< 8<#l $b4L8$0!  @ !  (! hQ!CB< 8<#l $b4L8$0!  @ !  (! t'9 0# !z䏙t'9 0# !n䏙h gh `h Yh Rh Kh Dh =$:p $ 3h , %h  @Q!HEFCGB8<0 4 @D!DEFCG48<0  ! $Q!CG0!  0!Q!CEG  Q!CEFG  t'90# Q!@!4P+ @ !4 $ P䌂$D!C䌂$D!C䌂$D!C䏙t'9 0# !䌅t 0# t'9 0# "t'9 0# v"D!p@䌂D!j@䏙t'9 0## q!^b䏙t'9 0## q!Rb䌄$H !LLHD@D@A䌄 !䄃쯢D@@DHLLH0䌂$D!*C䌂$D!$C䌂$D!C䌂$D!C䏙t'9 0# ! 䌂0D!FE$H< 8 Q!CEFG  Q!CEFG  hQ!CB쯣< 8 8<0`$H  ! hQ!FCEB8<0 4 48`<0  ! hQ!FCEB8<0 4 <0`48  !  Q!GF $  Q!GF $  Q!GF $ { Q!GF $ p Q!GF $ e Q!GF $ Z Q!GF $ O Q!GF $o D4 $o$Ɠ $ ; Q!GF $p 04 $p$Ɠ $ ' Q!GF $q 4 $q$Ɠ $  Q!GF $r 4 $r$Ɠ $ "\X"PT'`<'8!'د$ $!('9  !%$  @@$B`b!$%$Bh !b`""D'9, `!@!$`!BC*@$`&!BC(!'9  !"R$#$ #'(<'!'د$ $!(#"cQ!C" !'9$B "'9  !"M@;!"%$ $B" @@$B`b!$%$Bh !b`""D'9, `!@!$`!BC*@$`&!BC(!'9  !"R$""$ `!'(<'\!'௿D(@$Bv(!$B{b!b$C` !C#d!b4 $('9 M,B' <'!'௿D(@$Bv(!$B{b!b$C` !C#d!b4 $('9 M,B' <'!(!D$c{!c @$Bv0!$d $d# !4 <'!'௿4$(B,!Θ$(@ $M D cP!C DP!$c !E4'9  !' <'!'௿($b! (,0'9  D M$vfv $ !p! ,B' g4䌃D!$c $$cM!<'!'௿'9 !$M!' $M!$M!<'H!'௿!D$Bv@b!$(e$B{ !p!b$@#p!c4  P!C4'9  !M@5 @$l$B `d !b!b$D$c$G\!(B@G!BF+@$!+@!<$Bt!C @$B !$Bb!y ! D@!' <'!'௿!$(D$B{ !p!b$@#p!c4  P!C4'9  !D !@$Bvb!b'9 M@5 @$l$B `d !b!b$D$c$G\!(B@G!BF+@$!+@!<$Bt!C @$B !$Bb!y ! D@!' <'!'840($b*!#D !#H!$kX$J$T%JDP%khfG4P!%%%p!FHg4H! (,0$ ( @$lC!D%#\@C!BH!F$M@ <$Bt!C$b (@$B `!D<$Bt!C$b$l!B$$B@%#\C!BH!F@4`6$$@C!F@4`%$0 &C0C!B0B@$\64`6$@ '&'4`$044`$0$ƔH& &Hڸ  ! !$B'9 M840,B'@<'!'௿!D$B{!C$(`C#p!c4  P!C4@$Bvb!b'9  !M@6 @$l$B `d !b!b$D$c$G\!(B@G!BF+@$!+@!<$Bt!C @$B !$Bxb!y ! D@M,B' <' !'௿D(@$Bvb!c!$B{(!$ (,0 G#p!c4 '9  $vevP!p!Ef4DM`9 @$l$B `d !b!b$D$c$G\!(B@G!BF+@$!+@!<$Bt!C @$B !$Bxb!y ! D@M@M,B' $$( 4M<'!'ȯ0,($  !@MB 0@&\$Bl!Q@C!B@RE$B`& `@b! !$Bh!cF$CE$BD'9, !@!$`!BC*@$`&!BC(!'9 @ !E0$F\3!B@F!B+@$q`!3+@3!&\@C!C0b& `B @C!Q< @$Bt"!C$B !$BHb!y@ ! BDBM@0,($ '8<'!'د$ !!!@T &1DB b! !c&b &R @! $!$ '(<'!'840,($ |! !Pl! !! !lB T@!  !tPT(!`0!8!840,($  '@l@E<'! $<'!'௿! $@&   & &  &$&L ' ' <'!'د$ !<!$R@$4(!@!  0!(! 0!4$e@:$P@! (! 0!($g@0$@! (! 0!4$f@&$@! (! 0!4$h@$@! (! 0!4$i@$@! (! 0!0$j@$B|@! @$k$$ `!'(<'!'د$ !4!$R@$(!@!  0!@S$l4(! 0!@! $؏@J$m4(! 0!@! $X@A$n4(! 0!@! $@8$o4(! 0!@! $@/$p4(! 0!@! $ď@&$q4(! 0!@! $̏@$r4(! 0!@! $܏@$s4(! 0!@! $@ $j0(! 0!@! $B|@$k$$ `!'(<'!,@4$cC!B\!@$B$B<'0!'௿$$$$dD$0H(,@ |!(! $l@!!`!' <'!h $l<'!'Я($ x'!(!` ! $Bp$$B,B@JCM$Bp4`!$X\'      ' 'GF        4`  &d+ $($ '0<'!'௿!$ ! !' <'!'د ! ! !$g (! @0!(! @ ! '(<'!'د$ ! !! !Cl !g (! @0!@(!$ @ ! '(<'!'௿L! ! (!(!@ ! ' <'H!'|xtplhd`\X0!L@ !D! (!@H8<'9௢P 0HP'9H @!0@!l08< @!@ @ !$( 0@ ! (!0@M$l1  b|!  !0쏥8@<@$(,   !0 0!@$( 0*|$ǐDLB  ! 0@ ! (!0@$ЏHPb ! 0(!|xtplhd`\X@ ! '|xtplhd`\X'<'!'د ! ! !،g (! @0!(! @ ! '(<'@!'LHD@<840,(!(!'9௢   !  !'9H @!|"@!\ !8!< !@(! `0!@($|쏙␏LHD@<840,($$ 'PB8!@(!`0! @ ! (!@+Q$B$4(!0!  !@ ! (!@$b(!t   !@ ! (!@  !" LHD@<840,('P<'!'௿! (!@ ! ' <'!'௿!d (!@ ! ' <'X!'௿!D!$((! @0!(!@ ! ' <'!'௿l! 8!`$|$` !! b(!@ ! '  ' <'|!'௿! !@@! !`!' <'0!'<840,($ !4$T@D$H!!P! !@$8(! 0!! $E@$4(! 0!! $@ $4(! 0!! $@$$D|0! !B0!8! !`(! @ ! @(!$BDB8!`(! @ ! @(!@BP $b`DH  !@(!<840,($ @ ! '@<840,($ '@<'!'840,($ l! !!`!@ !P@!0|`!  !" !(!0!`8!  (!840,($ @ ! '@<'@!'840,($ x|! !!! !P!`! "`(!0!@8! ! @ !  (!0$ @8!"$  (!@"$CdU#"840,($ '@<'$!'Я,($ !!0!'9$u@8!@ ! !@(!@ 0!,($  '0,($ '0<'!'௿@! !@`! $  (!@$Bd' <'!'诿 (!@!$X' 0!2l!@B$C,b @-4$c$C!B\!@ !'9D '  !0% ! '( ! '  '$G@0! ' '<'!'௿!\ (!@ ! ' <'d!'Я($ @|! !8!48  ! @(!@! 48L ! (!($ @ ! '0<'!'Я($ ,! 8!!L!@@ !! " (!($ @ ! '00|0& $H0 ($ '0<'!'840,($ l! @!!!@ !P@!!  (!840,($ @ ! '@0|  !" !PT(!0!`8!840,($  '@<'!'د @! 8!!0!@@ ! (! @ ! '(!   ! (!  @0! $ @ $ '( '(<'!'௿!L (!@ ! ' <'|!'Я,($ l!D$!(! !@s@!X 0!`(! @ !!@Ql#,b@X4$cHC!B\!@@ !'9D (!G@ !@ ! (!>@ !(@ !0E@ !( (!@ ! 0!-  ! !(!< @0!  ! !(!@0!   ! !(!@0!  !'D@0! (!Bl(!D0!,($  '0,($ '0<'8!'ȯ40,($ |! !!! ! !"l$B @ ! (!@! " !`(!0! @8!@ ! (!40,($  '8<'\!'!$F(@$4`'  $p$B,B@$p`$lCbE#$F$ H!(!$ b$ $ $%)h@(!BD`$C'8!$B$ (!@'4`$ $p$B,B@$p%$p$$B$!$B4p$B$$B$ !$B$8  !!`!'<'X!'Я($ x' !(! ! $&p !4` $$#&H4`' ! $@0H4 ! $X !$ 4\@ $h @ ! "p$B,B@$"p($ '0<'<!'Я($ x!!' (! $#p$44$c,c$t`$0!'3`0"Mt       $"p "#$%&')!(*      . '+,-./0123 ($ '0<'!'Я($ @!'%'9!!8!0!@ ! !(! !`@! 8@ '&0 @ !!$ @ !&0S#  !$B,B,@ ! !($ `!'0<'!'Я($ !BD!'!!@(!@ ! '9㠏@ 0!@$$!W8' @ !Q#'90 $B,B@B!! (!$@(! 6`! BS !&1  !"* (!`@ !!$ !  (!@!! Bb !&R   !B*@(!@ !&1  !"*@`!($ `!'0<'!'د$ !!!!@!  !,B(!4ͨ' $@!  "8` ! 0!8! ' @!$ `!'(<'!'د$ !!!!@!  !,B(!4ͨ' $敬@!㕬  "8` ! 0!8! ' @!$ `!'(<'!'د$ !!!!@!  !,B(!4ͨ' $@!Č  $8` ! 0!8! ' @!$ `!'(<'!'د$ !!!!@!  !,B(!4ͨ' $数@!㕰  "8` ! 0!8! ' @!$ `!'(<'!'د$ !!!!@!  !,B(!4ͨ' $整@!㕴  "8` ! 0!8! ' @!$ `!'(<',!'د$ ,!!!!@!0  !,B(!(ͨ' $8@!8  "8` ! 0!8! ' @!$ `!'(<'H!'د$ !!!!@!  !,B(!4ͨ' $數@!㕸  "8` ! 0!8! ' @!$ `!'(<'d!'د$ !!!!@!  !,B(!,ͨ' $F@!F  "8` ! 0!8! ' @!$ `!'(<'!'د$ !!!!@!  !,B(!,ͨ' $捴@!㍴  "8` ! 0!8! ' @!$ `!'(<'!'د ! !!! !,B' 4ͨ(!$敼@!㕼  "8@ !0!`8! ' @! `!'(<'~!'د$ !!!!@!  !,B(!4ͨ' $@!  "8` ! 0!8! ' @!$ `!'(<'}!'ȯ0,($ !!! ! ! (!@0! `8!0,($ '8<'}l!'Я($ !!$(!0! ! !$b#P!($  '0R̬S($ '0<'|!'د$ @ !@!!D@(! &܏%'̏ @0! &R@ &1 !$  '(B+@&܏$  '(<'{!'@<840,($ \`!4&@LP$(! 0!`!X !@${4(! 0!`! $P@w$g4(! 0!`! $̏@n$|<(! 0!`! $s<@e$}<(! 0!`! $'@\$~4(! 0!`! $ԏ@S$4(! 0!`! $@J$4(! 0!`! $쏼@A$4(! 0!`! $@8$4(! 0!`! $@/$4(! 0!`! $@&$4(! 0!`! $@$4(! 0!`! $(@$4(! 0!`! $4@ $4(! 0!`! $@@$$,LP&@ (!$ ! `0!@/$t4 (!`0!! $H@&$v4 (!`0!! $P@$w< (!`0!! $܏@$x4 (!`0!! $\@ $y, (!`0!! $x@$z$0!8! !(!'9 @0$$򌎤LP @ ! (!@$BȎ\` @ ! (!@ !@<840,($  'H@<840,($ 'H<'wp!0$,8$b!Bp$b<'w !'د X!! 0! ! '(<'v!'Я($ !!!!"@x &R$B !b!cS +b#@&&1@S !@$",C$c`!($ '0<'u!'د !!"@x $B b! !c&b#@&1@@$",C$c`! '(<'u!'௿!@x Bb!b&' !`$C$B@$H! @!( !'(!%$*@ !<'t !'د !!, !@@(! @&&! '(<'s!'د !!, !@@(! @&&! '(<'sH!'௿! !!' <'r!'د !!@ !% "@!B@`$% $"! `!'(<'r`!'Я($ ,!!! !@!$ &@!$D`!`$brpq d!($ '0<'q!$  $<'q!'Я,($ !&h-@!g %b'9p 0!@3!@0P$ (!&bE+@$g '9p 0!@ '9 '!@P$ '9 ' ! !,($ `!'0<'p<!'د !bE+@$p'9@ @!"P!P` ! `!'(<'o!'د$ $P'9@! !+@ !x00#`$ D !B@ !Q!@$ !'(<'o!'د$ !(!'9p! !(!@0!X@ !$ " !R!@$ `!'(<'n|!'௿8!0!'9p(! !@!!@`!' <'n!|8!%( F (!& !$c<'m!` b$B@b'9 <'m|!'د$ !!'9@(!0! !(!@0!X@ !$ " !R!@$ `!'(<'l!'د$ !!E$넌C  0!b$  '(! C$B# !$ '(<'l0!'د ! ! !@(! !'9@ 0!(!P@!$  ! `!'(<'k!'د $E'9@ !@!0@ !T Bb!b& `!'(<'j!'د $E'9@ !@!0@ !x Bb!b& `!'(<'j<!'Я($ !Q!'9@&(!$ !(!`0!X@ !D !B@!"!S!@($ `!'0<'i!'د$ P$'9@& !@ !" !P!R"P!@$ `!'(<'h!'௿b! @!$!' <'h!'௿,b! @!$!' <'h,!'௿ ' <'g!'௿, ' B0!$F!C0!!<'g\!'د "@ !x !#B&1b!b#` ! !'(<'f!'Я,($ !!!! !x d(!& ! @0!+@,($ '0<'fD!'د ! $ ! $& '(! <'e!'د$ e+@4!`,@!$D  (@! (!$Q+@@e!D  (@! !܎EFG   !` @ !ED ␎F (QP$$ '(<'d!'Я,($ !! !@!`!D !DF x !&1 (!3+@Cc+@`(!`(!E$,($ `!'0<'c!'௿L  !@!!`!' <'cx!'د !  !@ !%&  "! `!'(<'b!'௿`@ !  ␏( ' ' <'bx!'د `! !%  !@ !%&  "! `!'(<'a!'௿` !' <'a!'د !$E !$x#@(!&   d !$"$C!$B$b! '(<'`!'௿! $@ !$B !$!' <'`!'ȯ0,($ !!#+!`!E+@ 444$$$熐 $.E@ ! $P@"!q+@DxF ! $D&1 ! $q+BxF  (! D !B(!$BBCb(!0,($ !'8<'_!!$E@0e  !<'^!'د$ !+@!b!+@ 444$$$熨 $.#"C!B+@@!@ !&P "#b! &x&  (! !&"$B"@!$ '(<']!'Я($ !!!!dE((! !&1@0+`$!($ `!'0  ''  <'\!'Я($ ! ! !' (!|' @0! !@ '  '($ '0<'\4!'د$ | ! ' !@ '  '$ '(((!(E!! <'[p!'Я($ !C#E+ !@@(!(!E!.b@@$@$ `(!@! ! @0!(! !`8!%@! &% ␎$ (# !(!`0!8! !0! "($ '0<'Z\!'د  $Bb+$!\b$ @Q$B '(<'Y!'د$  !F!b+$!\!b(! @ $@(! 0!"P!"$ '(<'Y,!'௿!@@0!  (# !`(!0!8! ' ' <'X! <'X!'د ! !!&$@ (!@(! !P8!`@@0! !(!0!8!  '(<'X!`8! (!<'W! `e!C+0!(!@8!b+@ C#<'W! `e!@+0!(!8! <'W<!'௿  !@$' <'V!'௿¤ !@$' <'V! <'V\! @@$<'V ! <'U! <'U!.@. <'U!'د$ ! !! !@!+ڔ@ ! (!@0!`0!B@$  '($ '(<'T!'د !!@ !  !(!ڔ @0! '( '(<'T|!ڔ@ <'TD!ڔ@ <'T!'Я('$<4H0!$C!@#$B0``(!@(!ڔ 0#('0<'S!'<840,('$<!@!4D 0!&1C!@#$B0"``(!ј# #B@ @ ! (!!@&B@@ !ڔ (! `0!<840,('@<'R!'د <' `0!$G0G!B$c)b@`(!ڔ 0# '(<'R!'ȯ40,($ <' ! !$C 0!0C!B&1)"ј# #B@ @ ! (!!@&B@@ !ڔ (! `0!40,($ '8<'Q0!0ڔ$N@$ <'P!@(! <'P!x <'P!x <'P! <'P|! <'P`! <'PD!( <'P(!'௿LH !!' <'O! <'O! <'O!, <'O!֤ <'Ot! <'OX! <'O<! <'O ! <'O! <'N!рH <'N!@ <'N!H <'N!BB<'Nl!B$B<'NL!B$B<'N,!'௿ BBT' <'M!'|xtplhd`!!! !(!dX@0!$P @!$Ck"' P  ! !@0!\ @(!@N !P @(!<\ !$ $@ !, $,&0@@!$Q ެ ` ! ! @(!<\$ $,@ ! $,&0@@!$Q  ` ! ! @(!@!* $,@$Q 4ͨ@ ! $@ !ͨ (!@!4(!$Ƙ8! @ ! ! @(!$|xtplhd``!'<'K@!'Я,($ ! !@!BSPH  !@ !8 (!@(!4@&B@ @(! @ ! ` ! ! (!@!` !@@(!1 P(!L & &0 &%؏ ` !@!,($ '0<'I!'ȯ40,($ !! !@!'9= ! @!  !`@ ! `(! !D @(!@`(!  !  !@ ! @(!@@! ! @(!$$! !40,($ '8<'H,!'(ԯЯ̯ȯį茂x'!!!g !(!$S !p'!@!&     '"#$%&'()*+ , - . / 01'9       "#$%&'()*+, - . / 0 <\@ !$ $@ !$<\@$쏙,$, &T  @ !,@$, &T@  @ @$R@! ! '@X$*`!,b@+$ b!'d $@@0!`@!$G $ %&g0!' $ $Zd $@_@0!`@!$G $ %&g0!' $ $4b$$#b$$$ d\$ `$dh $@*@0!`@!$G $ %&g0!' $ $ !y (!!ԏЏ̏ȏď'<'CD!'د !@ @! Ҡ @ !@! @ ! (! !Y  '($$<'B!'D@<840 \!! ! @!E$PB'(  ( !\ &   !  &  x   CD8c ,cȎG`0!@(!  !  ! $ H݀ $ d $  B` ! ST \  @!  !Ќg@(! @0! @@!h݀ $  $  $ !D@<840`!'H<'?!'௿! $ & &d    ' <'?8!'௿! ! (! !@(! ' <'>!'௿! ! (! !ď@(! ' <'>!'د ؏4 !$ƙ'@ !@ !`! 4,  (! $ '(<'>!'௿p !@ ! (!&@(! ' BTB<'=!'د$ !'9N4 ! (!@0!$D @!&$4  '(<'=!'د '9N4 ! (!$D| @!& 쏱 '(<'<!'௿l!  $,\ @ ! ' <'<!'௿ !$B,B@ ! ' ' <';!'ȯ40,($ H0!!! !@!@ !'9N4 ` ! (! $P ! (!P@0! 8!` ! (!'9O 0!@!40,($ '8<':!'ȯ0,($ T!! !@ !Q  @!&$ @!@ ! (!$B,BH@ ! @ !$ @!` !(!< @0!T !@(!0!0,($  '8<'9!'ȯ40,($ HX!!! !@!@ !'9N4 ` ! (! $P ! (!P@0! 8!` ! (!'9O 0!@!40,($ '8<'8!'د$ $!E !$ $,@ ! (!T0! @!@!@!$"8#2$BO8b,$BPb$BR,b$BQ b$BMЬb4$BNPb$$BNȬb(!$ `!'(<'7!'د$ ! !'9= @!@ ! (! !D@ @(! @B$R@!$ '(BB<'6!L $ <'6!L $<'6l!'௿ !$' <'6$!'840,($ !! !$|t !@ !(!x$| @!& 0| 8!&EH 0!&EH&| 8! 0!&&$0! !(! $ !l840,($  '@<'5!'Я($ P !& 넎 @! &  !@ !0! $|` !(t$  '0<'4D!'௿$'$ ! ! $  !H $' <'3!'d`\Xx'!$@ ! (!"(!C@$ 0! !l0b!  ! D BR $' @(!"C@$b ! @ !  !D $ d`\X$'h<'2|!'௿ $,B' <'2<!'د  ,!!@$ $b$ $b`$   ! ',$,h  '(<'1p!'Я($ !!!! !(!0! @8!.(@4$c0C!B\!@"@!$  !P  !#Dgf   (!@! ! $ $""@!" @ ! $$q$"@ ! $ !(d$#$b ! $ !$,@!$<4B`b$`{ ! $  !B(!#$ bn ! $ $"@a ! $$"  !$9$#$b$$ bJ! !$"$  !#$ b: ! $  !$H -!#$ b( ! $  !$H $##$ b3!`  !bp  !$0$␌D  0!$!@@!($ '0<'-|!\ <'-`!'௿(!@@(!D $PL  !$ !(!C0! @0!!`!' <',!'௿(!@@(!D $PD  !$ !$(!C0! @0!!`!' <',!'Я($ !Q`!  !(  !@ !ې @! !@(!@ $ d x @(!@0!$$$($ `!'0<'+ !'د$ Q!@ ! (  !@ ! @(!$ $'(<'*x!'د$ ! !p @ ! !ɘ @(!$"$" DD$  '($ '(<')!'௿ɘ ! !X$ $8! ' <')X!'௿ɘ  '  <')!'د ɘ !$  !b $  $ $ '( '($<'(x!L $ <'(X!L $8B ,BE$b$\@!`!<''!!ŴD$b  $<''!!,D$b  $<''! <''h! <''L!'௿ X$8 & W' C `$B !C `$B !C`$B!C`$B!<'&h!X$$&$ 8!<'&0!D <'&!'د$ $!D2 $0F0@!@ !  (!!$ '(<'%!'D@<840x'!!@ !$!(! !e<TAͨ4B:@ !  !$( Q !"$d C(!$DȏĮ"P0 @!&P &Q@ !h &EH @ !h &E !(!x $ !(!Dx$B4DD  t$<ɘ(|xLXxl\d``hل \`(!@ !HpB"x"" ,"$"LΌ"H"X"\"`"@"(t"00"4 "8"l "p@@!0|G0$H&D 0!E0TďP &D8!D@<840`!'H<'!!'Я($ 30 !&0 ! @(!  ! @(! @(!  !  ! &$؏ &$8 &$H @(!F$␌D $` ! 0!␏($ $d '0<' L! <' ,! <' !ۜ <'!'௿<!C!C!8C!h$$k(! '$<8d!d! d!(!E@0!0!!' <'@!'௿'9k ' <'!'د$ <!$( (! @ !@&1&1 !*@&ݸ &D8F0@ ! (!!$ '(<'H!'د '9k !@!@ @ ! &$8(!<  '( '(EE<'!'<840,($,B$L!!!@!$0 @!"0@(!`0!8! ! $BX&$'  '$!<840,('@<'!'د !&$ $Ѽ  !$00!␏ $L '(<'T!$!,B0!<@`(! !<'!$, X<'!'@<840,($ $!!!!$$`!` ! `!P ` !(!P ` !&,@2$4$cC!B\!@'$  @ !@ $'$$$$"$"$  $"$"$$% $pD   !$#X` !0! '  !@<840,($ 'H<'!'Я,($ @!! !$ !(!$x@ ! @!  @ !@(! 8!|& @0! !(!0! 8!!,($ '0<' !'د 넎  & !0!␏ $ '(<'!'௿$$ '$@!C`!' <'X!'د `4!"0!`$0@' 9  !'$4 $ƙT '(<'!'د `Y $8<  '(<'h!'Я( `Y $@DH  ('0<'!'@<840,( `!4 !!!'($$ƙpX@8!   !`(!@0! 8!  '($4 $ƙ @<840,(!'H<'!'@<840,( `!4 !!!'($$ƙ܏X@8!  !`(!@0! 8!  '($4 $ƚ0 @<840,(!'H<'8!'Я,($ `!B@"!x 4$B`4 8!$ƚL' $ Y ! (!' $4 $ƚ|,($ !'0<'\!'ȯ40,(! $ $菼@ !<0!$H$ @!@@(!4< $<诠$+ !0! @8!@@(!4< $܏<诠$< !0! 8!@@(!4< $<诠$4 !0! @8!@@(!4< $(<诠$+ !0! @8!@@(!4< $P<28!$, 8@ ! 0!@@(!4< $<诠$h 8! ! 0!@@(!4< $<诠$@8! ! 0!@@(!4< $菼<诠$t !0! $@4<@(! $ < !$0!8!  !0!4$$L  !0!4$$X  !0!<$$D  !0!48!$t  !0!48!$  !0!48!$  !0!48!$  !0!4$ $   !0!4$ $L  !0!4$ $  !$44$B$$   !$44$B$$  !0!48!$P  !0!48!$|  !0!48!$  !0!48!$ 0!8!4 !$ ' 4P $'  !4$$$  !0!4$$D  !0!48!$l  !40!$x $@@(!4< $4诠$ !0! $ȏ@@(!4< $؏4诠$ !0! $ȏ@@(!4< $<诠$ !0! 8!@@(!4< $H4诠$h !0! $d@@(!4< $4诠$ !0! 8!@@(!4< $ď4诠$ !0! $2@4<@(! $!40,('8<' P!'௿ ' $ b<' ! <' !'௿x(!$  !$(x$u0$& 4  0(! $Џ& x(!$ ' <' \!` 8!  <' !x`(! $<' !'Я($ 0! ! !0!T$J@@!4%$BH @!($ `!'0<' `! <' D! <' (!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<' !'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'T!'840,(\$ !' 0 !@! !@0!'$  @! @8! ! !$$@(!@(!`! @! !$`(! 8! 0!@(!! ! @8!840,('@<'<!'840$' $$! 0!( ! !'$'(@@(!  @$$$b((!"840!'@<'!'௿!8`0!$~|  !!' (`8B<'$!'D@<840,($ !EHP  !@$!܏E  !@|$E  !@r$E  !@h$ ۀE  !@^$(E  !@T$؏H !@L(!$H !@ ! @! @ !@5@!,@ ! (!@!(B`@(!@$`(! @ !@ !@!d &s" ! @(!  !@P` !pc+&+@&+!D@<840,($ 'H<'l!'Я,($ ! !@!@<! (! ` !@ !@!d &1,2+  !@ !4 $@  !@ !4 $@ !,($  '0`B,($ '0<'!'د 4!$Ƣ ! !$ @(! ! (!4 $Ƣ8 !$ @(! ! (!4 $Ƣt !$ @(! D'(@D<'(!'840,(!E! ! !@! (!$ƲЏE @ !@ (!w$Ʋ؏E @ !@ (!k$ƲE @ !@ (!_$Ʋ菂E @ !@ (!S$Ʋ(E @ !@ (!F$Ʋ4@ ! $@ (!9$Ƴ4@ ! $@ (!,$Ƴ4@ ! $@ (! $Ƴ܏E @ !@` ! (! $ƳG, (!($Ƴ$ ` ! C $b (!$Ƴ0 ` !@!t' ` !(!0! 8!$C$ C(g*@`8!G(` !(! $ !840,(!'@<'!'쯴诳䯲௱ܯد\! ! !@! !@ !@(!4 $Ƣt@!$Џ'@&s` !'9P (!@ !(!0! 8!@!@ !p@@(! @ !@(!|$  ' @!`  ! ' @ # !' ܏E 'Џ@ 'P4@ ! (!$Ƣ4`$ ! ' @ ! (!0! 8!Џ쏴菳䏲܏'<' !'lhd`\X\! ! !@! ! !@(!4 $ƢtP@ !4@! $菼@@ !, $BY+'@&s(!'9P ` !0! !(! 8!@! !p@@(!  !@(!|$  ' @!` @ ! ' @*(܏E ' @@ !4'P !(!$Ƣ 8!4 $@ @ !, $B@$PPPlhd`\X'p<'!'xtplhd`\! ! !@! ! !@(!4 $Ƣt@!`5$&R@ !'9P '  !`(!'  8!'@@!p !@@(! @(! !|$  8!!(!@ ! `@@ !$(! 0!!xtplhd`'<'`!'د ! !@ !4 $d !@ !$`! $4$b(Bc(   !@ !4 $ !d@(!$ $ !'(<'P!'ȯ0,($ !!!!%! ` !@ !@ @!@ !4 $0@@ &@(!8 $*@$&1 ` !"+@ (!.@+4$cC!B\!@P@ !P@ !E!P@ !P@ !Pۀ@ !(EP @ !` ! (!@ !@(!P @!0,($ '8<'L! <'0!'LHD@<8\! !@!4 ! $<@ !4 $D@  !4 $@t'  !0!8! E'$t0! ! 8!$ C*@X@0!V0!܏E  !@M'(4 !&fL8! E', !&fL8! '04 !&d8! E'48! ! &d,(Eg*@`8!쯠&fL  !0@ 4@ !E&d$E !&d8! @0!LHD@<8!'P<'!'د P(! ''4  &x@ !, &% $ !&x @+$ @ ! &% $ !&x @$ @ !< $`&x ! @$  @ !$֏C$$ !'(<'d!'ȯ0,($ \! !@ !@(!4@! $ƣ|'@(!| !'  !A$4' $ $ƣ/`!  8!' $$   !$ !|@(!&f, @! 8!Cb !  !@(!| &f8$4' $ $ƣ!0,($ '8<'!'ȯ0,($ \! ! !@! $@ !@(!4 $Ƣ@!P 0!@ !(! 8!@&1ܐ(!@ !0! $ԏg@ !ܐ@(!$  @!(!@ !4H$Ƥ  8!g@(!4H@ !$Ƥ@ @!&p  !@ !4H (!$ƤX @8!0,($ '8<'\!'ȯ0,($ \! ! ! @! !@(!4 $Ƣ@!$B$BBPF !`(! 8!@ !ܐ`(!0! $ԏG !ܐ@(!$  @!G(!4H !$Ƥl  !`(!ܐ0! $ԏG !ܐ$@(!$  @!G(!4H !$Ƥ$ `(! !ܐ0! $ԏG !ܐ$@(!$  @!G !4H(!$Ƥ $0,($ '8<'0!'ȯ0,($ \! ! !@! $ !@(!4 $Ƣ@!P@0! !(! 8!@&Rܐ(! !0! $ԏg !ܐ@(!$  @!g !4H(! $ƥ 0,($ '8<'!'ȯ40,(\! $ ! @! !@(!4 $Ƣ@! $'  P@0! !'$ (! !8!4&R@$ƥ` 40,(+'8<'!'<840,(\! ! !@! $ !@(!4 $ƥA@!$  !8!4@4$ƥ$  !8!4@)$ƥ$  !8!4@$Ƥ$  !8!4@$Ʀ $  !8!4@$Ʀ`$ @$P`0! !'$ (!'  !48!$Ʀ@&s@!<840,('@<'0!'௿4\$$ !@!4\ !$ $@!4\ !$ $@!4\ !$< $@!4\ !$ $@$4\ !$ $@$4\ !$ $@$4\ !$D $@$4\ !$ $@$4\ !$ $@$4\ !$ $@}$4\ !$ $@t$4\ !$  $@k$4\ !$( $@b$4\ !$0 $@Y$4\ !$8 $@P$4\ !$@ $@G$4\ !$H $@>$4\ !$P $@5$4\ !$X $@,$4\ !$` $@#$4\ !$h $@$4\ !$p $@$4\ !$ $@$4 ! $$`!' <'!'tplhd`\X!$ !!( !@ !  !` ! "  !P @(!  !@;@!(!  !$D@ @! !@ @!@ !4 $x@ !@ ! @ !"(`! @ !4 $@@ ! &+@ ` !@ !4 $@ !P ` !@ !4 $@ $P !E >$# b: !P'  (!'4  $< !4  $@@@ !B@ b!@#,c<b4BMb"($C "84 8!$Ƨ'X $!!tplhd`\X'x<'!'x|xtplhd`\! !@!⸏E  !@(!؏  !@0!'9l @!@ !!$(! !@ ! @!@Z@!`(!  ! !@(!' '9L @!&s@F !   @ !@!B b:v+$b.'`C,LC !XC80C+@D8B8 !@#! @  !d P( ! B$@ !P @(!~4$Ƨ $x !v+@&+@ 0! !@!4 $@ @ !4 $ԏ@P@ ! (!P$4 ! $<@#4 ! $D@4 ! $@(!4 $@$, ! $B@$B,@,t&B( !0!܏E  !@$4&B($ƣL ! 8!&B,4 !$ƣd 8!$|xtplhd`!'<'ܬ!'<840,($ @! !@!$!!@P!@ (!$D@ @! !@ @!@ !4 $x@ @ !+@!@  !@ !4 $@ @ !@!@  !@ !4 $0@@ !8 $*,V&+@/@?4$cDC!B\!@܏PE  !<4BbS!C#5(,6,P# !P ! 4$CdBc$"#(PE  !<ff4BfgbC# "(P !E 3( >$  !" <840,($ '@<'٘!'(ԯЯ̯ȯįܯد௧䯠@!!D!Cb@C!BB@8!௠@!!(!Cb@0!BB@C!(!DD!S!cPq !C!r (!@$D (!@e$Pl! '@: !E! 'X@2 !8xb@8!$b,(4 ! &܏@ !P&  !@ !(!  !@$   !@ !cBb$$ $ !8!DC&,G !b!bb!B$0(!B!B!B@v '(!CC!B`&$@ND!Bb!ڌe 䏼!@ b$!@C!C$C!&Y!CC!B &$c@ԏЏ̏ȏď'<'!'Я,($ !'! ! !@)$&,  !H@ $&8  !$ @$ @(! !0!@ $ $  !,($ `!'0<'!'Я,($ !E! ! !@@(!+$Ƴ8 $b ! $Ƴ@ !@(!'9 0!E  !@@(! $ƳHE  !@ @(!$ƳP  !(lE  !@@(!$ƳXE  !@@(!$Ƴ`(E  !@ !@(!$Ƴh4 $@ !@(!$Ƴp4 $@ !@(!$Ƴx4 $@@(!$Ƴ܏E  !@  !$Ƴ @(!(@(! !$ ,@(!($Ƴ  !, !@(! $,($ !'0<'!'xtplhd`\! ! !@! ! !@(!4 $Ƣt@!`2$&R@ !'9P '  !`(!'  8!'@@!p !@@(! $ @(!| ! 8!(!  !(! !@0! !xtplhd`'<'l!'8įدȯ !!@S(!$ !@ ! @!@B@!, ! (!@!(B`@ !p@(! 'ȏ ')& !@!@!`(!  !@ !@!d'X &s(! !B0!'9L ȏ@(! u+@&+@&+ď'<'͐!'ȯ0,($ ! !! !@8!@ !(`(!$Ƴ @ !`(!(8!$Ƴ @(!@ !(8!$Ƴ @!E  !@ $((@ ! (!$Ƴ b (!(($Ƴ@ ! @ !@(!'9 0!@ !`(!ܐ$BA8!E  !@@ !(( (!$ƳE  !@@ !(( (!$ƳrE  !@@ !(( (!$ƳcE  !@@ !(( (!$ƳT(E  !@@ !(( (!$ƳE4 ! $@@ !(( (!$Ƴ64 ! $@@ !(( (!$Ƴ'4 ! $@@ !(( (!$Ƴ܏E  !@@ !(($Ƴ (! ,@ !( (!$Ƴ 0,($ !'8<'!'PLHD@\! ! ! @!@ !@(!4@! $Ƣt@!(!ܐ$"8!A@ ! @!D' bD'9P$BbD @ ! (!@ !H'  8!@ !`0!H @(!PLHD@!'X<'Ȝ!'8įدȯ !!@S(!$ !@ ! @!@B@!, ! (!@!(B`@ !p@(! 'ȏ ')& !@!@!`(!  !@ !@!d'X &s(! !B0!'9L ȏ@(! u+@&+@&+ď'<'!'D@<840,($ ܐ!!0!$ԯ!X !@ !@(!ܐ$ 8! @! (!4H@8!$B@ !'Ƨ ` !@!4 $<@@ !g(H(!`0!MX4` ! $D@z(!Hg(`0!@ ! (!@ !ܐ0!$ԯ @ !@(!ܐ$ $ @! (!4H@ !$ƨ  @ !@(!4H$$ƨ0 @!@ !(!4H$$ƨP @ !(!4H$$ƨl @ !(!4H$ $ƨ @ !(!4H8!$ƨ @ !(!4H8!$ƨ @ !(!4H8!$ƨ @ !(!4H8!$Ʃ  @ !4H(!$Ʃ@ $$C(E ` !@(!4Hg($Ƣ@ ! @ !(!ܐ0!$ԯ &@ !ܐ@(!$ 8! @! (!H@8!$B@ !'Ƨ g(@(!H@ !`0! 8!@ !ܐ(!0! ` !, $B@@ !ܐ(!0! $ԏ&@ !ܐ8!@(!$  @! (!H@8!$B@ !'Ƨ g(@ !4H@(!$ơ (!@ !ܐ0! $ԏ8!@ !ܐ(!0! @!&@ !ܐ (!8! $  (!H@8!$B'Ƨ@ ! g(@ !4H@(!$Ƣ X\ܐ@ !(!8!D@<840,($ 0! 'H܏E ` !@$4g(H$Ʃx@ !(! g,@ !4HX(!$ƩD@<840,($  'Hc b"@ !g(H(!`0! (!@ !⸏H8!F @ !`0!D@<840,($ @(!'9 'HD@<840,($ 'H<'!'0̯ȯįدԯ !Я\ Џ @!8!@ !4H@(!$Ʃ @!(!@ ! @!@ ! (!ܐ$ 8!  (!@ !ܐ$ '8! @(!@ !ܐ0!$ԯ @ !@(!ܐ$8! @!(!@ !ܐ$k8! ܐ@(!@ !0! $@!@$ !@ ! @! ` !" @ !@ @!@ !4 $ԏ@@& @ !8 $*@$ ` !+(!` !@&p!,` ! (!@!(B`@ (!p` ! ' &8@ !0!'  ܐ8!@ !(! 0!H D!(! ` !@ !d @!' ` !"0(!'9L '`@ !8 0! !|@' `!  ! (!@!$pb(!$lb ܐ@ !(!0!  8!'+@&+@&'9$ #+@E@ @ !ܐ(!0! $ # '@ !ܐ(!0! @ !ܐ$(!0! ܐ@ !(!$ 0!̏ȏď'<'!'௿ BB' <'!BD4 (!$( !$ $$$$$$`!<'0!'840,(!4`!$'  !(! !'  $@!@(!4 !$ƪ8!($'  R  '9X $4b'$(! !8!$ƫ  $ !|PC@(!$ !840,('@<'!'|xtplhd`\X\BB!'(D'( $(!$x ! @!x '  !0!4`8! $ ! 0!^Y@!4 !$ƫh @(!'<4$ƫ !@(!8! @!^@!$84$ƫ !(! 8!R84'<(!$ƫ ! 8!$R$8`(!  !R !4@(!$ƫ 8!R !|<@(! 8!< !h (!<!@< ! $d䏼@o !x !(! $'0 !44`$B$0!8! 0! ! $R @! !0!'8'9Ҡ E4'@$Ƭ8 !(! 8!R @'9X $48'D(!$ƬP ! 8!@(!$ !|D 8!8$b'8x !(! $ !0!'H'9Ҡ @ !P (!,M< $d@D !( $:@B'84` !$` 0!0! ! $R,@!4'L$ƪ !(! 8!RL'9X 8(@'P4(!$ƫ  ! 8!R !|P@(! 8! 8 ' '('  (!( '  (!|xtplhd`\X'<' !'ȯ0,($ ! !'9X! !'x @!$(!"' ,@(! '` !( '0,($ '8<'@!'௿P B' <'!'lhd` !! $$C$$ !( $$p' @0!$ 8!lhd`'p!!<'8!'௿T$ ! ! $!' <'!'௿T$ ! ! $!' <'!'9 <'`!'9 <'@!'9 <' !'9 <'!'د ,! ! ! $$" '(<'!'Я(  !4` $| ('0<'8!'(ԯЯ̯ȯP! 'H ! @!D' $PP'   (! !4ͨ $ !ͨ (!D  (!ԏЏ̏!'<'L!'P|!$'$  !* ! $Q%@!@(!|'@$s $'| (!@!@  (!$x '!$'<'@!'X ! @!$@(!|$s'$ $'| (!@!@ ! (!$x '!'<'\!'د Ҡ!D  !(! @!@! ! @(!! '(<'!'xtplhx' !! !(! $'( !x(! $@@ !$T00! 8!` !P@ (!,0C!@ xtplh'<'!'8į!w!$u&\ @!(BPT  ` !@r$B<@>DP"D0B@&&< '  ' 8 ` !@S$P' ' '@ !4H(!$ư$ @ !8!4H(!$ưd  ` !@3$"D$B"DDDa`!$b$cC '4$bBc D$BD&,B@!|$(! '@ ! ` !@$!ď`!'<'p!'<840,($ x!D'(! $x !t !@W@! @ !` !( @!|@ ! @!@@(!P ' D$B!!!$(! ` !@ !@!' !Ѐ!$,x<@ ! (! 8$E#d$DF#$tD@'!$$%<&H$x @(!@0! ! &&00h&|&|$D$ '!<840,($ '@<'H!'@<840,(!!C\`$S\ !t p @ !@h@!( @ !@ ! `$| @@(!P ' $ !$ (!T $<@ !(!x$< @!@ !'$ (! &2@ !",$P`(!" 50b$@ !"b(4 8$ "@ @ !, $B@$"8#$bb,"8b0̏ $&0 " $H`(!0! 8!!@<840,('H<'!'`\XTPLHD@!!! !$! !P (!8Q 0!$$  ! (!@$`@$P  !D&`ɤ(! 0!  !txbrP  !E( @ !$PL  !@_ ! (!@ ! @!@R` !$ (!@K@!BXR@$48"L$$*&$d$   x `(!@3 ! @(!$@4"l&0d$ƣ !@(!$ @8!$ 4'  $Ƭ ' "4L !$$ '  x `(! !(!0! 8!!`\XTPLHD@`!'h!!<'p!'tplhd`\X$4! (!@ !@! !@+@!$ ! `(!@ !@! !@@!, (!  !@(!' 0! &1' (!@2+$`&st+@!tplhd`\X'x<',!'TPLH!'!!@! @ !$@(! , " ,B$C#$TPLH'X<'!'د$ 8!(! 0! ! !@(! 0!$ 8! '(<'!' d ` \ X T P L H D @P l ( !CD4$ 0 , (! , 8bd@ޯ 4x$ `' (! (!|! ! p  0@(!P'  'P'(!x $ `u! l$B' ' $ ' !⸎P̏E  !@ \ 0 ' E@ !p @! !p @(! 0 8⸏@8!f  ,  (!&`   !Ȅ ,&` Bԏ@f$ $d!D``! $!Ȅ (P $D\R'b!D`DdK!!!' !0Ӑ!E ! &x@7 !e @#ԎBb*"`@!Bd0! l(!@`8!'P $ 4!Bd@!b`@ 'P뼏 l(!0! `8!$ 4 4@!&*@&x'&xȏ l (!@@(! 4`O' ($b 4@؏ l  d ` \ X T P L H D @!' h<'!'tplh4!!$F' $  $ $\ !@!@ !'9ڐ @ !'` (! !'  8!@ @!'H  !`@ !ȣH (! !tplh'x<'!'h(P!! (@!(!H'0$`!'|$@x'd'''' ('<'!' دԯЯ̯ȯį!!!'9ڐ @ !(! @!@w@!B@s`8! !@(! 0! @ !< &d䏼@@ ! ! ' #DbP \ @! !(!x$ @! G' 4`$ ! @0!(!` !0! $W7@!&d @ !4@e !0 ' &Ƭ` !(! @! !@(!P @! !4ͨ $ (!H@0!` ! 8!@@!` ! @(!$ $(!4H(!$ƫ 4H(!$ƫ4H$ƫ` ! 8!(!$Ƴ ` !@!$` !((!$Ƴ 8!` !((!$Ƴ 8!T '  !(!$ $@0! !(0`$ $H(!` ! &Ƭ@(! @0!H` ! 8!@@!` ! @(!'  ! (!` !4H (!$Ʃ @8!W 4 $@ !\ ' !P4 @!D$d  @ !4(!$Ʃ@ !8! @!@[@ !p @(!@ !t@(!0!8! @!'(|@ ! (! 8!0!@8! $@:@!4'$ƪT` !@(! 8!$b&` !4$ƪ @(!@@!t''` ! (!0!8! '(| (!` ! 8!(!X!@(& $$` ! @(!؏ԏЏ̏ȏď!'<'d!'ȯ40,($ !!C!'9ڐ @ !`(! @!8!@0! !@(! @! !< $d䏼@ ! 0!<4$d@$(`(!  !@ !`(!4 0!@ $8( ! $:@ !`(!4 0!@$H'9 40,($ !'8<'!'TPLHD@<840!dR!!Dhs !@!$!!.@ $Z$$.@$ $$ $ $.[@$$$$b$\D @ !(!|0! ' @D!d (!8! ' @5@!$ !  @!' 4$ƭ\ !@(! 8! $ b !4$ƭ @(!@@!t'$'( !(!0!8! $ !|(! 8!$!@+$l @(!!TPLHD@<840`!'X<'!'@(' B!!B(!!Rď!8!  ! @ ! (!`@`0! $X(!0!@ !8!@! @!`!'<'!'Я($ $<!!!D @ !(!x$< @!"PB0,($ !'00!$\$0 $ $!`<'!'D@<840,($ !!!!@N!! !bB@@!b!B!BB@-!B4B!B$b!b&1P  ! !,@$B  !,@$A$ @$ !BB!Bb!b !b&RB!B@&@&s@h!! !bB@8!b!B!BB@%!B4B!B$b!b&1P  ! !,@$B @$ !BB!Bb!b !b&RB!B@&@&s@@4$bDEFcB  4$CdBc 4$bD EcB 4$bBcD@<840,($ 'H<'!'8 į ȯ ̌!@  (! $BP ! ̌S @!$B,B @~'(!'&1*"dd$c@$8' ̯$d' '$d ' $ $*X ` !0!X ` !(! '  @!*T!' Xx !(! $< @ !h (! A&1>!!@ !'90 ' X@! 4!D $  !@' X '9P (!!GF` !  ` !(! & ` !A(! h(! @ ! &16*@&16*@  ` !@!$ bCXB@  $ @ ! ȏ ̏ߠ @ ď !' <'L!'@ Pȯ ! S'(\` ! ! @!!' 0!(!&!!*dЬ$$8'$d' !'$d'     !@! @@!ќ  ! @ '菙 ! (!$d @8! &P't$c&C$B@'x ! (!@0! $d @s$P ! ! $b$b` !X0!X` !(! ' @@!x'H !(! $<  !h (! L!@I! !'90 'H@!'( b!"4D $  !@'H'9P "(!GF` !  h$` !b (! ` !A(! ` !0! 8!   !h (! &*@!`!'<'!'诿 !'9ڐ !@(!@ !' @!@\@(!$b-,b@$$b'8Qb7 !M0'$'04 !@(!' ' @<4@8'  !0 !ȐB(!) ! 'Џ'  !ЏԏȢ#@ '菼'  !"@@ $쏙ȯ !(!  !'<'}!'௿ߠ !' <'}!'x|xtplhd` 0!!! !'XU !. @4$cC!B\!@4$D4$Dȏ( $D( $DD<$D4$DЏ<$De.B @%4$cC!B\!@4$C܏4$C4$C菂4$C4$C( $Cȏ4 $C4$C4$C(<$CeԏX@4$B04$B<4$ƮH'($  8!$ .@$$*b`$&(%$  ! S !$4, &4$␌D $ 4␎$, 0! $< l8 !X@7$4, &4$␌D $ 4"4@'(#&$'"%('$$௤$ !  $$D &3 @ !\ "4 $4d &($4${ $t %@ ! @! ` !4 $ @ "898#$~|8@'84` ! $菼 #8@'888!$~|8@$~|`8! $ '8 ! &Pd B4L$x !$ 8!X @$48BL$ԯ$* ! $ 4` ! $ @` !, $B @$48BL$0$* ! $ 4` ! $ @"8@$48BL !$0$* $ ܬ$ @ ` ! $@C%l`0!@8! &Dd % ,@ ! &Pd $@4Bl% $ƣ !$  ' $ 4 ! $Ƭ   ! B4L !$8! $ ɐ$48!$e $l $0%4 $ C Ā  ! $0D (!@$px  ! @ ! |xtplhd`!'!<'u!'Я,($ ! !'! 0@ @$@($,($ !'0!*<'u<!'쯰诼!$ !  !' 'Ā  !!쏰'!<'t!'௿ !' !!!<'tX!'@<840,(!!'9! !@ !@(! @!@ !@!4 $ !4@$ @` ! ' B\@ ! @ !4H8!$Ʈ @(! ! @(!( !`0!@8! @(!@<840,(!'H<'r!'<840,( !!'9! !  (!@ ! @! P !0! 8! @(! <840,(!'@ <'r!'د  !! (!D@ &$E\ @(! '( `  @ ! &$E\ @(! @ !D8 $EX@D@EXD"D@< 4B@  !  '(<'p!'ȯ40,($ D!PD!$BD $,&&g&$ $ $` !b (!@@!DD @(! !\ &&E\ @0!`(!0 &D@@!Ȏ  &D@@!<4&D (!&D4 $ԏ$ &D@|@! &D@u@! &$E\ސ @(!@h@!dd$ `(!@]@!p菅L !u $ !$P( ' !p< $< ! $` ! $( !(!x $ (! !׌$((0d,48`<  HP \A   !Pd & @!D@!$BD40,($ `!'8<'l!'௿ @(!D@'  $E\<'lh!'௿DbD$B bD@0!DT&D< (!@ ! ' ' <'k! <'k!'௿! ! (! !0@(! ' <'kp!$ ,@$$$ ,@$,@$ $!, @$$$  $$ $$$ $$ < `(!<'j!< <'j!'௿ ' <'jh!'HD@<840\!! !( $ @!@S!4@(!$Ʈ ` !@!@I! F' <'$$` ! (! '(@9@!Ű (! ` !@!$@@(!| ` ! ' @(! !ܠ@ 8(!  !@(!'  &@+T@(! ` !@@(!$ ` !A!`$HD@<840`!'P<'h!P`$ <'hX!'TPLH!!' !' !x@(!@ 0! TPLH$'X<'g! <'g!< $ZZ<'g!< $Zj<'g!4$B$4$B $4$B0$BH<'g$!'௿ ,B' <'f!'௿ ,B' <'f!'௿ĸ0! &@$ (  (! !`!' <'e!' ܯدԯЯ̯ȯį P! !!! ! @ !S @! @!B !@(!V &f @!'9%$ @(! @!4 ! 'h  @ ! D  !(!x$T @! $(!|'  $(!| ' @ $b 0!|$ (!   (!$ ! $ @!'h$'h(! ( ,p'(0$$ 8! ! !  (! @!4@&B@4 0!(! 0 @!B @ !(!@'0!'9  '9 @ !   ! x dtp$p'p|$0! 8! &1*"@d8!$|8 0! '܏؏ԏЏ̏ȏď`!'<'bx!'$ $$$#####쯰#诼(!'0(!` !!8$ 8('ȏ(D'9t ' ( !(!x$@ @!( !(!x $(ЯT` !$0! 8!Џ(A !4 $((@` !' '9 (!(' P''8' 8 0! !(! $4 ! $,(@` !' '9 (!('0! !(! ' P( ` !`'#௢@ !'0$ 8!(@@!P@ ! $^(#Q&W ' (@(!  !( (@(!  !( $P @ !'0 3($` !(! &4菼(@ !(!l !(@ ! (!($!,!0T'!(0!` !$ 8!!(@ !$(b&'!h #xX(! ! $8(8'!h#x&4!T'#p0!` !$ 8!#p@ !$(b&&0 h#x#t  !(&0 `'#T` !$0! 8!(@# ! $7( ( ! @(!( ( ! @(!(#䏙D'9%$ @(! #$b$ $< ` !($ $$$#####쏰#!'$<']h!'Я,($ (!D'9t !@ !P @!D&F(! @!$'9%$ (!(!X4 0!tA$<! $B ! b!,($ '0<'\\!'h|xtpx!!$' (! \0'xCh$`b\dB'H!B$@ ! l(!$x'x @!d$y0 ` !(!< @!@!`^P\` !t(!'P 8!P$Tb(bT@$U[$xb$(b` !)b$|b` !#($&$p (!@!$p` ! (!@!$p (!` !@(!p $@!4X@ !$X $@` !t(!'P8! P !$ @8!'L`Ll'8@0!(! 8!08BB`#``\$D '88$D $@ !\ @!d  !0!${ ! $t@ ! @!'84 $@ 898#$~|8@'4'8 $菼8@'88!$~|8@$~|`8! $' ! &0d"4L$x !$ 8!8L4@ $$8"$0$*"($0$ ! $ BX@$48"L !$$* $ P&'8 @ ! , ! &0d$@4"l $ƣ !$  $4 ! $Ƭ  !"4L !$8! $ܬ 4@ @ !$@#l&$d@0! @8! 'TT@(!   !@9@ !$ (!B(T$b. ! Xp @ !@!@!$@ ! (!B !( (@!B@Pe 'X(X̏$ 0x'8(! $<h`'x4$Ưx 8!h @ @!4h'x$Ư $p @ !@'x4 $Ư$@ ! (!@@!4'x$Ư8!4& ! &D@4 ! $<@ 4 ! $@\l @ !T (!'\@(!0!` ! 8!4&$  !@  !, $B@$84 ! $@0\l @ !T (!'\48!$Ʃx@(!` ! l\ @ !T (!'d4` !@(!$Ʃ 8!d8   !$Cd$Y0 '8⸏lf@(! 8!`\!  !@ !@ @!@ !4 $x@B&q@  !@(!P ' \'  P.&P' (! !4 $<@ ! &D@4 ! $8\\$~|' $ 0 !< ' @ ` !@ !4 $0@V&4$  !@(&p@  !@(!8 &D*,@  !$$B `@ !(< $ $B@ !<&E*` 4 ! $@&p@  !@(!8 &$*d@$``(< !$` !<&%*` &  !+@@(!`$b)d@ &4 $@$4&$  !@ !, $B@ $48L&d$0$* $ |xtp!'<'M!'PLHD@!x $ 8!!x'($' b!$'!  ` ! @(!# ! (!l ( @!$@ ! 8! (!,$!@ ! (!! ` !@@(! @!!PLHD@'X<'L!'Я,($ P !XS$p- @ !` !@(!ɤ !@ 0!$"#%& 'dt`hlp @ !`! 4 "#$%& 't`dhlp,($ $'0<'K!'ȯ0,($ !!!(!0! @ ! !\ @! (!@ !4H`8! $Ƭ@ ! (!0,($  '8<'J!'د p!P  !@ ! @! ! '(<'J`!'@<840,($ !!!\X@!!q$ #b$ \  !$C4x%t&C0@ !0! 8!#$ b\  ! ! @!B@ $B4x%t&B0 !0! 8!#$b=40$  !@ !4 $܏@ !4 $ @  !4 $0@  !D$P@0@4$$ X$4 $0@\&*d@&sb@@0@4@<840,($ 'H<'G!'ȯ40,(!$! ' ' P "$$4诲$8 $@_$$4@30! $P$b#@ !P &@J$@$@$4$$`0! $$4$$ 4Ď$ $诠$P$ $ 04诠$x 0!@@(!4< $Ў$  D@!& D$@!40,(`!'8<'E!'د$  !! !@$ @$ɀ $D @!$$ `!'(<'D!'840,($ T$\ !A@! \ @! @!@!@*@ ! $(!4 !C"$0 @(!0!ܐ$@ ! @!@@ !  !!'<840,(D!x$SEp(!$\` !5$ ` !$X& ' B|@&@ ! D &$QL ! 'D`0!0' & ! (!D  (!!<840,('@<'=t!'د !0\ #$ !$<|@$`8  < <4Q $P  !+# `!'(W !C@ @!@H!$!% *b$ !C!@<'<0!'௿ $ !@(! ' <';!'د !!$@  !  !(!X @0! '( '(<';d!'د !! !@ $Q  !(!X @0! '( '(<':!!` (!,@X` !@$P <':!'د !!  ! ,B@&$PP@(!  '( '(<':$!,@P$ $! (!@ !C@$b $B,D!<'9|!'د C@$b! (! !@ !`! @ !  @D @ !@ (!  '( '( $$<'8!'د $$ ! ! ! (!$d F '(<'8(! $$<'8 ! $$<'7!'௿$$  ! ! ' <'7!$l   <'7h!'௿4x!܏0ج(!$ $@&P(!x $@(!$ČF &$p  ! @ !h &&Hx ' <'6p!'௿!$H $' $HY Y Y Y< Y  Y Y Y Y  Y$ Y Y Y( Y, Y0 Y4 Y8 Y@ YD YH YL YP YT YX Y\ Yl Y` Yd Yh Yp Yt Yx Y| Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y  Y$ Y( Y  Y, Y0 Y4 Y8 Y< Y@ YD YX Y\ Yd Y` YH YL YP Y| Yl Yp Yt Yx <'/,!d <'/!'௿DH  !@ !h &$8$&$c@a$B@<' <'.|!'௿ $ !@(! ' DY DY DY DY  DY DY DY DY DY  DY$ DY( DY, DY0 DY4 DY8 DY< D.Y@ .DYD DYL DYP DYH DYT DYX DY\ DY` DYd DYh DYl DYt DYx DY| DY DY DY <'+!'Я($ D@ !Yp!!(!!0! `8!$@ !(! 0!C`8!($  '0($ '0!<'*,!'د (!!@ (! *q!@(!e !'($(!$$cB@$$a!@E!E!f!@C!D!$B0<')8!'௿ $ !@(! ' <'(!'௿ $ !@(! ' <'(!'د$ @! !!&#d@ $c &&$  ! !&*@$  !$$ '(<''!'د @! ! !$  '(<''!'د @! ! !&bB@$c$(@` !  (! ! $ '(!<'&!'د @ !$  ! ! '(<'&!'د$ @! !&Cp$c@&1&1t @ !"T ! $$ @ ! !&1*"@$ @ !!$ '(<'%!'د @ !t  !P!Q$  ! ! '(888B+$88Y <<'$!'د p! !0  !؏ @(! '(<'$T!'௿! $$B' <'$!$ D<'#!'د ! ! ! (!8  '(<'#!'د$ !!(! !  !@ @ ! $ @ (!P ! @@$ '(<'"!'د ܘ!$ !"#$Bb !#$ !'(<'"X!'<840ݐ!!' $E,'  ь @(! '<840'@<'!!'د$ !! !?!$@b9& i $hE!c@b$ i hE!c \  (! !  (!  !@ !$  '($ '(<' p!'9j $<' P!'9j 8!<' 0!'D@<840!@x!F&G !(!HDbH` !`(!Œ BDb &EFݐ ',' T$  ! !ь $ '3  !@! !ь $` ` !T $` !ь $P&B DD#d3&*@@ ! (!D@<840$'H<'!'د$  !@ !ь@$ ь ! $ $b  !"DR(!$  '($ '(<'4!'@<840! !C&E e'p&s$ce` !!P\&1@ ! (!3*@ @<840'H<'X!'د$  $!b$ !R(! R !  Q $$ (! '($ '(<'!'௿! $ @ !h & $Ю<@D d $@@0!$H $ $4'8!$Ƶp $!' <'p!'د$ $!$ $%@ !P @!@ ! (!'8!4$ $Ƶ!$ '(<'!'د$ ! !1! $ !QҠ P @ !@(! @! !$ $ '(<' !'د !P  ! @(!␏ 0!␎& $ &$ &$  @(! 8!'4$ $Ƶ '(<'!P $H<'!'د p ! ! @!@ !@(!Q  '( '(<'p!'Я($ ! !@!\@*@(!D P  !p  !D (! @!` @ !Q  2 S@ !x(!($  '0($ '0<'d!'Я($  !@@!$E2]!y @Rs$ !f $dS!c@b,  (! !ь $#&% eO!dS!ceB (! !ь $ !3$   !  !@ !$ BQ@  !$"8  (! !$0($  '02 (! ($  '0($ '0<'!'௿ !(!؏@ ! ' @ B@Y  <'t!@C`  0!y  ! @ !<'!'௿ !@ !@(! ' ' <'!'௿ !@ !@(! ' ' <'P!'د$ !! !@ !(! 0!@@8!$  '($ '(<'!'Я($ !$<b$$$ $$8@(!b !  @!@ ! !@@ !8 @(!@! !($ '0<'!'د$ !$<b$$ #$ (!b !    !@  (!$ @ ! '($ '(<'!'௿ !(!@ ! ' <'|!'௿(!\$ ! +' <'$!'HD@<840ݐ!F't &E,' 50T8 !`(!   ! @ !1 '@ ! $HD@<840$'P<' !'௿ !@ !x@(! ' $' <' !'௿ !@ @ !B@(! ' !' $d b$c!<' !'௿ܘ !,  !'8!4$ $Ƶ0!$␌D $' <' \!'D@<840! ' '&ݐ2 &%,XT@ ! ,@ !  (!$C '$H  (!D@<840'H<' T!'Я,($ !! ! @ !@  (!B@'G ,($ '0<' !'௿ !&  @(!$B' <' l!'௿ !@(! & $B` H@(! ' ' <' !'௿ ! &h@ ! ' <' |!'௿ $  !@(! ' <' !'Я($ \!!(! !! ! !H@(! @ !`(!($  '0<'x!'<840,($ !!$HLv,rH &DH@!&T P<L"@ ! @@(!p !0!0   8!P$7  psP@!<840,($ '@<',!'Я($ ! !! !E&p@!` ! @8!0  ($ !'0<'!'TPLHD@<840!!$`UJ'Sݐf&e ' ,7$<#`b. ! @)  ! ! @!@(!\  !  !p @ ! !`(!p0! 8!$   'R!TPLHD@<840'X<'!'840! ' !1$D&D!D$ Ȍ'0p .@840'@<'D!'@<840!'!  !X @@ !BC< 8!$`(! 0!b!@ !'! @<840'HB <'\!'د$ ! !! !@!$B$B-$b,b@$$b&B0B@ 2"`,b@$b ! $0B@2" !$@  !$$  '($ '(<'<!'h|xx' !!!@ !(!4 $@&,b$@(!4$cPC!B\!@# ,b @(!4$cC!B\!@T ! $$$$$ $$ #$b$b$b$ b$"$$ C d$C 0 ! (!"C@$b( !l '  ' #@ !$ b$    !@ !X $Vb$   !"@@T$  !|$ ! (! !T2$# ,b@n(!4$cC!B\!@#$ $b_(!]$@bY$ W(!#$bS$ T ! $I#$bI$ G(!# ,b @c4$c$C!B\!@'9`  !x'`(! $ ! !Q$ #b $#b!Q@  !&*@  !'9` ! !@(!'9t 0!!Q` $  !&*@(! ! (! !T $ ! $ !0!4|$ď !&$# $b$b !  ! ! $F ! (! !T $ !$$ N# $b,b@$`Ib-E'9`  ! !@(!'9t 0!1  !'9`  ! !@(!'9t 0!$  ! ! (! !T $ ! $ !0!8$2 1~ !# $bZ(!,b@$$b(!Rb(!N ! $ !T $#$ b<(! ! (! !$T #$ b)0  !"# $b,b@$$b (!b$b(!Q0 ! $ !T$0 !$ 0 ! $ !T $ ! (!#$ b0  !$# $b !T)$# $b(!?$# $b(!"C@$b$Ddp4 $透@P @ !@ !'p8 $~|  !@ ! @!!Ӑp  !$# $b(!$# $b(!#$b  !@ !\ @!(! ! @! !$ @! ! @! !|`(!@0!  8!  !c(!# $b,,b@$$b(!Xb(!T"C@$bN$   !"$ E@@ !(! #$ b0  !4$ #$b/  !@ !\ @!(! ! @! !$ @! ! @! !|`(!@0!  8!  !(!(!|x!'<'!'<840,(,.!!P@!4$cHC!B\!@$b+,b @$` !b| ! $ϼ  !|  !X @ !c$ $ ! $ ! `$ $$bJ $ !$b $ b;C@$b5X !$ . !$b)$X`",b@$ b> ! $@| !"  (!@!"$ $  !T @ ! @ ! ! @!' $4$Ƶ8!  !$  $$$"C@$b ! (!@$T@ !@ $e  !$C$#$+$b$$ b$b $ ! $e(x !b $(i !$b0$ $ @ !@ ! @!P*@$e  !'  |$0 (! &@C#C!`@8!0! $<bi $ ! $]$$ b ,b @$$b,B@RbN ! $  !T $e !8B ,B:$D"$C,b@34$cC!B\!@ $ !$ $ !$ !$b  @ !C$ b @ !$ $ b$P  !̤ @(!@   ! !@0!(! $߮0  ! !@0!(!$ $$"C   !@0!(!$  !@0!$$$ ! $ e  !$"$b$$ eHi !$b$$%b#$ b$   !  !eH  !}$# $ "@`  !ֈ ! 7,b @b !$p0b @]$"0b@Z ! ! $P ! T !$$ bD  ! $$ b7H$$ b0 $$ ! "$C"$ !$ b $$ ! "8B+$ b #$ b !$ !<840,(!'@<'<!'௿Ҡ !(!@ ! ' <'!'ȯ0,($ $! !!! @ ! (!`8! ' ! 0,($ '8<'8!'ȯ0,($ ȯ@! ! ! @!@   !C$b^@$b,b@$$b Ob-$b !IL ! $$C ! $:'2$L $$C  ! $ !0!4$ !'$L ! $$C ! $ !0!8$2 $ '$'9   !@@!$b",b@$$b $ b&bk$b"$"` !EP$ @@ !'@J$,B@@ @ ! !,F$e(!.@$$  @ !@$'9` @ !@!B0B@0b"ETQ$@M$ >@ @ !@$"EL ` !@  !'@$'9 t4E$ď4$]@j.@>$f @ !@-$EČ @ !'9`C$ @!0B@"EP $0B@$ "EL$9@7 ` !@0@0! !'9 '@'8$@ !$2(0! @ !@$"ET ` !@$ !'@8 !$28@$2 ! 0!$E(! !$ @0,($ '8<'x!'D@<840,($ !!!X !@!!@!@  !$/.@.$.@$.@.@$$ N$$ @ $,.@$$ !.-@$.$*r !r@$b CB<@C$.c,b$ bp$ ! B@  !)@,b@$ b&$p ! `(!@P$` !C@$%$Q ! $ !$ ! $B@B<@A ! `(!@ $T4 !+`(!C@b  ! ! @!T  !@M@!` !$'9 $c $bB$C@b !` ! (! !![$cb0$c b,r@(C<`R$ ! `(!@T  ! !(!p@0!8! @! !(!p@0!  8!@ !8(!  ! ! @!  !@@!` !$'9 $@ !(!(! $ !  !`$Eb$ ! $  !$$ E(!bcČb `(!$4B'9 b P  !@!(B@r@ ` !Q&%`  !  !@!B@C<$b$c b ` !Qj$` !'9P< $ !` &%  !@!$$#A b=B<C9@ ! b @ ! (!(  !(@ ! p  (!@@b @`` ! (! !@( !'9 (! r@;$P<$ c b b P@ ! (!@ !$cb  4B$cb 4Bb 0! !'9 `(!r@@! !'9 `(!b $B,B@  !@@! @ ! !` $EC<$b$b (@ !@ !s`(!w` ! (!p@ !'9 (!d!cb$eČ  !$ C$ '9 `(! !`(! @!@L@!J` !$'9 $  !(!` !  !5@!r@1$D<a$+]P ! ! $E@ !$*'9 $r@B<@ B@@(!|` ! !` !(!&0! $$$*$   !R@ @!B<@$ ` !$)! $$   !R@ @!B<@` !&9$  $$ !D@<840,($  'HD@<840,($ 'H<'נ!,$@v4$c@C!B\!@4$B4$B4$B 4$B04$B<4$BD4$BP4$B\4$Bl4$Bx4$B4$B4$B4$B4$B4$Bď4$BЏ4$B؏4$B菂4$B4$B4$B 4$B,4$B8,$B䌏4$BD4$BX4$Bp4$B|4$B4$B4$B4$B4$Bȏ4$B܏4$B($B<'ը!,0@4$cC!B\!@4$B4$B4$B4$BL$B4$B$4$B,4$B84$BH4$BT4$B`4$Bh4$Bx4$B4$B4$B4$B4$BЏ4$Bx4$B4$B4$B4$B4$Bď4$B̏4$Bԏ4$B4$B4$B4$B4$B4$B 4$B,4$B84$BH4$BX4$Bh4$Bt4$B4$B4$B4$B4$B̏4$B4$B4$B($B<'8!,@R4$cC!B\!@4$B4$B4$B4$B$4$B44$B@4$BP4$B4$Bh4$BH0$Br4$BX4$B`4$Bt4$B4$Bt4$B4$B4$B4$B4$BЏ4$B܏4$B4$B($B<'!, @(4$cC!B\!@4$B4$B`4$B4$B 4$B4$B 4$B(4$B04$B($B4$B8<'!$ $ $  ,$B䌏4$BH4$BX4$Bt4$B8<'Д!,@4$cC!B\!@($B4$Bp4$B|4$B4$B4$B<'!$, @4$c0C!B\!@4$B4$B4$B0$Br4$BH4$B4$BX4$B<'p!,@4$cTC!B\!@($B4$Bԏ4$B܏4$B菂4$B4$B<'!$ $ $ 4$B$4$B,4$B4<$Bf䏂($B<'p!'PLHD@<840(!!!!F6PQ  ( ! @!( !  @!( !t @!( !x @!(@ !C4`$G4$G@4$ $ƼD'0 $(`tPLHD@<840'XT<'!XT(! $P!T 4B4B4B!   t p Y0 Y4  $(<',!'(ԯЯ̯ȯį$,!@ !!! !x@(!' !  @(! '  !+(!( !@& ! @(!T ' ` !+(!(` !@&(! '@ ! ' 'ԏЏ̏ȏď'<'ɜ!'د $,!  !%x !ָ  '(<'D!@ $Tdhl!!!!!!! Y <'Ȩ!Ǵ <'Ȍ!'د ďָ!$B!$BȬ$BЬ$Bج $Bଂ$B謂$B $B$$B( $,&T  (!xtď $Bd$B(h'(<'|!'௿! $,&Th ' $,$TY Y Y Y Y Y  Bt Y Y( Y  Y Y Y Y Yp Y  Y$  Y    Y Y Y <'!'Я($ ˤ$T@ ! !@!@!4(! @ !&@ !,@`(! @$+@!($ '0<' !Ơ $BT$B,Yd Yh Yl !!<'Ð!'ȯ40! ' ! ' '40'8<' !'@<8!!$$$ '(!<'  ! '@ '@<8'H<'h!'Я($ 4!$(3&D 0  !D0! $|1 &STBY, @ ! &D<Q`3&DL0  !D0! $1($  '0dhY$ Y( Y <'!'د ! $|%@ ! @! !$8 $䏼&$  (!! '(@4B$(!`!Y Y Y Y   Y  Y Y Y  <' !'Я,($ ! ! !@0!|@(! '' &<'0  !@$B @ !`0!@(!  !'t ' ',($ '0<'!'TPLHD@<840P!%$< !% &$ (!&$L < ! pď4$B0"$ $B8"  @!@ !ď4$W@! $ !!8 $E* !!4 $6  !ď4$VȰ! $'4 $'44 $Џ'44 $$' !4 $0 ''4 $8'44 $@' !4 $H ''0 $EH !'4 $  !'4 $( !'4 $0' !4 $4 ' !0 $E0@ !4'%<! @! !!4 $E@ !!4 $ED !!4 $EH !!44 $EL !!44 $ET !!44 $E\ !4! &P !! &X !! &e` !! &Ed !!4 $Eh !!4 $El !!0 $E0 !!4 $E !!4 $Ep !!8 $菼 !4 $t@!@ !4!$ $E< !!4$ $E@ !!4$ $ED !!4$ $EH !!4$ $EL !!4$ $ET !!4$ $E\ !&P! $ !&X! $ !&e`! $ !&Ed! $ !!4$ $Eh !!4$ $El !!0$ $E0 !!4$ $E !$4! $Ep !4 $؏@!@ !4!$u0 $Ex !6 4! $E| !6 (! $EO  !!4$> $E !!4$u0 $E딏 !6 8! $EGL !6 ,! $Eb8 !!<${ $E646  !4! $E !4 $E딏@ !6 4'%! @!6  !4!8 $'< $'<4 $,t' !8 $ ' !4 $@ !!4@! $ !!( $$ !!4 $ !$,! $Eb8'0 $EH !'0 $' !4 $ ' !0 $ET@ !!4@! $ !!4 $ !! &쏼 !4 $ !4 $ !8 $%؏'0 $EH !&쏙 ' !'8 $*' !4 $E ' !4 $@ !!4@! $ !8 $zl !, $b !4 $ď !4 $E'0 $EH' !4 $ȏ ' !( $؄@ !4'%! @! !!( $EO  !!4 $Ex !!4 $E딏 !!8 $EGL !!4 $E| !!, $Eb8 !!< $E64 !!4 $E !4 $ԏ@!'8 $E*'(4 $؏' !, $4 ''4 $܏' !, $T ' !4 $菼@ !$4!@! $'0 $EH' !4 $ ''< $d'<4 $at'L4 $'44 $3@'<4 $P'<4 $X'<4 $`',4 $C'44 $'<4 $m' !4 $ ' !$<! $܏'0 $EH' !4 $Eh ''4 $E'44 $'44 $'04 $ET' !4 $ ' !!4$ $ TPLHD@<840'X<'T!'Я($ ! ! !'(!|@0! '' !&$<0 '@'P !($ '0l <'x!'௿0$< ! !$44@$PB !' <'!'د !0! !(!$D(@! @! !44$@$p ! '(<'l!'د !0! !(!$Dx@! @! !44$@$ ! '(    Y8 Y< ppl <'<!'@<8! ! 0!&  (!&L,  (!'„  (! 8!'0x&, $H '&\\H \x & `@<8'H<'<!$܌E <'!'௿D ! &` &L&,h ' <'!$ <'!'د$ h$, !! ! !(!@0!$  '(<' !4 $<'!p $L<'!'௿X!$ $\[' <'!'௿X!$ $\[' <'X!'௿!$ ` $' <' !t$\ <'!  <'!'d`\XTP!!!@7!4|$& 'H  ! (!@0! 'H&'H $H' `0!' !4T $ ' 'H@,$B $,'0$H `0!$B $4'0$ `0!$B`0!4$ '04T'0 !$ 0!  !d`\XTP'h<'!'د ! !$ !40!C1$  !Џ4 !@$`! P @ !D$$0c0B,c ,B`0@$sb$e$ob $f 0!4 ! $@$0! !'(<'!'tplhd`\XTP0!$H '  !'844 $@!@ !ď4$$^Ȱ! $ !!4$4 $  !' 4$ $ !' 4$ $ !&$ '  !' 4$ $'  !4$ $  !<4 $䀏@!@ !ď8$W@! & !! &E !4 $$@!@ !! & !! &E !! &e菼"&e菇P\d  !(!\4  !  ! !4 $0@!@ !! & !! &E'  !$ &e( !4 $<@!@ !! & !! &E'  !$ &e( !4 $@ !!8$@! $'  !4$ $@ !4 $H@!@ !! & !! &E !!4$ $L !&e($ '  !' 4$ $P !' 4$ $X'  !$ & !4 $\@ !!8 $op !4 $d@ !!4@! $l !!4$ $p !!4$ $t !$4! $x !!4 $ ' tplhd`\XTP'x<'L!'Я,($ !!!!<$Bf䯢  !<$Bf䏆4$' $ @8!@ 4' $F$0 $ $@ ! (! (!@ !'9Ȱ $,($ '0<'!'Я($ !!!<$Bf䏆4$' $  8! 4' $F0$0 $ $Ơ ! (!$C  !4$d 8!'  $(! $($ '0<'!'௿4$$ ! !$< $䀏 !$4 $$ !$4 $0 !$4 $< !$4 $ !$4 $H !$4 $\ !0!4 $d !0!4 $ !4$$ ' <'x!'௿40!$t ! !0!4 $؏ !0!4 $ !4$$ ' <'!'௿40!$ ! !4$$ ' <'!'௿40!$ ! !0!0 $0 !0!4 $؏ !0!4 $菼 !0!4 $d !0!4 $ !4$$ ' <'!'௿L0 !!' <'<! <' ! <'!, <'!֤ <'! <'! <'! <'x! <'\! <'@!р0 <'$!@ <'!0 H!X!P!@!j!D EFG%k! +d ef@g@$B! <'l!'௿@ !  ␏) ' ' <'!'௿ !' <'!'د$ e+@4!`,@!$D  )@! (!$Q+@@e!D  )@! !pEFG   ! @ !ED ␎F )QP$$ '(<'!'د$ l!! !@! F 8! $ $C#+@ (!`(!E$$ `!'(<'!'௿  !@!!`!' <'!'د ! !%l  !p@ !%&  "! `!'(<'!'د l!  !p@ !%&  "! `!'(<'T!'د l!$E !('@ G!C DEF#$c!$B#! '(<'!'௿l! $@ !$B !$!' <'@!'Я($ !!!#+`!E+@ 444$$¤$缸 $Dl ! $@#&+@@!C8!%(0+ $ED FGC!ED FG`(!$Bb(!($ !'0@$C<'!'د !+@!b!+@ 444$$¤$ $D!#+@ !&& $!$B ! '(0! !$!C@+$0!!  ''  <'!'௿ !!' <'!'Я,($ !!!! !!d(!& ! @0!+@,($ '0<'H! <',!'د ! $| ! $& '(! <'!'د$ e+@4!`,@!$D  )@! (!$Q+@@e!D  )@! !@EFG   ! @ !ED ␎F )QP$$ '(<'!'Я,($ !! !@!`!D| !DF !&1 (!3+@Cc+@`(!`(!E$,($ `!'0<'!'௿  !@!!`!' <'`!'د !  !@@ !%&  "! `!'(<'!'௿@ !  ␏) ' ' <'`!'د ! !%  !@@ !%&  "! `!'(<'!'௿ !' <'|!'د !$E !$#@(!& ! d !$"$C!$B$b! '(<'!'௿! $@ !$B !$!' <'p!'ȯ0,($ !!#+!`!E+@ 444$$¤$ $EE@ ! $P@"!q+@DF ! $D&1| ! $q+BF !(! D !B(!$BBCb(!0,($ !'8<'!!|$E@1e  !<'!'د$ !+@!b!+@ 444$$¤$  $E#"C!B+@@!|@ !&P "#b! &&  (! !|&"$B"@!$ '(0! !$!C@+$0!!  ''  ! 0! H!%)!!'@+b$,$0!!  ''  ! 0! H!%)!!'@+b$$0!!  ''  ! 0! H!%)!!'@+b$4$0!!  ''  ! 0! H!%)!!'@+b$h$0!!  ''  ! 0! H!%)!!'@+b$$0!!  ''  ! 0! H!%)!!'@+b$$0!!  ''  !   ''  <'X!'Я($ ! !!! ! ! (!|@8! @0!!($ '0<'~!$G <'~!'د$ x!! !& 0!x &D@!$ '(<'~<! <'~ !'د x! !#! '(<'}!'Я,($ !!!! !Ґ d(!& ! @0!+@,($ '0<'}<!'௿ !&넏 ' <'|!  <'|! <'|!'د$ !+@!b!+@ 444$$¤$@ $M#"C!B+@@!p@ !&P "#b! &Ґ&  (! !p&"$B"@!$ '(<'{!!p$E@0e  !<'{h!'د ! $p ! $& '(<'{!'د$ e+@4!`,@!$D  (@! (!$Q+@@e!D  (@! !ÄEFG   !@ @ !ED ␎F (QP$$ '(<'y!'ȯ0,($ !!#+!`Ì!E+@ 444$$¤$` $ME@ ! $P@"!q+@DҐF ! $D&1p ! $q+BҐF  (! D !B(!$BBCb(!0,($ !'8<'xt!'௿! $@ !$B !$!' <'x!'د !$E !$Ґ#@(!&   d !$"$C!$B$b! '(<'wh!'Я,($ !! !@!`!Dp !DF Ґ !&1 (!3+@Cc+@`(!`(!E$,($ `!'0<'v!'௿  !@!!`!' <'v4!'د !  !Ä@ !%&  "! `!'(<'u!'௿@ !' <'u\!'د @! !%  !Ä@ !%&  "! `!'(<'t!'௿@@ !  ␏( ' ' <'tP!'د 0! !#! '(<'s!'௿(b! @!$!' <'s!'د$ !!!!$E(! !@&"+@$!$ `!'(!<'r!'TP !'L @ ! '' ` @(!L<k_4k 4, @ ! !0($7 $B$cl(-(# !! TP'X<'q!'Я($ ! !!! !(!`8!| ! @0! @ !@(!`8!|&$ @0! !($ '0<'q!$LG <'p!'د 0! !&0 &$ ! '(<'p!'د$ !!$ $! !@ (! @@!$@!$ '(<'p! <'o!'د ! !&@&% ! (!  '(<'op!'د$ $$!!(!  ! ! @(!!$ '(<'n!$F <'n!'Я($ $$$!!(! ! ! ! @(! ! `(! !($ '0<'n0!$!'<840ƨ!! !(! !4@'`!  !@(! ' '@ ! (!<840'@<'>! <'=!'Я($ !0!!'$H @0! ! 0!h '  '($ '0<'=X! <'=<!'د$ 0!0!$H ' ! '@!  '!$ '(<'<! <'<!'Я,($ !!!  !< @!@(! !! `0! ! @ ! @!" !,($ '0<';!'௿ ,B' <';!'௿ C&C!B$0B@2$`!' ! <':!'Я($ !$SPD&`!&  !`! @!DQ#b% %D($ '0 <':T!'௿!&'9PD &b$+'  <'9!'௿| !!' <'9!$|E <'9x! <'9\!< <'9@!'<840,($ P!!!!4 !R$ @K$&SH$F$D! H@ ! @ !& @% !&`(!$VR 0!8!! @!$B $Ă%'9Q|  !@ ! !`(!&&8!! @!r+@  @!Ă%'9Q| &@&1!<840,($ `!'@<'7t!'௿ !$@$$!' <'7!$„E <'6!'د \! !" !#$ '(<'6!p <'6t!'د D! !" !#$ '(<'6! )E!<'5!'LHD@<840,(!!!!!!!1! !  ! @!8!)' (!0!'9R @!$b ,b@$$b &1b  &R &s &@@!&1  !"+@ (!@$B$ `+$`$$$$$  !  !   !  !!LHD@<840,('P<'3`!'Я($ ! !!! ! ! (!|@8! @0!`(!@0!$ &!($ '0<'2!$xG <'2!'د$ x!! !& 0!$ &D@!$ '(<'2,!'௿ !& ' <'1!'د 0! !& &$ ! '($<'1l!'د X! !B<@  !  @ !@ !$ ! '(<'0!'د ! ! (! & ! '(<'0t!T $ !$ <'04! $ <'0!'د ! ! (!L &! '(<'/!'@<88! !' (!„ ' 8!0x&  $H ' (! &@!d@<8'H<'.!$F <'.!'د$ !! ! 0!& &EC ! $ '(<'.H!'௿( !& ' <'.! $<'-!'د Ȍ\ !h &  &@d@ @ ! d !␏ $ '( '(<'-,!0!$e@E!E!`  !<',!'د$ !@P!P!D& ! $&1$ '(<',\!'د$ e+@@!`,@!$(@(!(D (! (@! 0!,Q+@@e!(@(!(D (! (@! !@EFG   ! @ !BD (@(!(F(! (QP$$ '(<'+ !'௿,! $@ !$B@b!b! !$!' <'*!'د ,!  !@@ !%&  "! `!'(<')!'௿!$ $!' <')!'د$ t!! !&$ & @0! "&$@&@ΰ @0!d@ !@$ d "ddۄ@ ! @0! !$ '(<'(!'د$ !+@ !#@C!C!!+@ 444$$¤$羀 $I"$@b!b! !D +@!@ !&Ph #$@C!C! ! &&  (! !&h"$B"@!$ '(<''!'ȯ0,($ <4cN#C! +! !C@C!C!!E+@ 444$$¤$群 $IE,@ ! $F@+@f+@!@F!F!DF ! $D&1 ! $q+@& @ !B !F  (! D !B(!$BBF!CF!b(!0,($ !'8<'%!'د ,!$E !#'@(! @ ! !&   !#$$c@C!C! !$#@C!C!! '(<'$!'Я,($ ,!! !@!`!`!D& !DF ! (!&1hCc+@`(!`(!E$,($ `!'0<'$ !'௿x  !@!!`!' <'#!'Я,($ !! !!! !q(!@0! &&1h,($ '0<'#@!'௿ !' <'"!'د ! !%,  !@@ !%&  "! `!'(<'"\!'௿@! (@(!( (!( ' ' $@<'!!'د h! !& &%# ! '($ <'!`!'௿Ȥ$@  ! !( ' $ <'!! $ <' !'௿!(! $!' <' !$ F <' x!'د D!D"Eɬ(!@$E $"Ed@D$BE '(<'!'௿!$ $!' <'! $@E!E!b!<'\!'௿ +' <' ! $<'!'௿! $!' <'!$̌E <'!'௿l!$ $!' <'@! $<'$!'௿!$ $!' <'!h $<'! $$<'t!'د ! !@ ! `@  !  @ !@ !$ ! '(<'!'د !(!$ !&ď  (! (! &! '(<'4!'د$ !!$$ !&&%ď @0!$%&"#l&%@0! &!$ '(<'p!'Я,($ !! !!!t !q(!@0! &&1,($ '0<'!'௿H! $H &ď& ' <'!'د$ !+@!@d!C#D!!+@ 444$$¤$ $J%$@e!C#E! !D +!@!@ !&P $%@d!C#D!(! &Xt&  (! !&"$B"@!$ '(<'(!0!$@e!C#E!  !<'!'د$ !@p!C#P!D& ! $X&1X$ '(<'H!'د$ e+@F!`,@!$@P!)(#(D (! (@! 4!0Q+@@e!@P!)(#(D (! (@! !@EFG   !˜ @ !CD @C!)(#(F(! (QP$$ '(<'!'ȯ0,($ <4c#C! +!!D@d!C#D!!E+@ 444$$¤$ $JEX@ ! $F@/@f+@!@f!C#F!DtF ! $XD&1 ! $Xq+@&X@S!! # Bt !F  (! D !B(!$B BF!b#Bf!C(!0,($ !'8<'!'௿X! $@(!$@d!C#D!(!$X!' <'|!'د X!$E !&t'@(!@F!! # !&   !$%$@d!C#D!(!$X $@f!C#F!! '(<'!'Я,($ X!! !@!`!`!D& !DF t ! (!&1Cc+@`(!`(!E$,($ `!'0<'!'௿  !@!!`!' <'d!'د X!  !@@ !%&  "! `!'(<'!'௿˜ !' <'!'د ˜! !%X  !@@ !%&  "! `!'(<'!'௿˜@! @C!)(#( (!( ' ' <'@!'௿! $$' <'!'௿! $$' <'! $<'! $<'x!( $<'\!( $Č<'(! $$<'!'௿@!@@@ @$ @!$!' <'T!'௿! $ď' <'!'௿ !$' <' !'௿! $' <' !'௿0 !$' <' <!'د ! ! (! &! '(<' !'௿ !&D ' <' !ߌ <' p!T @e!C#E!b!$'Я($ !!!!  !`! @(!@!&!($ '0<' !'Я($ ! !!! 0` !@(!|@0!  8! 8!&d 0|0!$Hp `@ !, $:@`!B@`! CBb!b0B@&R$b`!($ '0<' !'௿ !& 넏 ' <' <!'د 0! !0"#&  &$  ! '(<' !'د$ 0|$!$!&EH 8!0! $&&EH| 8!  0! 8!0!|& &EH (!&  ` &0&EH 8!&H 0!!$ '(<'!$E <'!'௿! $ & & & &Hď ' <'!'د 0!!$ $#" 0&&%  &0 &%"& &%  $8%<"0#4&@'D<8<04@D&%H &H! '(<' !L$ $ <'!L $<'!T $ <'!'௿  !!' <'`!$,E <'@!$ <'$!'௿ !!' <'!l <'!'௿ !!' <'! <'d!'<840h!! !(!' @0! !@(!h ' '<840'@!$((<'!'௿8 !! $(' $@E!E#b!<'! $@E!E#b!e!C!<'!'د  !@ ! @@ ! @ !$ ! '(<'!'د 8!0! !"'#$% & !$(,0 '($<'|!'௿ !!' <'8! <'!(  !<'!'د$  ! ' ! 'p '$ '(!<'h!'௿X! $!' <'!'د !! ! (!X@ ! !@$ `!'(!!<'p!'௿! ! $X@ $`!' !$!$<'!'Я,($ !!)! ,B@$ B !@XP!! ! (! $&&%X$ &%X& $B &sb+B $ ,($ `!'0<'!'ȯ40,($ !!! !@?! !,B@5!q ."@0!!,$ `! ! (!&RQ+@&`d P(!" d !(!d P"d ! $(!d P"d ! $b $$Bb 40,($ `!'8<'P!'Я,($ ! !@,! !,B@"! ."@!!$ ! ! `(!&RQ+@&` P`(!"  ! $$B ,($ `!'0<'8!'௿x(!$ !&(!x $&(!x $ $' <'!'௿p !!' <'p!'ȯ0,($ !!!@! !,B@!  ! ! ! `(!&R@&$@&2! B+@zT!T!''     '"#$%&'()*+ , - . / 01'9'''     '"#$%&'()*+ , - . / 01'9'''     '"#$%&'()*+ , - . / 01'9 &RB+@'x" !$(! $ $$B 0,($ `!'8 (+!!  !(+!$  !(+!$ <'!x <'! <'! <'p! <'T!'௿L !!' <'! <'! <'!, <'!֤ <'! <'! <'h! <'L! <'0! <'!р <'!@ <'! <'!x <'! <'l! <'P! <'4!'௿L@ !!' <'! <'! <'!, <'!֤ <'! <'d! <'H! <',! <'! <'!р@ <'!@ <'!@ <'!'Я($ `$T!!H  !` !, @(!@ !($ '0<'!'د$ ! !! !@ !(!| 8! @0!&D (!$  '(<'!$ČF <'d!'௿ !& ' <'!T $<'!'Я($ ! !!! ! ! (!|@8! @0!@(! &($ '0<'`!$G <'@!'௿ !& ' <'!T $<'!'Я($ D!0L!!$H 8!@0! !@ ($ '0<'L!$B <',!  <'!'د$ !! ! 2"# $$ '(<'!'د$ !! $ (!,@ ! @!&L@(!ȏ$  '(<' !'Я,($ ! !! !@0!(!$|G '&$x '@'R ,($ '0<'p!'Я,($ ! !! !@0!(!$|G '&$x '@'R ,($ '0<'!'Я($ L!!!' @0!& 0!P '  '($ '0<'0!'Я($ L!!!' @0!& 0!h '  '($ '0<'!'د$ L0!! '&0'0 $H  '$ '(<'!'د !L!  ! (!֌  '(<'!'د$ ! !! ! 8!@0!|@(! &&  (!&  (!&0T  (!&@  (! 0!&d  (!&x  (!&ܸ  (!$ '(<'!'௿! $ &D & &0 &@ &d &x&Џ ' <'!x b$Bb<'! <'h!'௿!b` !$B@ b ␌$ ' ' <'! <'! <'!'௿LT !!' <'t! <'X! <'<!, <' !֤ <'! <'! <'! <'! <'! <'x!рT <'\!@ <'@!T <'$!'Xx!' !' '''&x  'LF  ! (! ' '&E @ !'d &d   ! ''<'!'lhd`x!'X !'X 'HlTP'X'P &$ 'X'%L @ !&' @(! '<4B't( ( '& @ !', &$@  @ ! 'lhd`'p<',!'د$ !$@ ! @ !, @(!  !+(!( !@&$ '(<'!'د$ !$d ! @ !d @(!  !+(! !@&$ '(<'!'د$ !$d ! @ !l @(!  !+(! !@&$ '(<'L!h!! !@(! `0!<'$!'د $0 ! ! @! ! ȏ̏@0!$ '(<'!'د `$ ! !` @! ! ȏ̏@0!$ '(<'<!0!ȏ$ $<'!'LHD@<8!4!`$0! !@P @ !@!4$PЏ4,@ ! $@ 8,@ ! $*@X$ V4, ! $@N$4, ! $Џ@4 !D"E@$$ $@ ! "E' 4 $8$E' 4T $H ' "EL !`(!@0! 8!$4, $$@ 44d$¸ $!$LHD@<8`!'P<'!'ȯ40! ' ! ' '40'8<'\!'<840ȏ4!$R@! &%؏ !@!, $옏'4 $菼'44 $쏼'44 $'44 $'44 $'44 $' ! &%؏'0 $H !'4 $' !4 $'4 $'44 $'44 $ '44 $P !'4 $䏼<840'@BB<'!'௿4$8!$' $  !' <'۬!'د ! ! ! ! $E@ !L @!$ !C(! &$0 @! !(!䏿  '( '(<'!'LHD@ $!!!b $,b@$$b$$b$$X E(ָ '@ !(!h '@$!"''9$  ! ' !'9 (!$LHD@`!'P<'ٜ!'௿T BB' $B<'X!'8į0!! !0'8@ !L8 '@<<C4Bރb08Ï` !&F~|$0'pC#! 8!0&F~|8!$0  !0   !0 !  @!0 @ !0` ! @!0 ! @!0 !'94 @!0@ ! @!0$e $l `8!$(!0! ! (0 !$0` $B|0  !0 !(!, 0!0ď'<'!'ȯ0,($ ,! !! !@! &, ! @(!`0!@ !'9x  (! ! (!`(!@ ! @!  ! @(!!0,($ '8<'!'Я($ մ !& !  !0|@8!$H 0! p` !($  '0<'<!'௿0 !Ϩ ' <'!'د$ R ! !@(!Ũ 0!  ! !@(! $(  !B`GP$X0! $ !$  '(<'!'@<840@!Q!  !' @!$L !b' @$B $ $X  !  !@ $ !B'$ !B`(! @<840'H<'!$ !`! <'Ҝ!'Я($ ! ! !@(! $$S" @ !| (!@!$|D  $C$|@ ! (!@!$$ @ !` !@(!Ũ $!B$!($ '0<'d!'@<840,(!!b !T$  0!@ ! (! (!@ !l '  @0!@ !'$ @! (!@ !8 '  @0!@ !'$ @! (!@ !'  8!  0!'$@ ! @!  !  0!@ ! `(!  (!L@ ! !@<840,('H<'!'LHD@!|$ '8$  2!2 #$b$(!8|'@$   !' @!@0! ! ' !$%0! $ &D$LHD@'P<'Ψ!'<840,(!! !$@! !@8!T0|$D$H0!@ @ @!&"&1؏(!` !0! 8!`8!' 4$ $菼'  |$ (! &\ `8!<840,('@<'̀!'ȯ0,($ !&03  !  ! @ !@8!$4' $  &$` ! 0! $@t @ !0,($ '8<'|!'௿X D, ' <'8!`$ b$H$ ! 8!T !! !`! <'!'ȯ0,($ ! ! ! ! @!*@ !$%0! @!x$ !!`(!`! @ !@ !$%0!@$@ !$ '8! 0,($ '8<'!8!0! $ <'!!c`` ! <'ʌ!'P ! X@ ! ` !P@! & R &C,` ! @(! b !T $ @ ! @! @!D /@ ! '(@ ! 0!8! (! @ !  ! @! ` ! @! C4$4 8!' $   @(!   !  ! @! ` ! @! C4$| 8!' $ '<'!'X ! @w$W  ` ! R@! &V, @(!  ! b T @ !  !@(! '( @d  !  @! ` ! @! 4 8!$ļ$ ' D @ ! @ ! (!  @ !  @(!  ! D @ ! @ !(!` 0!b W$b'<'Ŭ!'Я,($ !  ! ! @!@!$b$ b$b$ $ b$ b $ cb  !'9  !$b   ! !@(! 0! !x (!$C  !0  !p$Ϩ  !$B$   ! !@(!Ũ $$,($ $X '0<'Ì!'ȯ40,($ ! !@@   !#,b@$s0b4@ $< 4Bb$@`<b$@Q# b `  !  !" @ !X @ ! ! $ 0$$B,B@ $HT @ !S  (!0  !ܮ  $ J  !3$(`  !  !* @ !"!3(! ` !@ &QC$b  @ !X @ ! !$#' $" @ !T $0 ! (!40,($ '8<'p!'Я($ ! 4! @/!P+&, @(! @ !%   !@ !ې @!$&C(! @! @ ! @(!`!($ `!'0<'H!'`\XTPLHT!!! ! !@! !ָ@' Q O( $ ! (!`0! !b0' `!E  @ !Ȝ @!@(!0 @ !  ! !$dF @(!@ ! (!$ '  !'9$ '  @ ! ' l  !$`\XTPLH'h<'d!'p|xtp4'p!8!$ !!4 $'!``;!   !@ !R@*! @0! !(!'9x @!(! ` ! !@(!'9 `0!@@!4$G 4$G(4 !$0 $!|xtp'<'!'D@<840,( X!  ! Q@! &4,  ! @(! "@@ ! ! @0! ! `(! $D$X @!  !(! 0! @0@! ! $  @! @(!  !   ! ` !  @!  ! @! 4$P 8!'( $ @!D@<840,('H<'!'` X! ` !Q &6rP B !@J&, @(!  ! b !T $@! @` !'9 @!E   !  !D @! $'(8!@ !(!  0! @!$!0 P  ! @(! $b` !'9 @(! !`!'<'4!'௿ $' <'!'د$ X!  ! ! $  ! !@(!Ũ 0!#$ b ! @!@!$ '(<'0!'<840,( ! !!!!@(! ! @@<!P  ! b `!  P@ ! &, 4$ń'($   @(!  ! e   !  @!  ! @(! !<840,('@<'!'hd`\XTPLHȌ'9쌐W !@ @ !(!0!'9Ԡ '@@@!$$Bې @ !@$@ 莐  !@ !@! &, !, @! @!@(!  ! p  !0!(!'9x @ !(!  !  ! @(!@P &,@(!  !(ָ ' !`(! '@$Cb$$' B  ! @(!#$''9$ ` ! '  ! @(!@ !'9 `(!$B$hd`\XTPLH`!'p<'x!'ȯ40,($ !!F!!?$ @ (!'9Ԡ '@!2! $Q 询  !@!  !$C  !`(!  !&X $$@ ! (!'9 0!40,($ '8<' !'<840,($ !!F!! M! @(!'9Ԡ '  $S 询 ` !@ !@!ې $R  !(!  !&0D  !XR !$$ $ `(! 0!'9  !@!p  !@!<840,($ `!'@<'@!'௿'9 !  !4 (!$' <'!'Я($ !  !X  !  !$ !$' H!C-$ ! @(!0!Ũ  !  !@!$4 !$b0!8$b$2 0 ! (! !$ 0!$$" ! ($ '0<'t!'<840,(T! !q$R0@(!&$ @! &X@ !4 $䏼P@@ ! @(!@!, $H(!4@$ @!`%' ` !0!$ @ !@!0L $H!<840,('@<' !'௿X (!$' <'!$$&0! $<'!'Я($ $! ! !x (! !$ 0! !@$ $%$`! " !$''$ ($ '0<'!'د ,!bD `(! (!@ !4 @! ! $! '(<'T!'د$ !  !@ ! @(!@ $H ! @! @ ! @(!@ $$  !+(!8 !@&!$ `!'(<'`!'P ! ! X B !  @ !^ @!W " U@   !  ! @! 8!'4$ż @&,   !  ! @! 4'$8! $q  ',@(!  !   @(! C% rS  !  ! @! D @! $'(0!@8!@ !`(!  $ "  ! @(!   @(!   ! 4'$,$  (!$P!  ! !!  (! $'<'!'P X! ! B !  @ !^ @!@ !W" U@   !  ! @! 8!'4$\ @&,   ! @! 4'$Ƙ8! $b  ',@(!  !   @(! C% rS  !  ! @! D @! '( 0!@8!@ !`(!    ! @(!   @(!   ! 4'$ $ $'<'!0 <'!'د ! (!  !$C 4 ! (!  '( '(<'P!'د  !  ! !@(!Ũ $ !T $ $'(<'!'د Č !$C& ! 0! !Ũ @(!$T  !  !@!$4 !$b0!8$b$2  $'(<'!'د  $!b!  !T $ !T $ !0 $ $'(<'$!'د$  $!!b%!  !$T @! !T $ !0 (!$b !  ! $ @!$ '(<'8! <'!. .<'! <'!'X X!  !SP b @@ ! & Q &>, @(!  ! B !V $ e  ! @!  !D @! '(@ !(!0! 8! @  ! @ ! @! #8!4$' $ D  ! $'(@ !(!0! 8! @  ! @ ! @! #8!4$X' $  @(!  !   ! @ ! @! #8!4$Ǩ' $ '<'!'X X!  !  !P & S  ! !@&w,  ! @! c'4$8! $W`! @(!  !  !R $ ` ! @! ` !D @! $'( 0!@8!@ !(!  $"  @(!  ! $ !   ! @! c'4$$D  8!  !'9 (! '<'h!'௿T H @ !@ !8(! ' <' !'௿T H @ !@ !8(! ' <'!'௿T H @ !@ !8(! ' <'T!'௿T !H @ !(!8@ ! ' <'!'P! !!0 !@ ! @ !@ !,0! 8!$P.@$$!r$ n! @ !@ !0!4,8$Ȁ @ ![  !@ ! @!@@!4$QȐ  !(B @$  !@!4'X$Ș$@ 8!  !@ ! $@ !(!,0!&8!$b'! @ !@ ! @!$C @ !  !!B,G<@ !'0! !'<'`!'<840,($ !R !!!P !@!$B$B= !W$ "S$bQ$bM$bK  !@ !\ @!(! ! @! !$ @! ! @!P !|`(!@0! 8!<840,($  '@(!$R 0!8!@! @p` !P(! 0!8!@!<840,($  '@<840,($ '@<'8!'௿ ' <'!'௿ ,B' <'!'௿L< !!' <'t! <'X! <'<!, <' !֤ <'! <'! <'! <'! <'! <'x!р< <'\!@ <'@!< <'$!'د  '@!BB$C `!'(!<'!'د !  ! !  (! '(<'\!'د !'@! @!C `!'(<'!'௿0 $$' !$bԌ@<'!'Я,($ ޼!@ !! BP&  !$ !C`(!!  ! @ ! @!" !,($ $'0<'!'د$ ޼! ! D @(!@  ! B  ! @! !!$ '(<'!'௿ !@!|@@ ! !' <'`!'Я,($  !' 4$Ƞ $& @ !L  !DX 0! $L,($ '0<'!'د$ ޼!  ! CbBR !`!  ! @! !!$ '(<'!'د ! $@!$b% "4 ! $Џ !4@$؎"@P  !4@$"@T @"@L '(<'!'د ô! ! !D  (! $'(<'!'د !4!$ ! !@$ @ !T@  (!CbP@qP  '( '(<'!'د !4!$ ! !@ $ @CbT@qT '(<'H!'د !4!$ ! !@ $ @CbL@qL '(<'!'Я($ 4D4&Џ4 !@(!&@ !'9D D ! &E@(!&F@ !'9 D ! &e@(! !@ &fȏ($ '9 '0($ '0<'!'LHD@<840 !$X!$L!` ! @!@ !$@(!`0!4$<"X 说"X8!@(!`0! !  !  , ( !X'( ', $@ !(!\`0! !'9D @ !(!'9 `0! @ !(!'9 `0!! LHD@<840'P<'!'(ԯЯ̯ȯį!! !' 8!$!@! @!`! '  ! 0!$8! ` !0 @!P &@8!(!  !$ !p   !,$ ' (!'D@ ! $8!'4$0 $ !ԏЏ̏ȏď'<'x!'د ޼  ! EC$b !  ! @! !޼  ! EC$b !!  ! @! !! '(<'d!'ȯ0,($ !;! !b6޼' !@!BHD  @! @(!  !@$ @ !"+ (!8@ !@&1 !  ! @! !!0,($ '8<'!'د !  ! !@ (! @ !P &$C ! !'(<'|!' 쯲 诱 䯰 ௼ أ !@!,B@4ͨ$c0C!B\!@'4$4$04$\4 $Ɉ4$ɰ4$ԏ4ͨ'$ $L  !R ! (!@ !'D$ ' ؏' !4$0$  '(!ͨ 'D  !R$ ! (!@ !'D$ ' ؏' !4$0$@ '(!ͨ ' 쏲 菱 䏰 ' <'x!'PLHD@<8p!!` !$! !` !$\ C(!QPSX$D @!@ !`(!&P &Q &E h @ ! !(!x $$ !̏x(!p  $\Μ<44(,0`@DxptP4TH\L`,ldhT|L4@8l֐8HŤ  !܏8"h|B""" " "$"x"P"H"L"@"(t"00"4 "8𔮕TT"l"p"x"|̤ "dDT0  $0@!BT' 8B\h\ $菼' \  ! ' @ ! `(!hBPl BT&E(h @ !PL0HD@<8$'XC<'z!'Я,($ 0޼TX!@ !@ PL  !DX0! $L ! @ ! @!" !@ ! &P  @ !  ! @(!  ! @(!  ! @(!f$␌D $ &D( @(! !@0!␏,($ $\ '0EEEEDBD<'x@!'د 0`B@ @ !0 '@@@ !  '(<'w!'د !4Ơ! $$ !$0Ơ@$0  !$4@$`  !$4@$ + `!'(<'v!'ȯ40,($ !!(!` !! !@ !(!D @!@ ! (!0!8!@"! P@8! &`(!@ ! @!$` !p   !(! $\ @ !@!40,($ '8<'u!'ȯ40,($ !!(!` !! ! !(!D @! !@(!0!@ 8!$\B )! Q@8! &2`(!@ ! @!$` !p " "  !װ  ! $ ! (!@!40,($ '8B<'t<!  $,@$$! !P+L+T$ $ $ HPHLHTHH`(!Pb $Lb$Tb$(!!BHEH<'r!'Я($ 7! &3,@(!` ! &P, @(!  ! ! @(!  ! @(! ` ! @(!$($ '0<'q!'ȯ0,($ X !@'@!P &,@(!  !  !`8!' 4$$d   ! @(!0,($ '8<'p!'د ! ! ! 0! @(! '(<'pd!'840!!' (! ! (!T ' '840'@<'o!'!(!'! !' (!0! ` !(' ! `(! ! '$u0@菅4@ ! $透@P @ !@ !'菅8 $~|<ff4BfgbC#菙t  !@ ȏ@ !$ 0!,(!  !$"  ! '` !'@  &, !0$H 0!@ !(  (!  ! @(! !T ' @(!  ! '   ! @ !$'<'m!'Я,($ X!! !D$(! 0!@8!'9 ,($ '0<'l!44d$$ƿ 8!<'lt!'د Ȍ$'9  '(<'l0!'840`! ' ' ȏ48$Pl!$ $*!' 44$ʘ $ʠ !' 48X$ $'  @!4$B(4$B 4'0 8!$ʤ $!840'@<'k !'840`! ' ' ȏ4($Pl!$ $؏!' 44$ʘ $ʠ !' 48X$ $'  @!4$B(4$B 4'0 8!$ $!840'@<'j!4(d$$O  8!<'i!4! $<'>!! ! @(!<'>|!'Я($ !! !&,@ ! @(! !(! `0! @!@ ! @(!!($ '0<'=!'d`\XTPLHD@tx" 8!B!!U'  !@ !t @!@8!'@4$ $t$b( !4 $@ @ !P $"@!BR&  !@@0!!BR$(! &$&2, &1X@(! @ !0  !@ !(!L @!&L (! !T (! @ ! @(!t !ȯ`(!8! ' d`\XTPLHD@'hBB8B,BBCC!B$!$c(g $B,B@$$!$0!$$(b @$bHe$!$<':\!'د $ ! ! ! (!$d F '(<'9!'௿! !t$`$\ $' <'9!'௿! !$`$ ` $' !$B<'98!t$ !<'9!'Hɬ!'$ !'0! (! @ !'0 !(@(! &q,'d (!  ! @(!` !d ' @(!  ! '  !  @ !'<'7!44$'9R $<'7d!48$'9R $*<'7<!'0ȯį4|g(!$ ' &˴` !'h&t, '@0!&˴' '8 ' ! @(!@ !08$0 $Ɲ菼 !( @(!'X (!  ! @(!0!` !ڠ  (! @(!  !  !  @ !` ! (!  ! @(!h  ! 'ȏď'<'4!'9T $<'4!'9T (!<'4!'Я($ !4,!$! ! !4,@$  !$8,@+$* @&$ 0 ! $0 !8,@$  !(!\@$ @ $$ !(!@0!`8!($  '0($ `!'0$DH!!<'3,!'د  &,@(!  !  !  ! @(! '(<'2!'د ! ! ! 0! @(! '(<'28!'!e('! !' (!0!  !f(' ! (! ! '$u0@菅4@ ! $透@P @ !@ !'菅8 $~|<ff4BfgbC#菙t ! $u0@ ȏ@ !$Y@ 0!,(!  !$"  ! ' !'@  &p, !0$H 0!@ !(  (!  ! @(!` !T ' @(!  ! '   ! @ !$'<'/p!'د 44$$$ƿ'9Y 8! '(<'/!'د 44$$$'9Y 8! '($<'.!'د 4($$$O '9Y 8! '(<'.l!'د 44$$$ƿx'9Y 8! '(<'.!'د 44$$$ƿ|'9Y 8! '(<'-!'Я($ !0!!'$H @0! ! 0! '  '($ '0<'-4!'TPLH$e!!$E$*$f4$bBc 2$F$# '04$bpBcp20L` $̏"@"@)@ !`'8  !&' 8` $~| !' 4 $透$@ !4'0$t8!'9Y  ! @!  !4$$t'08!'9Y @! !TPLH'X$<'+l!'TPLH`!'  !'0 (! ! ' 0! !4T $h  !$@ !4< 8!$$Ƨ'9Y @!  !!TPLH'X$B$<'*P!D $bEЬEfEЬGHI JD<'*!'LHD@<840,( D菞4$WEЎ !!!@J!  @!  !t @! x @! 8!'($'̐  (!0!  !  @!  @! ` !t @! x @! '̐8!'( $ `!LHD@<840,('P<'(D!'HD@<840,( D菗4$VEЎ!!@J! d  @!  !t @!  !x @! `8!'($& (!0! ` ! d d  @!  !t @!  !x @! &`8!'( $ HD@<840,('P<'&!'ȯ0,($ D菓4$REЎB@-! $  @!$&fP 8!'  Y  !$ $  @!&fP 8!'  $0,($ '8<'%!'ȯ0,($ D菓4$REЎB@-! $  @!$&f͔ 8!'  Y  !$ $  @!&f͔ 8!'  $0,($ '8<'$p!'@<840,( D!4$UEЎ!!!'($`8!$@$ 0!@(! 8! ` ! @ !t @! 4$`8!'( $ !@<840,('H<'#p!'HD@<840,( Dt4E!!!`@2! ! @ !x @! '(&L`8! $E(! 0!@8!` !  t  ! @ !x @! &L`8!'( $دY HD@<840,('PBP<'!! <'!!D <'!! <'!! <'!|! B<'!L!'د ! !BX!@(!@! !@$ `!'(B$H!!Xp\`dhl#"$%& '($`!<' l!'د ,!  !@!,  !@0! 8!$H $ $$ `!'(<'!'د$ ! ! !@! !  (!@8!@0!$H $ $$$ `!'(<'!L <'!'௿@ ' <'!X <'|!X <'`! <'D!'د$ ެ!! ! !ެ@! @ !@(!X  0!Q!@$$ `!'(<'! <'!X <'p! <'T!X <'8!d <'!( <'! <'!X <'! <'! <'! <'t!H <'X!T <'<!'840!'  ! '840'@<'!. .<'!4 <'!Ũ <'! <'d!, <'H! <',!| <'! <'!'د$ !! ! !@! @ !@(!X  0!Q!@$$ `!'(<'X! <'<! <' ! @<<'! <'!'د !P ! "! '(B<'X!  <' ! <'!'د ! !@!  !@0! 8!$H $ $$ `!'(<'4!'د ! !@!  !@0! 8!$H $ $$ `!'(DD<'d!'د$ !!!#!$  $ !C(! @(!\ ! @(! !X@@0! 2!$@!$ `!'(<'!'د !!!(! @(! !X 0!@! !@$ `!'(<'!'Я($ !!!!$!$! $ !C0! @0! !@(! @(! !X@`0! 3!$@!($ `!'0<' !'د$ !!!#!$  $ !C(! @(!$ ! @(! !X@@0! 2!$@!$ `!'(<'0!'د$ !!!#!$  $ !C(! @(! ! @(! !X@@0! 2!$@!$ `!'(<'T!'د $!!! $ !C(! @(! !  !@@(! $! '(!   ''  'Я($ !!!!  !`! @(!@!&!($ '0<'!'د !! $ '(<'d! $<'H!0!$Ee!e! d!@  !<'!'د$ !P!P!C!D& ! $L&1L$ '(<'h!'௿ !' <'$!'௿@! ((!((! (!( ' ' <'!'د t!!$ $" !#$ '(<'4!'د$ !+@!"b!b!b!!+` 444$$Έ$p $#$C!C!C! !D +!@!@ !&P #$C!C!C! ! &Ld&  (! !&"$B"@!$ '(<' !'Я,($ !! !!!d !q(!@0! &&1,($ '0<' H!'د$ e+@F!`,@!$((!((!D (! (@! 4!0Q+@@e!((!((!D (! (@! !EFG   ! @ !BD ((!((!F(! (QP$$ '(<' !'ȯ0,($ <4c0e#C! +!!Bb!b!b!!e+` 444$$Έ$Ô $E@ ! $C@/c+@`!C!C!C!DdF ! $LD&1 ! $Lq+@&L ! !C !dF  (! d !B(!$B BC!C!DC!(!0,($ !'8<' !'௿! $@(!$D!D!C!(!$L!' <' |!'د !$E !#d'@(! ! ! !&   !$%$D!D!C!(!$L $C!C!C!! '(<'!'Я,($ !! !@!`!`!D& !DF d ! (!&1Cc+@`(!`(!E$,($ `!'0<'!'௿D  !@!!`!' <'d!'د ! !%  !@ !%&  "! `!'(<'!'د !  !@ !%&  "! `!'(<'0!'د L$ ! ! !@ (!  '( '(<'!'د D$ ! ! !$@ (!  '( '(<'P!'D@<840,( $!@ ! ! @ !@!L! ! D@@ !& @@ !& @ ! @! @ ! @!  ! (!0! @8! D@<840,('H<'$!'௿!!$@, &,E!' <'!!@$ !<'!'௿Ȝ! ! !ۜ@(! ' <'P!'Я($ !!!!!De ! (!&1@&B"+@$!($ `!'0<'! $<'!'0̯ȯįȜ!! ! 0!@(! ' ! '  ! ! $E@!B0B@@ ! @ !  @ !@(! &BB0B@@ ! @ !  @ !&ď @(! '̏ȏď'<'!'X`'8! !! !@ !''9 &p !@(!d 8! '@ !@ !0!'̎g('9P $`!'<'!'X`'8!@ !! ! !''9 & ! (!@' @8!@!$ !`0!'̎('9P !'<'!'PLHD@!' '9!! !h&d (!0! '  !@0!@' ̎g('9P PLHD@$'X<'\!'xtp`!' !& (! 'xtp'<'!L $<'!D $<'! $<'!T $<'!0 $<'h! $$C$<' !x <'!$ <'! <'! <'! <'! <'x!'௿Lx !!' <'4! <'! <'!, <'!֤ <'! <'! <'! <'p! <'T! <'8!рx <'!@ <'!x <'!'௿ ! &h@ ! ' <'!'௿ $  !@(! ' <'!  <'!h <'!'د$ ! !&@ ! @(! !'9  (! @!@ ! @(!!$ '(<'(!'Я($ !! !&@(! ` ! !'9  (! ! (! 8!@@0!! @ ! @(! ` !($ @(! '0<',!'௿!'9 $&@(!@! $`!' <'!'Я,($ ! ! !X@B ! &t !P< +@ ! @!0&p$ ! (!@ @0!̏,($ '9 '0  ! @(! !p  (!  !,($ @(! '0,($ '0<'H!'د ! $, ! @(! !&   ! @(! $'(<'!'د ! $, ! @(! !&   ! @(! $'(<'!'Я($ ! !&S,@(!` ! !D Ï'9 @ !D 8!`0! $ ` !($ @(! '0<'!'د ̏\!$8!$ƕ(!  !&8!̏\(! $Ɩ@ '(<'l!'௿! $&ď ' <'$!'د $!b$$, @(!  ! '9  !  ! @(! '(<'L!'د$ $! $@# !&2,@ !@(! $8!`7 $ @ ! @(!$"$ '(<'p!'x|xtp`!'! !  ! !0 @! ! @!@ !@S$ (! &D$PD@ !B @ ` !H @! ! @(! !BX@1! B !< + @ !<@  ! @(! &D $0 (!@ ! @ !$P@ ! $|xtp`!'<'d!!$(!'9 @0!<'<!'9 $$!D b0!DD$$$b$0!!<'!'د$ !! $<@!(!@$DF  ! 0!@ $< BDC"BD$cCQQDD &D$ !'(<'!'Я($ !!$< !@!(!@$DF  0!@$,0$<&  ! !0 &5 !0 @!H @ ! !0 @! @ ! ! @!@ ! @!@! @(!  ! @(!  !@0!8!(!&$   ! @(!  ! @(!  &$bP0B@J` '  !&, &װ  !P$C$ P@(! @ ! @(!  !& '   ! @(! @ ! @(!bPB0B@'x` !R & (!,  !DT(!` 0! ԏ @(! Џ @(!쏴菳䏲܏'<'є!'쯴诳䯲௱ܯد! ! !@` ! &ud(! !4 ! &d  !@!&bD` ! Џ' ` @!0  !@ !H @!ЏL @(!@  !@(!4, $@@v(!@ !& ' @n@!`'x  !B@5!0  !H @ ! !0 @! @ ! !< @!@@(! ` !@!  !Y(!0! 8!@2B@0  !H @ ! !0 @! @ !Y(!@0! &dڠ (!` ! $@ '  !+@X(!쏴菳䏲܏'<'!'Я($ !! ! ! @!@(!"4@ !@! 0!`(!($  '0<'h!'د$ ! ! ! @!.$P@ !  !P @! ! @(!@$!$ `!'(<'̜!'د$ !!@(! !@(!@  !'9h @ $h@(!0!$  '($ '(<'!'د !!@(!  !'9h @(!,B '(<'l!'ȯ40,(|! ! !| @!(!'0!"$'9X @ !'̏ $䏼40,(`!'8<'ʰ!'ȯ40,(!! !(! 0!@''9X @ !'̏ $440,('8<'!'௿ ! <0!␏$@ ' ' <'ɰ!'௿ !8 @(!($b(!4` !8!0!@$C 4 8 @(!0  ! 8 @(!'9  !$' <'Ȉ!'Я,($ !$@!! !@!@ !@8!$̮b(@*u1/Ï\$ p,q!P7(!4 $3$' @!@0!'X (!  !B!@ #Bb!b0B@&1  !B!"+@` !P(! $0,($ '8<'Y!'<840,($! !(@$%$xt$4$bD EFGHIJKcB    Y!PJ(! '@0!(!X '  !!$*|@(! ' $*d$#b'd$#b!' $Bb!b0B@&1$*  !!"+@@ `(!P` ! $4 $$<840,('@<'WP!'PLHD@<8!!! ! ,B@$ *@$*$"$ 4$bD EFGHIJKLM cB $ #%&'()*+,- " !P !x(!, ! $-@<@!Qt  !@0!"!$BjX'  (! !' `!S!@P$-U$ &R Bb!b0B@G&R  !b!B+@3 ! '@0!'X (! `!  !S!@P$*&R$#  Bb!b0B@  !b!B+@P ! (! $4 $$PLHD@<8'X<'S!'HD@<8$! !(@$%$OK$4$bDEFGcB8!P1(!4 $-$P' (!'! @!R!@ #Bb!b0B@&1  !B!"+@` !P(! $HD@<8'P<'RT!'Я,($ !$|$X(! '!@(!t$Y 0!"%0B@&!+@  !,($ $'0<'Q|!'௿'99| $' <'Q<!'د L$  !"L  $ ,8DP\ h "$$ @c$ $c4Ba& $ '(<'Pl!'x|xtplh x'(!!! !(!$ !'`<'dH'T'`'l' x'$ '(','Lx'P'ȯ'T !(!$ 0$ Xа@(!`0!$B: 8!  ! X@0` dX  (!$Y\0! 8! @(!4B0B$@0c4$P`0B4 0!@$!  ! |xtplh$'<'N`!'䯴௳ܯدԯЯx' !!! !(!$  !'ȯ($@ !`(!0!  8!@9$@5!|'0 (!$Y 0!ȏC!D (!@&1."@t$Y (! 0!@ !0B@4$0B@4$  䏴܏؏ԏ$'<'L!'@@!B0B@f!!|(!$Y '"'BC!D &@*`P$ '\0 L `L0, d#8$D%Pbh#\'hl&tpP$bt'|x #$b%ج'' $ $ 0!$ $c4Ba$ $`!'<'J!'PLHD@<8 x'(!!! !(!$ !'(0',H'0T'`' l'$x'(','0'4'T'X'\ ̏hа'̯<$B?@ !`(!0!  8! @!|'h@(!$Y `0! (`(!C!P  ! @&R.B@P'(!  ! !|' (!0! $  ! &1 @0! !\ `(! L@ *" , !P `(! *"@$t@(! $Y ' !P @! ,X ` 0X  0!\$Y(! 8!%0B @ B\$Y(! 8! 4$0B@\$Y(! 8! 4$P 0B@ $Y\(! 8! 4$  ! PLHD@<8$'X<'G<!'쯲诱䯰௼(x'0!!! !(!$  !('د8$@ !`(!0!  8!(@4@44 $((̜ &|(4 $Џ( &|($X(!| '܏؏(4R!D $$(@h`!|'@$Y (! @0!Џ(8B0B@RL (L !( $cp !دC!G@4$B$4$B(4$,@(!  $ď(@4$F$4$F(@4$G$4$G(̏4$Bb!b$\ '(&1"+@k`!|'@ (!$Y 0!؏((!R!D &1(@"+@L (L !( $cp !دC!G@4$B$4$B(4$,'@  $ď(@4$F$4$F(@4$G$4$G(̏4$Bb!b$\ '(쏲菱䏰$'<'B!'د 8!$(!|'$$$ $ l ' '(<'B!'8į!'! !$  (!| '$ (!| '$p$"$ P@(! '$$௢ '\l"$P@(! '$$' l$௢p '"$P@(! '$$௢ '$x\t"$$ @@(!P '$ $௢\$ '`d h$Bl$p 'x$\itP"@(! ' 'l 'p$\$P ' '.# `Bl4$cC!B\!@$ $ 5$$$$$ $$$$ $ $$$$$$$$$$$$$ \$Y(!' $ď'<'> !'Я,($ t!(!! !$ (!| ' !D@(!@ 0!  l ʀ ,($ '0<'=@!'HҰ!C!B@!|$s(! 'l ' D@l 'D x(!|$s '('$x` ! (!'0` !P @(!P 4C!E $t@$ $ X  !$4$b$@$!X$B0B,B @$cb$BЀb@4 $ ̏  !$C$4$  T0@ $ЯH0!$ (!@!X  !  !|xtplhd`$'<' !'د $'$& (! @ ! $'(<' !'Px' !! !!(!$$ !'$'H'(4@@ !`(!0!  8!@T!@/0!|$# (!0!$$| (!0!$%| (!4 $ (!4 $ $4$Bpb!e $ 8#$@$# (!@!0@0!$$ (!%<@0!$% (!%  !$'<'!'x|xtplhd`|!!!$(!'P !$(!|'T ' $(!|'X 'P$(!|'\ 'T !(!x$0 'X'\$@L(4@ !`(!0!  8!@W!@(4X $ H\@($E<$Eď4 $ `P4C!E $ |T4 $ -<@0!$ (!@!H@0!$ (!%$@0!$ (!%0@0!$ (!%  !|xtplhd`$'<'!'D@4! $ 4 $|(!$, '88(!|$-@ '< <'̏'9Ql (8$|(!$.b '< <'̏P'9Ql )B 8$B !$B4b!f'& $ *@$D@'H<'!'x|xtplhd`x' !!! !(!$0 !'P($'T'X'\4@L@ !`(!0!  8!@8$@4$ 0@0!4$ ( $ЏP $,@!<@ 0!XЏPX $-%H@ 0!\ЏP@\ $.%  !|xtplhd`$'$b$$c4Ba$ $<'!'H$$$$$$$$$$(4x!P(!!#H'#I(!$$h$l$p$t !(#`'#ax(! $('0 !x(! $'$d(D$ȏа !@(!$B'$`8`0! 8!$x$|$ $(@@@4@0` $N(!$|$J@(! '$h($x$h|$Kb!@(!'$l $x($|$l|$Lb!@(!'$p $|($$p|$Mb!$@(! '$t$t$(b!$`B$$d$B,B@@40 $ P( &N($h4 $ p($l4 $ ($h$l4E(# $ ($p4 $ 菼($t4 $ ($p$t4E(# $ 8( &N($d`$b54$ ` !($W@(!|'H $('H ! $#(@'0w!&'#` !$ 8!('#H(!X ! $#Y"(0B@4$E 4$E 40!$)$H$#$ w! $(0B@O4 $ ܏(ď4 $ (ȏ4 $ ((̏4 $ T<b4ME(4$ |()1@0#00!0 F0#<Q4E(4$ ()B0@0!00!0 F0#(؏4 $ 䏼(܏4 $(0 $N(`$'Hb!E ! $H(@'0w!&'#` !$ 8!('#H(!X ! $#Y"(0B@4$E<($E>$40!$)$H$#$Lw! $(0B@O4 $ ܏(ď4 $ (ȏ4 $ ((̏4 $ T<b4ME(4$ |()1@0#00!0 F0#<Q4E(4$ ()B0@0!00!0 F0#(؏4 $ 䏼(܏4 $(0 $N(&&s< $,($&R*B$c$@P'$`$R:$d$B,B@?40 $( &N($x4 $ p($|4 $ ($|$x4C(# $ ($4 $ 菼($4 $ ($$4C(# $ 8( &N($d@R!!|'H0!@(!$W &R*B(@&!$ '@6'0@!C+@+'#%`8!%  $ $%%% ، $ $`0!% $'$` $&%&R*B'@%J4! $($''0S!";@'#`& !$ 8!('#H(!X ! $#Y"(0C` 0B@4 $E<( $E>$0B@4$E 4$E S!B'H!0B@$f4$G($GS!C!$D)0c$B#`($C4$C4!$BH $ S!(0B@94 $ ܏(ď4 $(ȏ4 $(̏4 $ T(Џ4 $@(ԏ4 $h(؏4 $(܏4 $(0 $N(&i&R< $,($$$$$$$$$$$'$<'\!'lhd`\X x'(!!! !(!$HLPT !'@0'D <а@ !`(!$B0!  8! @`8@\,@X!D$B,B@!(!@$J'H$b (!$K 'L (!$L 'P (!$M 'T D(!`$W$b @$b &*@0 &N D@ $B !`4b!f $  &N lhd`\X$'p<'!'8|'($ (!', !| (!'$| (!(!'0| $($E(@<$Eď4 $ ($E,@<$Eď4 $,'4 $L8$'@<'!'쯴诳䯲௱ܯدx' !!! !(!$< !'4'xL'X'`''h !(!$t@ ($@ !`(!0!  8!@@$@<<@80!\$s$  8!@!0B@B4$l0B@!4$ Ұ  !D@0!\(! &R@&1*" @ ! $  !쏴菳䏲܏$'<'!'8įx' !!! !(!$  !'(؏$ 8!@ !`(! 0!@W!$@N!|(!$s '0$ !C (! (!$st 0!"%&. @.$ (!$st$ 0!@!0B@ $ $4$0B@$ $4$   !ď$'<'!'h!@2!|'E $s<P,b 'D8P 'c @8'b' $ $$0!$c4Ba$ $`!'<'!'쯰诼 x'(!!! !(!$< ! '௢0'<'xT'`'h' !(!$t H ` !аЯ 8!$B@0! (! P@D'pҰC!E $st 0!@!, @10!D\$s$ @+8! % B0B\8$s$ 8!@ 0c 4$l !$ ` 8!@! 4$   ! 쏰$'<'!'P 4! $ 4 $ $(!| ' |(!$s '($ C*P L !$Bb!4$F'T'sg@4$F4$D$@4$D(4'0 $$ &. @$'<'T!'`!!|(!$s '$ !C (! (!$st 0!"%&. @  !$'<'!'௿'9| $' <'X!'PLHD@<8x' !! !!(!$  !'0$|(!0! (h$@ !`(!0!  8!@!4@ $\0$Bb!e $0!$@(! @!  !PLHD@<8$'X<'!'hd`\XTPx' !!! !(!$  !'0$@ !`(!0! 8! (@0!$\(!8!@$O B40B$x@0c`4$ hd`\XTP$'p<'!'x|xtpx' !!! !(!$  !'h($0!@ !`(!  8!@v!$@rh@B|$N(! 'll!!@c'0| 0!@(! $P'P !H (! (!0!4 8!t@$! &R(!4 $$O@(! 0!%40B$@ (! l&sb+㈏HQ!D'P (!h@4Q!E$ 0!(!4$􏙄t$$O 0!0B@ h4Q!E$ |xtp$'<'h!'D@|'8$N (!8!4 $L4 $h8@(!|$P ''&4 $=8+D@$'H<'!'XTPLHD@x' !!! !(!$  !p'0$8!@ !`(!0! (@!|$(!@ 0! (!4 $$$@(! @! ` !XTPLHD@$'`<'`!'PLH4@ $!  ! )@0!(!  '2#0`$FN0$FH<' $&1L'0'@ 'D@!'x$ @$0 $NPLH$'X<'H!'plhd`\Xx' $!!! !(!$$PHL !'H('L4$'P@@ !`(!0!  8!@E<@0!$Q (!$@!(!$T& 'H*@@H@8$Eˌ<$Eh4 $0@L`@$b``B@8$Eˌ<$Eh4 $ďplhd`\X$'x<'\!'HD@<840$!!(`7!(@$ !"$+!X(! $b@(d @xL'(' ',@@(!q$P ! @ !d$@3!($$bHBcHBC'( b!$S&$c0*ͨ(!@ !"u*!`$ &<$E4$",$E菙ͨ @ !L'', '(@!@@ !$" @ !,ͨ $H$0 @ !B!H$\c\CD@0!! @ !HD@<840'P<'ڄ!'د$  |!,0$/(!' !$2(!|' 'Џ$0(!|' '؏$3(!|0! 'Џ$(!|' 'ȏ$4(!|' ' $5(!|0! 'ԏ$6(!|0! '̏$*(!| `0!$(!| '$(!| '䏼$(!| '菼$(!| '쏼$(!| ' !(!x $'Я@'ȯL'دX'ܯd''௢'䯢'菼'쯢'ď8$,0(4p|@ !  8!@Q!@@($E<$Eď4 $܏̏4$B@b!e $Џ< ,4C!E $ Зҏ4 $$؏4$B4b!e $@܏@($E<$Eď4 $X'܏4 $p'ԏ4 $(!`0!| $*ȏ4($$<4..$ 4 $Џ䏼@($E<$Eď4 $菼菄4 $쏄4 $4$Bb!e $0$@0!$0 (!@!0@0!$/ (!%<@  $2(! '%H@@ 0!4 $H җȏЧ$3 (!%T@$(! '؏%`@$4(! '܏%l@0!$5 (!%x@0!$6 (!%@ $*􏙕$B˄b!f (!%@$(! '%@$(! '䏼%@$(! '菼%@$(! '쏼%@$(! '%  !$  $'(<'Ҕ!'\XTPLHD@|!!!$'8(! !'<$|(! '  !(!x$ '8p'<$@0! 8!` !(!( 4@/!4@$`8$Bb!e <4 $|$0!$@(! @!00!$@(! %  !\XTPLHD@$'`<'!'௿4 $4 $ԏ4 $4 $T4 $4 $ȏ4 $' 4 $0<'!'௿0 $N4 $p'9 4 $4 $܏4 $4 $P4 $t4 $4 $4 $4 $D4 $x4 $4 $䏼4 $d ' <'!'h!4!!$$ 0! (!+ 4'($FH$0 $ $.`0&&,b@>4$c<C!B\!@!$$$$ $$$$ $ $ $ $ $  +$.E$&$%4$+$b|FDEc|B (,04 64(!$  '$'<'!'p!4!$ (! 0!."@&"&#,b@4$cπC!B\!@$$ $ $$4 (! $h '$'<' !'x|xtplh!8\!!$E ! $@H !\ !@(! 'X@`b@($E<$EČb,B@4$F䏂0$FH4 $X@(B@4$E 0$EH4 $X`pC4 $4`f@H\$ $@!$4 $Pb!Ca0`$EH4$E`4& $db!D4 &@(!4 $4 $b!LD @!b! D @!b!ČD c 0!!e8!&D b!LD @!b! D @!b!ČD c&D!e 0!8! & 0 $N $8\ !$G $@& !\ !@(! 'X@ !\@(! '\@ !\@(! '`@'9 X\` jH\$\ $@ !\ !@(! 'X@@(!\ ! '\@4k$ͰX\H4\$ $@ !\ !@(! 'X@4R$ͰX0$4\$ $@ !\ !@(! 'X@4:$4ͰX$8\$* $@ !\ !@(! 'X@4"$LͰX$ L4\$d $@> !L@(! ' @ !\@(! 'X@' 4$h G X@#(!$Ͱ$0B&&,B @$ #$*Ͱ$ b(! #$#Ͱ$ (!b&1 "$@(! 0!+|xtplh'<'ð!'(Я̯ȯįx' $!!! !(!$  !'0$8!@0!` !(! (@#($$@ !  !0!@''9 '9 @4 $Џ̏ȏď$'!!!!<'D!'lhd`\XTPLHDD$$$G|$GbG G|5!$x&5 !(!$ &1!&!$?x4 ! !(!$ &1!&􏒐!$PE& ! &1&T!&R4!!$<!x&dD !$t (!&1$f&Rt!&st$#$讂t$x$ZĐ$ $<$$TĜ$$$ĀĈČĄ\Pl|dhx|ĔĘ|'( (&؏PC $^ &$ȏxPC4$ $Bܮ$&4 &HPC4C $B$B$@UB &X0$0B@$4QU$BD$`P&lC&q E$ &|00B@4w!$Bb !&PB$ &r$ &00B@4w!$Bb@!Ǹ&PC$&q$  &ď00B@4w!$Bb !PC&$&q  &菢00B@4w!$Bb ! PC&$ &q  & 0B0B@4w!$B b !PC& $&q  & 000B@ 4w!$Bb !W!@ !$ x&  !(!$ &1!&!&t$x&D !(!$ &1&!&Rʀ 5  '&P @(!Џ$ $t4$ $ 4ЏЏH$$ $ďlhd`\XTPLH!'p<'!'د$   ! !b@n'x !(! $H&B"!c$$b,b@ $@$b,b@$$b,B@<xb%,bA@$ 'x $b$b,x!$Bb!d&E %(!&`!@(dx$'xx!$Bb!d&E %(!&@`!`x$$8$E%(!< ,4l$C$B#!"!$0$$$0! 8!&s$$BDb*@&1$x'@` !(! $'|'菔4Cl$&&8`0!HT8!P| D$&ďl&8B`0!HT8!|D P&&8Ǹl`0!C$HT8!|D P&&8l`0!C$HT8!|D P8!& l&8C$`0!HT|D P''ʀ' '0'p(!x$l '@0!x'P|'p''$(!tȯ ԏ0!$|(! ' 0!$| (!@0!$| (!`0!$| (!0!$| (!'P$| (!'p$| (!'$| (!'p8!4l$ $(!'Xx $' \l`(!|h$  '$B,B@Ll@'X4$`$菄4$`$ 8!$,B@'| $ l@'X4$$4$$$ 8!|$'($ h'  !P ') !, $*@@4l$8$'X 8!x'(!` ! $<'$'  $ 解䧠$$,B@|$@0! `0!8!4l&H &%$ $$|$@0! &H&%l`0! 8!$,B@$|@0!$ &H&%l`0! 8!$B(C@(!`Mx'@ !(! $$'|'@0!$'(! 0!$(|(! '8!@0!4l$` $ !(!x$ ''(!|'$1  '`0!|$+(! 8!0!4l$p $ԏ@ !(!x $$'@0!|$(! ԏ@0!8!4l$ $(!|$, 'ď' !x$0 (!'ȯ'ď$|$-'$@  '̯̏̏ď|$. '̏ '̯̏B̏4l$$ 0! 8!ȏ$B(C@(!`ȏx'@ !(! $ '(| $N(! 'Џ!@$P|(!  0!@0!8!4l$ $dЏ&+x'H@ !(! $ 'X 0!|$ (!$8!4l@0!P$$ L'h(!x$ ܏'''x'4'''''' ''8p'(!$l|xħЧ̧ا䯢 '܏'X'd'|'4'8(4@Lp| $0<HT`lx$X(! '!@Z'|$Y (! `0!@$0BCL L ԏ'h4l$$ p 8!@8B0B@/B0B@+L !L ԏد܏@!`(! &&C@`!@܏4l$$' 8!&1"+x'H@ !(! $<'P'\'t'$'hdLXp|!x' !(! $t (!0!|$s &1$@0!4l$$C8! *" @'x !(! $ $'䏙|@0!$(! 8!0!4l$ $`' !x(! $$(!|' ' $(!| '쏼'询4l'8!0!$$$   (!$x  !&<4 002< !'&&dĘ&&@$ '(LXdp<$HT*`l&j|xd' '(&dP&eT4l&c\&fĜ&gL'0!8!$ $ !(!x $0&eĈ&dĀЯ܏4l&cČ&bx8!0!䧲̧د$ $4 !(!x$ '@'8|,<@0!0$# (!0!$$| (! 0!8!4l$  $܏ʀ $  !'(<'!'௿'99| '9| '9s !' <'0!'Я,($  $&S !* T!@` @!!P$ E(!  !&S !T! Q+&R`&1,($ '0<'P!'LHD@<8!$ R#@&!!&$C $B c!b! ! (!'(!P@&s  !P  (! !P '$ R#*@&R*B @$ $ ` $d &R@$b $Bb ALHD@<8'P<' !'ȯ0,($ !$?T#@!!<!&C&Bc!b! ! (!@@!@4"@@ 4`$?&E&Dd ! e(!@4!b!'!'     '"#$%&'()*+ , - . / 01'9<!$bb!$c$%&''c!     '"#$%&'()*+ , - . / 01'94!#$%&!b!'     '"#$%&'()*+ , - . / 01'9"#$%$?&T#*@D&s&*?@<$?<4C!D(!``` !$?&@$􌂁$B$c0,($ '8<'8!'ȯ0,($ Ұ$&T !* U!@`4db!!!bP !@ &st<(!$l E(!T!U!Qq&* &Rt@&10,($ '8<'H!'8į!$R#@L!!&b5"!&d6$$ ! (!@:'0! 8!& $ $&b6$"0!&b5$"8! $ $&d6$ 0!$8!' $ $$&R#*@&1&R*B@$$`5$d5&R@$b5$Bb5Aď'<'t!'௿!(! 0! !x(! $$ !' <'!'د !0!! (!$f$P(!` !  $" #! '(<'L!'د !0!! (!P(!$$b$f  $"# ! '(<'!'h(!쏙\ $L@&@ ! C'@!$x(!$lb !  !$ $  @ @(!`4B@$\ '(!(`$$$<'!'Я($ !!!<b!&$ ! @(!&$ !@@(! &$ !@@(! &$ !@(!@&1 @&s&s`!*b?@$($ '0$, $$!`!$ !`!$<'@!'ȯ40,($ ̜$&F(!H!*G!`@5@+!$!!$6!P$5e(!  !B&B0B&s@0c&`@&B8B0B@&R&5+@&140,($ '8<'!(!D 0!<'!$D <'!'Я,($ !! !."@!4$cϠC!B\!@<C!BLBBB ܮB׮BҮP ! $B(ŮB,P ! $4$b0e0DCB((!(P(!$B((!  !((!(P(!$B((!  !((!(P(!$B((!  !((!(P(!$B((!  !t((!(P(!$B((!  !f((!(P(!$B((!  !X((!(P(!$B((!  !J((!(P(!$B((!  !<((!(P(!$B((!  !.((!(P(!$B((!  ! R!R!C!BR!R!C!B BBBBP ! $BP ! $P ! $ӏB֮BhѮBl̮BpǮBt®BBBB<C!BP4ĬE(!  !<C!BB!$S$RBCDEFGHIJK L M N O PQ&R     S'BCDEb!$Sx$RBCDEFGHIJK L M N O PQ&R     S'BCDE2@R!C!B|*@R!C!B"@R!C!BR!C!BR!C!B R!C!B.B@4$c`C!B\!@BBǸBB Bݮ(P(!$B((!  !R!C!BɮR!C!BR!R!C!B `R!R!C!B d((!(P(!$B h((!  !((!(P(!$B ((!  !((!(P(!$B Q((!  !((!(P(!$B p((!  !uR!R!C!B kR!R!C!B aR!R!C!B WR!R!C!B MR!R!C!B CR!R!C!B 9B 4P@R#$ E(!  !)B ,$B 0R!R!C!B H((!P($B 4(!(!  ! C!BtR!R#$cC!!'     '"#$%&'()*+ , - . / 01'9B5ϮR!R#$c5C!!'     '"#$%&'()*+ , - . / 01'9 "#$%&'()((!(P(#$B5((!  !R!R#C!B5y((!(P(#$B5((!  !kR!R#C!B5aR!R#C!B5WR!R#C!B5MR!R#C!B5CR!R#C!B59R!R#C!B5/R!R#C!B5%R!R#C!B5((!(P(#$B5((!  ! R!R#C!B6R!R#C!B6<C!B<C!BR#R!4d!C!!'     '"#$%&'()*+ , - . / 01'9"#$%<C!B<C!B((!(P(!$B ((!  !<C!B<C!B<C!BP4E(!  !<C!B{P4E(!  !r<C!BlP4E(!  !c<C!B ]P4E(!  !T<C!BPN<C!BTH<C!BXB<C!B\<<C!B`6<C!Bd0P4hE(!  !'P4E(!  !P4E(!  !P4E(!  ! <C!B<C!B P4$(!e(!  !C!<C!BD<C!B`((#(P4l(!C!((!  !R#R!C!<C!B̮R#R!C!<C!BR#R!C!<C!BR#R!C!<C!B#r!4d!b!!'p     '"#$%&'()*+ , - . / 01'9#R!T!#<$%&C!Bd,Tf<C!Bx`<C!B|Z<C!BČT<C!BĀN<C!BĄH<C!BĈB<C!BĘ<<C!BĐ6Bx1<C!BĔ+<C!B\%<C!BP<C!BT<C!BĜ<C!BĠ <C!BĤ<C!BĨʀ !,($ '0<'<!'`!!|(!$s '@$b ' <@  (! @&&!&* @$'<'!'`0.P!| (!$s '@$b|@%0P$&1*" @!'<'~!'`( Qh`!|(!$s '@ b!$  (!d @&&!&* @$'<'~D!'ȯ40,(!!@c!?4$$bD EFGHIJKLM N O cB         A PC!E ! $8 ! ''X $6@ ! '@&1  !@!@(!$|$s"'!| (!$s '8\'@@@(! @&1*" @! !40,('8<'|h!'0̯ȯį|!'$B! (!'쏙\ $@5(!L @ !C@ !$b+(!x'PЬ$l  !P@ X$  !$C$ $ T  !@ @(!`B@4 $\$̏ȏď!'<'{!'Я($ | !(! '$2(!|' !@!"@ $t !8  ,"&*@$($ `!'0<'zT!'诵䯴௳ܯدԯЯ|!!!$B(!'  !' 쏙\ $@S!L @ !@!B@J!P$@(!& @ ! 'X` !x(! $l$` X$  !$C$ $ |\$ $ 'ȏȏ@ @0!8!'h $S ` !@ @(!`B@$4 $\$菵䏴܏؏ԏ`!'<'xh!'ȯ0,($ |!! !(! '!@+!|$2(! '$ < @ !`(!@0! 8!$"@ $0!@ !`(! $"&*@$0,($ `!'8<'wH!'@<840,($ !!!!! .@4$ctC!B\!@<d!bLCC(@欃`$$$ ݬCD  !S 4dB!@ f ! `(!&1*" @&tB CX(!& $(@'$``(@$`($ C,X(!&4 $$ C$b0De0FGe2d0 !X!&$ !(! $!'Џ'9 j$!X!&$ !(! $!'Џ'9 S$!X!&$ !(! $!'Џ'9 <$!X!&$ !(! $!'Џ'9 %$!X!&$ !(! $!'Џ'9 Ǐ$!X!&$ !(! $!'Џ'9 ͏$!X!&$ !(! $!'Џ'9 ӏ$!X!&$ !(! $!'Џ'9 ُ$!X!&$ !(! $!'Џ'9 ߏ$!X!&$ !(! $!'Џ'9 叼$S!ЎS!C!''9 F$S!ЎS!C!''9 Fy$Ў''9 Cn$Ў''9 Cc$Ў''9 CX$Ў''9 CM$X(!& $'Џ'9 $<Ў''9 C1$X(!& $'ҏЏ'9 $ X(!& $'񏙀Џ'9 $Ў''9 C$ChClCpCtCЎ''9 C$CݬC<d!׬b䏐X<!(!&Ĭ $2̢ݏ<d!Ƭb$$ C!&$SBCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqT&sBCDE$ bcde!&$SBCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqT&sBCDE$ bcd]e@ЎS!C!''9 F|N$@ЎS!C!''9 F?$@ЎS!C!''9 F0$ЎS!C!''9 F!$.b@4$c4C!B\!@ D DǸDD DЏ'9 '$ X!&$ !(! $!'Џ'9 $ЎS!C!''9 F$ЎS!C!''9 F$S!S!C!D `S!S!C!D d!X!&$ h !(! $2!'Џ'9 $ !X!&$  !(! $(!'Џ'9 $ !X!&$ Q !(! $!$ x o!X!&$ p !(! $!$ g S!S!C!$ \D S!S!C!$ QD S!S!C!GD S!S!C!=D S!S!C!3D S!S!C!)D X@#&$  !(! $! C ,C 0S!S!C! D H!X!&$ 4 !(! $! Gd!b|!D|!d#S#@b!y!W$'"!b!&BCDEFGHIJK L M N O PQ&R     T'!E|!E#s#@C!Y!G$` ! 0!s!s#$B5!b!&BCDEFGHIJK L M N O PQ&R     S'BCDEFGHIo S!S#C !6$0BC`5^$S!S#C !6$0BCO5M$S#S!4d!!C!&BCDEFGHIJK L M N O PQ&R     S'BCDES!S#C!f6B0B@0B@b5$S!S#C!f6B0B@0B@b5$S!S#C!f6B0B@0B@٬b5$S!S#C!d6B0B@0B@ b5*@d5$$S!S#C!f6B0B@0B@b5$S!S#C!f6B0B@0B@b5$S!S#C!f6B0B@0B@~b5|$S!S#d!6B0B@0B@ X$5d !(! $c6 a$S!S#C!f6B0B@0B@Nb6L$<d!FbP<d!@bT<d!:b<d!4b!X!&$  !(! $2!$ # <d!$ b<d!$ b<d!$ bX<!(!& $$ <d!$ bX<!(!& $@<d!$ bX<!(!& $$ ݢ <d!$ ֬b X<!(!& $@ˢO<d!$ ĬbP<d!$ bT<d!$ bXЎ<C!''9 F\$Ў<C!''9 F`$<d!$ bdX<!(!&h $2$ X<!(!& $2$ }ˏX<!(!& $($ qX<!(!& $($ e<d!$ ^b<d!Xb <X2 !$$ !(! $!!I3C!<C!ADD#<X!Q !$l !(! $!!$ -S#S!C!<C!$  D#<X!Q !$ !(! $!!$  #<X!Q !$ !(! $!!$ S#S!ЎC!<C!''9 F̏$S#S!ЎC!<C!''9 Fȏ$S#S!C!<C!$ ŬDS#S!C!<C!EЏF ` !S#S!C!<C!DS#S!4dd!!C!&pBCDEFGHIJK L M N O PQ&R     S'BCDEpЎ<C!''9 Fxc$Ў<C!''9 F|V$<d!PbČ<d!JbĀ<d!DbĄ<d!>bĈЎ<C!''9 FĘ1$<d!+bĐ'Cx<d!!bĔ<d!bĜ<d!bĠ<d!$ bĤ<d!$ bĨ<d!b\$ ʀ !@<840,($ 'H<'V!'P|$(! '!|$s (! ' H$b 4!D $t@ !'$&C$B&1b&1*" @!0'(!F0!& $?*@'<'Ul!'X$!!|(!$s '@&$b* |&1C$ !'$ (!P $'<'T!'د ! !P!P#$D !$Wx(!$".#X`$6$O$ $5$L$Y" ʀ  '(<'S!'LHD@<840,(\!! !$Y6.Z@$k$O $W\$s<V# ,b @`!!&% (!  !&R@&B B+@$   $  !"#@F#E!CD$YGCHIJKLMN O P Q R STUVWX_CРC'9倠CC C!C"C# Cc<C!C,b@@h@V`!!<b!&%(!  !&%(!&R'@&1 @EB+@<! !$'C#C!D!bcdefghijk l m n o pq&sBCDEFGHIJK L M N O PQt&Rbcde BCDE k!dtQ!Q#d#@C!&!C!'BCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqV&s !t$B,C`3t1tC5,b@`&!!!  !&5d !@! &5@!"+(!\&R !&s&@ 0!`0! @B5B+@XTC*@!'5&5b!b#d!BCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqU&sBCDEFGHIbcdefghi5C!C#T!'9 @6 l@!b!!!4lC!b!' (!&* @4&stC(C@$Cb$C*`&$@*`!&Rt." @#4dQ#Q!C!<C!Cd$b! !ʀ q$ʀ j$ʀ c$!b!b@$ct&* @#T!4d!!C!'pBCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqV&s#T!GDEF<W!C!$gdef'9꘠Cd Th\$ $b(!4$ 0!ʀ LHD@<840,('P<'I!'Я($ !! !$Y)!.Z@$k$O K$sh.b b b+@a!@x$b # !(! $'9 Gb5b+@G S!S#C!B68B0B@ ! x #$b5 !(! $'9 l.b@@!ʀ H$ # x4 !C! !(! $  -@ʀ *$$"`(!4$ $#<xQ !!$d !(! $t!!$'9 d$ ʀ @!($ '0<'F!'௿<۰!X X܏$' ' <'FD!'د 4'$bHBcH  '(<'E!'LHD@<840,(x(! $$0!؏4$G $(!x $$0!ď4$G $(!4菞x  !$0!48! $ď !($bBc84!d `$(` ` Q@$cH4|c $$bX$8! 444%ԏ44$ؔ%%#ܔB'%s44444)ؔ9ܔcԔħD$ 4<@>BF><#9< *95%67#6ԧ¯ȗ<%7$4ܗB<*9794(@0.@<*443  XD4^`$菈4F)%jاZ444'994$4Px444H%)4)9씄$'rLNRTl<#44B3p|D'Z%)N%P<*958`HplLrN4LN$H4&dR؏444$c$ Tc$\V444B 4`4<#9<*9\5848Z%)įБ'9R<#3<*34e04f170֯$V71*,\xhflZ\77~44TZ$B`Bc4444444'9 $%($ ) 9Bc(h dfjl4'',4p'dhG%,I`< #9d<*9795f5)5gl̯jҧԗdfp4',t444444$c4$8%<%)<$t+?q\9DctBJ8:<?@AD<<<<$t$X$XX'HKLMKB<'y%XJ<'Ԡ%%nP6_'I>4?@hAiDԗH<K'9X铨L$9M8<:<'9ܤ<<<$c'9cnP%$B+_V[cNP<<T<)ܧR$Cr'9r8fYr<}~<< 'CC&1&1!|(!$s '@&' Q`(! @!. @$ ."@$  @ !$'<'Ϡ!'௿t۰@!x @`4B@ $'C!E t܎x $Џ@$`4B@ $'C!E ' t' <'ά!'د$ l۰@!p @`4B@ $(8C!E l|'$+ (!p @$`4B@ $(C!E l$ '(<'͔!'د$ |!(!' $۰@   $ '(<'!'د$ !$$L&1&@ @ ! @ ! @(!!$ '(<'̄!'hx'!!$l(!  ! ! @ @(!`4B@$( '<'!'@<840,($ |'!!$ (!! 4C!P$t! (!(!,UH! $,,T!  $  !$CB|$>(! '`$b+$  !$CB"!b@.b$B b``< $$  !$C$$B,B@BB!S&*&1 @&R @<840,($ 'H<'ɬ!'p$)$  ''<'`!'h!$@ '$*  Џ'<'!'د$ |!(!' $  !( ̏@ ! $ '(<'`!'د$ |!(!$ '$$ 8!@  !! $Ȯ ď$ '(<'!'௿@ !ȏ<@$ Ȯď' <'`!'p$)  ''<'!'௿D!pD#!  !$ !`̏ ' ' <'Ɣ!'p$!b '$*  Џ'<'0!'௿ ! ! ' <'!'௿D!cD#b!$b ̏@$ ȏ ! ' <'P!'8į!!!! !@!@! @ !@!@`  0!T' $ @@$ @0!T' $ @@$ď'Ȍ@!@ @ @$$`!<'!'د$ !|(!'@ $$l pt$l$ '(<'p!4$C),$$4$C)@4$C)P0$CH`!<'!$-,@$$3,@$$:/$/3,@ $$ ($@&$ 4$B)d4$B)p4$B)4$B)4$B)4$B)4$B)ď4$B)̏4$B)܏4$B)쏂0$BH<'!!`B$B,$C#`!'@!X!H!8!bB %)    $' <'!'د$ !!C!h !C!B@! B$ '(<'l!'Я($ !$! @ ! @!@ !4 $@d  ! @! @ !"+ (!@ !@&1`!($ '0$( $$$$$ $`!<'L!'د $!!C !C$$$ ,@ $!$$!8#$d,b@$$b b $b  !h$!h$! h`B@4 $) @ B@ (!P  '( '(<'!'د$ L!! D L $(!|' @!@ $@ @@!$ `!'(<'!'ȯ40,($ H!!!@,!!#hC!S!B@ ! "d ! @ "b!s!b&R&B*@&140,($ '8$$$\\\<'!'840,($ L!!P !@G@!D CL @<@!$c @ !@ ! @!' !\(! @0!%B@$$$`$&#' $ X $ $|(! '@$"  840,($ '@<' !'Я($ !!"!+ @ !@ @!@ !4 $x@@ &` !P @(!  @ !"+ (!@ !@&1($ '0<'!'Я($ !1!#! @ !@ @!@ !4 $0@@ &@(!8 $*@$ B ` !"+ (!` !@&1($ '0<' !'LHD@<840,(꤯X\!!h !?!, (!@!(Ba@!"! @!d@@ ! R  !@!  !"+ (! !@&1!d܏`@ !(! ' @r &b&s&  !+@ !؏X  !\  !!LHD@<840,('P<',!'(ԯЯ̯ȯį !!!!((!  !  !@!L! ! @!')4x(!B$ (  ` ! @{$/|(! ' W$ ` !E@!$t  ${`B@F4$*0$`B@84$*t &1 1b`   !@!$ b쏙@ !@(!'( ' b!`  !$E@0! '( b&R$&1 ` !"+ @ (!!!   ! ,B !@$ $ ! (!  !$ԏЏ̏ȏď'<'!'(ԯЯ̯ȯį L䯤! !@! !#!'( @(!@! ! B  (! !ф@&1   ! "+ (!$@ !&R  !B+ @ !!'(  ! @!L ! @!')4x(!B$ ( `` ! ! @!`!$ ` !E@!$t  ${`B@y4$*%`B@k4$+ & d  !@!$ b؏쏙@ !@(!'( '菼 @Jb+(@ChC!$ D ! '( @!*  ChPC!$E(! '( ܏'@(! '( "l&R@ $( ` ! @&&| @ ! ̴ @ !# $b & ` !+ @p(!!$!`!&  !+ @A(! `!ED'ED $`!ԏЏ̏ȏď'<'!'@<8x'(!$!  !$ ! '|4$$ $$ $"I$ H$$$$D @<8'Hb@ $c(bC!<Q4cCB<'p!'د$ !40!$+H (!5$0! ! (!@@!`B@$d @ !@(!4$+d ! $@@!`B@ d @ !@(!4$+ 0!!$$ '(<'8!'د$ 4! $+'  !@ @(!`B@4 $,@)(!  !@@(!`B@4 $,X(! ! 0!@ @(!`B@4 $,$ '(<'!'Я,($ L !C䏼@!$8 !` ' @ @(!`4B@$, !Ԏ$qߘ$C@ ! !  ! @ ! ! @ !܏  !+,($ '0<'!'د$ L ! !d @!  !$ @!L @!$$$D$bP$`$c$@! ̏$ '(<'!'௿t ' <'!'<840,($ D$L! !(!x $L$P$TRXZ!4` !$($-  0!$C!e`B!E4`B!` $-$ 0! @̏& 0!4` $-,8!܏ԏ4 !$(! &fX@$;444$B-D<4$$-d (!4` !$-p  0!& 0!4` $-x(!4 !$&fX 8!@$C444$B-<4$$-d (!4` !$-  0!& 0!4` $-(!4 !$&fX 8!@$K444$B-<4$$-d (!&1*" @k&R쏿<840,($ '@<'!'௿! $@ !0 xx< xp x xD ' <'!'௿ @ !'9̄ (  !!' <'!'0̯ȯ!     $\  "$(,.0&($'8 ď  !4  '@(! $`4B@$. !̏'<'t!'쯲诱䯰௼L! !C@!$ԯ`|$,$ '|@$-$.$ ''&%(쏙$B $$| 'ď',B @ @(!`B@%4$.@x'(! !$ "Cϰ  !@@(!`B@4$. !E" "#|%" 00!'9  ""` !'9 ! $`"d! !C$b &sBD #$c&#b*@&R|$/(! 'ȏ !'9̄ !|(!$9 '̏(!$7| 'ЏЏ@$̏|(!$=b' $|(!$=b' &* @؏C+@$$$ '"L B@Ԏ%З$P`!  !@!%ԗ!  !@ !%ؗ!  !@$! ܮ"܎" @  !@ !  !@!$쏲菱䏰`!'<'!'0ȯ $ \įį "$(,0 .4@ '@(! $`4B@$. !'<'!'840,($ L! !@!p bd"| 0de0!'9  "e"` !'9 ! c$`"d`! !C$b &BD #$c&#b*@&R|$/(! ''9̄  !"܏@+$ 'L B@Ԏ%Ж&$P`!  !@!%Ԗ&!  !@ !%ؖ&!  !@$! ܮ"܎" @$"@(  !@ !d  !@!$840,($ `!'@<'\!'د$ H! D@@T @9L $D@2@ ! BD!D(L @!@!|$/(! ''9̄  ! @@ (  !@d  !$ '(<' !'د$ ϔ '@ @!`4B$/@(! !$ '(<'!'LHD@<840,(L\XP !$/(!|'  @!菙 !$t ${@!\!@!X!hC!Q!RBB@B`B@4 $/Hw` ! @(!$(!| '$$@*Ba@!!  !@(!cl 0!@8! &ddh4C!Q!D $p@t @ $b!q!b@$$X4!C!Q!D $@0 @ $b!q!b@$$X!CC!Q!C$b$菣\'&*@d&$44bL&pd$x$ !$ Pd @$ $b$48bL$ԯ$* ! $ $ $48bL !$0$* `!$b4(L !$0$ $ `!LHD@<840,('P<'0!'د$  L!! ! ! !@!( ! (!@ ! @!@!d ! !y !T8< (!y@!2 (!  !p&d  !c@8!l0!@ ! (! ' 0!4` ! $  !4L@ !$8! $s( !  (!@!+! @! !(!0! @!8!C$tTb 8< ! (!@!! @ !@(! @!  !&s  !b+`(!$@ !&1  !"+@,d  !@%$@b!P$2b`hb@!`!4d$ &1@chB"*@&s$|$(! ' (  !@$e<@ ! ' ɐ !$l ' ( $ @! $@ !$_b, ! $ @@!` !(!0`$B| $$  `!'(<'!'840,($  L!! !@!  $@ !D #L @@!BP b@b@gb@\ !(! 0!hx'($ $ '` !x$ $ '&1'  !(! 0!'('9դ @!@!$ J !' !(! 0!`8!'9ش @! R< !@'(`8! $ $|$(! ' @`0!$ &% $"܏X !  (!$ C !' !$(!0! 8!'9  @ !840,($ !'@<'!'د$ L! ! ! @!@(!D  !  ! ! @!@ !(!H @0!@!$ ! !$ '(<'!'D@<840,($ L!! !@!  $@p !x'($ $ '$x$  !  !`̏t&p ' ' !ԯ(!0!'('9դ @!@!$ "K !' !(!0!8!'9ش @! R= !|$(! ' @@ &e􏙧 0! $ܯt ! (!$ C !` $$Y !0!8!$(! $Y'( !0!8!(! w@ !D@<840,($ !'H<'`!'د$ L! ! ! @! !D@$ !$   ! ! @!@ !(!ۼ @0!@!$ ! !$ '(<'`!'8$ '%8'@<'!'8$ '$8'@<'!'د '$ (!'$ (!` $P (! '(<'H!'د t ( (!0!쏄4$G$/Ĭ@ @$8!D4|$BL $/̏ $4<$/$ '(<'!'௿  <(! 4$@@(! ((!&   !< T & D۰DL  P$(! ' <'4!(!PD <'!'PLHD@<8l$!!!0!L  !D L B '@V!d  !@ 0B !&1@@(!S>."  @6."  C$@0." hb@,!`!@@(!S @4$$@ @ !@ @$ h&1b"+@&$!@&!PLHD@<8'X<'!'plhd`\XTP|!'@$/!D (! !$t$ ${@!!hb@!`!4 $@:$@b`` ! @(!&qd  !@8!bl0! !@(! @0!' 4` $ ' b4L !$$ ' ^ `Z$bX'Dܯ@ !(!'H 8!@L` ! @(!$(!| 'LL@*Ba@  !@(!cl0!@8! &dd4 $p@ t @$@$$4 $@ 0 @$@$$h&b*@\&$$44bL&pd$x$ ! $@$b`$48bL$ԯ$* ! $ $ $48bL !$0$*  $b4(L !$0$ $ plhd`\XTP'x<'!'|xtplhd`\X! ''! !@ !(!,0! @! !$e4ɐ$l $瓬$ฯ h '!!$@S 4h $@/$| $/(! 'PP$b$`/$-$|&& f0! $=&&$f0!|(! $7&&f0!|(! $;&&f0!|$< (!* !|(!$9 'TTC(!&* @* @&&$&s$&R*B @&h2$Bv@N!bhR#$B@@!`H!"0# C+@2'(%&@8!%($ $ $%(%&(%'H $ %%'(@0!'H $ $b&R#$B*@%)$h&Rb$BB*@ ! (!'` !,4$4 $ԏ'@ !$ '؏@ !8 $*@ !( $؏`  !`(!@0!h  !x x'0!  8!x &| |' 8! 0!  ` ! @ !  !H '|xtplhd`\X'<'z@!<!4ªdbC8+4Ȫ4ª!htb !  <'y!'8$ '&8'@<'y!'<840,($ L! ! !Q@!!!!$cbB!B@.(d  ! $U)8!f`Ex0! ! $(@!bB!U  !e#"E(!   !( '!&R!<840,($ '@<'x$!'د$ d ! !$(' L  !$D(!x$@@@@@ @@@@@@ @$@ @@ @!&\(!x $$$ '(<'w0!'<840,($ d !!T ! !$d !  !R  !L  !@! !L!  !R$L ! !@! !L @!t  ! R$ꯢ444$B/<4$$0 (!|@  $dC$|` !&cbQ$c$$$(@$D  ( @ !@!T#s!S!qD$ .@$$ !$D !D !$T#S!C$b !`B@4 $0  D$D !$ (  !@!<840,($ `!'@<'t !'د$ d !! !@ !d $  !QL  !@ !L @!@!$ ! @ !Q L @ !L  !$bR$b$D#P0!P!(@$D  !(  !$ '(<'r!'诿  !<!4g$l@ !0! @ !0!4$ $0d @ !0!4$$0x @ !0!48!$t @ !0!48!$ @ !0!48!$ @ !0!48!$ @ !0!4$$  @ !0!48!$L @ !0!4$TT$ ( &$@ &$ @ !&$ @!8!4@ !$ $44$T0$@ !$$ @ !0!48!$P @ !0!48!$| @ !0!48!$ 8!4@ !$0 0!gT 4诠$0@ ! 0!4@ !$00!8! @ !0!48!$1 @ !0!4$$1, @ !0!48!$1h @ !0!4$TT$1  &$@ &$ @ !&$ @!8!4@ !$1 $4$$$2 @ ! 'P &e$'@ !4$$$ @ !0!4&gD$D @ !0!48!$2< @!@ !40!$2T8! "%`+"%cd$b'' 4`$2p $8!@ !' 0! $' 4`"% $2'&dh (!@8!@ !'  $"%4@ ! $2ȏ@ !0!4$$2د "%@ !40!$28! "%<!@ @ !4诠$30! 8!"%4@ ! $3\ "%4诠$3,@ ! 0!"%` 4诠$38@ ! 0!"% `B@4 $3D<@ !$0! 4@ !<0!$ 4ʀ  '<'j!'xtplh\! !@ !`(!< @!X\4PT$ ! @!@;' 4`$3 0! !`(! ' @p@(!  !'Pt'T@(! !'X '\@ @ !ԏX$2 '$C4$b3Bc34$$30! '4$$3 0! !4 $3䏼@4`(!4$3  !@'| !@(!$ 8!@@0!h(! '$'`$(! `` $P $D۰DL  xtplh!'<'g!'௳ܯدԯЯ\! !@ !@(!< @!ȯ̏4$ ! @!@;' 4`$3  0! !@(! ' @p@(!  !'t'į !@(!' '̏@ ` !ԏ$2 '$C4$b3Bc34$$3 0! '4$$4   0! !4 $@D۰L L $u04 ! $4<@ ! ܏؏ԏ!'<'e!'D@<840\X !@ !@(!< @!(,4 $$4T` ! @!@[` !4@(! ! $4d@@(!t' '$ !'( ',@ $ 4` $4 ' $ 4@(!$4  !@%@(!p  !' t'$ !@(!'( ',@'ԏ( !$2 8!$C 0!4`$5 '؏$ ؏4' $5 `0!$ 'J4 $菼@<'84`$5< ! `0!@(! ! 0!@@(!p  !' t'$ !@(!'( ',@  !ԏ($2 '$C4$b3Bc34`0!$5P$ '4`0!$5| $ D@<840!'H<'bD!'D@<840\X !@ !@(!< @!(,4 $$4T` ! @!@[` !4@(! ! $4d@@(!t' '$ !'( ',@ $ 4` $4 ' $ 4@(!$4  !@%@(!p  !' t'$ !@(!'( ',@'ԏ( !$2 8!$C 0!4`$5 '؏$ ؏4' $5`0!$ 'J4 $菼@<'84`$5< ! `0!@(! ! 0!@@(!p  !' t'$ !@(!'( ',@  !ԏ($2 '$C4$b3Bc34`0!$5$ '4`0!$5 $ D@<840!'H<'^!'\XTP$! !$C1 ! @!4@*@ ! @ !' $2'쏙\@$ L@@ !  !( @!b#p!c$$bC\XTP!'`<']!'HD@`|MLJKIǸHG EDCC LJ$M\KxIHG̬M@ED(! $(!'| $t  菄<  '(ԏ$BP($B#ܯ,$B!(0$B)4$B&08$B, < &$@!d &$䏅ش &$t &$T &$&$  (!$$b  2$d <  t !0!&$ (!6  (!6 (!$P $!HD@'P<'Z@!'p!DD $@! !$(!x $$p$trxz4`0!$5 ' 0!'04` $5" ԏ4D !$:X'  8!&@ *`B@$ݯ4b$B6`ԏ440$؈ &&8@ `B@$寢4I$B6<044$, &&8@ `B@$40$B6\\44$ &&8@ `B@v$4$B6􏅀44$t &&8@$`B@^$4$B64<4$6N$BR!ԏ44$$ &8@ `B@?$ 4/$B6<$@4"4$ּ &8@ `B@&$|4"4$` &8@!`B@$4$B6\4<4$6؏4(! $6䏼<4B'<'V!'ȯ0,($ 0! "!D '@ @(!`B@94*$6@1(!"!D `0!@ @(!`B@"4$7D"!D $@@(!`B@4$7 &R *B"!B&R*B@!0,($ '8<'T!'௿(! !@ @(!`4B@$7 (! ! 0!@ @(!`4B@$84 ' ' <'S!'840,(|!! $(! 'b@A!0B" ! ' @ b$(! ' @!\B"'p !' @0!@@0!$} (!%B"'p !' @0!@@0!$  (!%c$b,$b"&'p !' @0!@@0!$  (!%@!d ' @ b$(! ' %  !840,('@<'Qp!'@ |!$!! ! '@!x !(! $'( $` @ `B@E4>$8 @ !@(!@0! '( @ `B@/4($8'(  (! @ $`B@4$8询$ ! 8!'( $` @$ `B@4$9 !C$'<'O!'x|x|!$ !Y'$\ @!@ '`B@<45$8' $@  ! (!@0! '@'' $@ @(!`B@4$8 '@$`B@4$8 !C$|x'<'M!'ȯ0,(|' (!! Ӡ $ &|$@9(! '$$| (!$$|(!`&$b$ $(!| &$ ӠP$@(! @'$䏙44 $"0,('8<'L!'௿@! ' <'LT!'௿ӠP(! & !P ' <'L!'د 䏙4'4$  '(!!@$B0B,B @$$<'K`!'Я($ !!@&!,` !  (!@ & (!P @ ! @ !B!$P&, ` !@($ '0<'Jp!'௿4! !C!gdef c ' <'J!'840( !(!'P @!L 'q#b!b840'@<'Ip!'<840(! !(!'P @!L 'q#b!r<840'@<'H!'<840(! !(!'P @!L 'q#b!r<840'@<'H@!'840( !(!'P @!L 'q#b!b840'@<'G!'840( !(!'P @!L 'q#b!b840'@<'G !'840( !(!'P @!L 'q#840b!'@`<'F!'840( !(!'P @!L 'q#b!b840'@<'F!' دԯЯ̯ȯP!' !!  (! !L 'Dp @! !`(!D$@  ` !$@(!|$sC ' @p ؏ԏЏ̏'<'D!$ <'D!'LHD@<8P!!' @(!L '@ !( @!@!l#8BSH!$c2D@ !$%%0#"P4B%%$"P4B "P#S!P'04B'4 P&$W\@8!00e DLHD@<8'P<'Cl!'ܸ#@#<#8P(!! 'L ' !( @!%'0|$W @!#00!8!P#!Q!c0B$0!(b $Ў%$V '#0믥#0#@#<#8'#H<'Bp!'<840P(!! 'L ' !( @! !| @!R#!& $W<840'@<'A!'840( ! (!'P @!L 'p#b!fP$dЌE$0$fP$F $Fԏ  !840'@<'@!'`\XTP (! ! '(`(!P @! L '(@!P#" !$ @DH@B$X '@$ B,.B@.B$B$&@$ |% 'D D%$BH@b$|% 'DD @$BHH%$ 'H  ` !DH b3 @ !44($9$9 $  @! D @ !  @! H @ !  8!`Td  D@H@ $$H@$(! `\XTP'h<'>!'P(! 'x(!` !P@! L ` !@!#R!B@G' @@!`dB@ ` ! @(!0!4 $90#!`4r!dHLdhLlPpTtXx $(|, B ! '<'<,!'쯴诳䯲௱ܯد( !(!'P @!L ' ! @!@!P# ! !@!$b&&@ !(! $'0@ !(! $'P@ !0`(! $@$F|& !$F 0!` !4 &E9@ ` !4 $:@$ ! &E9@!4 ! $:@  !( $8@$< ! $H@ !( ! $ȏ@$'(! ! $2@  !!$d+@$ cb $ $+@C'&E9  !@!4 ! $:@ !4 $:@  !4 $:@$|$ $ 'ȏȏ@ @`4$b{Bc{"#D !&%) $4P$bTDEFcTB$$##%%"&&'C!E &$H"4B'"$b  !D& $@ !&ݏD $PC!E &׏#44c#$TBT"L$H  ) # H"84B "<b4cMC''Џ "@̏̏ ! "쏴菳䏲܏'<'6!'HD@<8(! !`(!'P @!L '@!'0'4 q#8@r!00 D<b4cMC` ! H$8 <b4cMC#!H` !C# L&(!x $HD@<8'P<'5T!'PLHD@P!!' `(!'L $23@! $"]` !` ` !R@!$b'0| $K0$B$K'00|$M '44$B4$M'4 ` !1(! ` !Q@!$b'8| $J8$B$J'88|$L '<<$B<$L'<  ` !$ PLHD@'X<'3@!'د$ L! ! !p#b!rL !q @!&B,B@ $8" !  $B $$" !$  '($ '(<'2L!'<840(! !(!'P @! (!@0!ͬ '<840'@<'1! <'1!'د |(!' $  '(<'1\!'௿L C$b $׀`$$b ! @ !!' <'0!'@<840H!! !$ B$   ! (!'P @!$,@(! '@$$$%"bB $ b@$  !'9E (!B@(!P (! 'L ' @ !@(!@<840!'H<'/!'LHD@0!4`!$:( ' '( !` '8 !04$H $ !(! ' @ !44L$d$ 8!   !  !LHD@'P<'.!'د$ !4\$t$! !@#@ !$db0!$0B,B @$B$0B&,B@&$_$$s$Z$$ol0!$T$4\$ $\@L$4 ! $x@ !$@$4\$ $@ !$5$4\$| $@ !$*$(\$O  $@!$4\ !$ $@ !$$<\$64 $@ !$ $4\$ $@0!$$"4@ ! $@ 0!4\$ ! $@0!$ "$$ !'(<'+!'PL!! ! !@! $ ! @! ! @!` !$4\@!T $d@'  !V  !4\$x $@ !4\$t $@  !4\$p $@4 ! $04\` !$ $@  !$C !8\$ $@ !4 $ʘ !4 $Џ4\` !$t $@ !4 $透x' !(! $l8!` ! (! 0!$b $$d! @ !$b$B@$$$$4\` !$ $@$4\ !$ $@$'(&E $T$%` !4\$ $@ !<\$64 $@  !@B@ B@'(&E $T=  !@6$ b$  !$C p  !CC$  '@@(!`B@4 $:0 $ $b$ ''<'&!'௿$! $$ 0!C !! '  ' <'&p!P!H!$B,B@!@1$ 0,$b0$Fc0B"&#C$b,B @$b$b)C$b,B@$bNC$b$$sC$b$o$xb31X!4$CdBcD$,@X!$X!4$CdB 8$C*dB*4$CdBc`!<'$!0,^$0%0IjG ^c%b,B $@ $*b$#$s$#b$o$xb !!&&$,B $䬠@$ $*$#$$#$@0!!<'#!'ȯ0,($!'  !$  '0,('8<'#,!'@L! !! !@!B' $ $$ "=$ "d!0!&& $ $  !!d @(!`0!L !@A8! & ''"+0!Ҕ@(!`0!@&1@$*$0!&& $ $0L @$BP!`􏙔& 0!@!!`!'<' !'HD@<8L! ! !@!$ $ $H$$ !*!@!8!  !H`bLb*@D!`f +`0!H!B@@F+`@0!H!&*$ @% $"!`0!&'&h $ $%  !ph @=$#,((,0 $ @!($ 2R$֬ @`0!!&'&h $ $ 'l  !3@!( @,!!  !@!&&`0!&'&h $ $%  !l  !$*@!HD@<8`!'P<'|!D!cD#C!b@(!$$c$b$@$c$8<'!'8$$  $, @$$ $(( '@@(!`B@4 $:l$,8`!'@$<'P!,@4D$cC!B\!@4%L$bBc4$bPBcP %Lď4$bDc%Lď4%L$bBcdLď4%L$$E F$B&e 4%L$b4Dc4B:4%L$@EFG@B eLĬfgEb 4$bhDch#%Lď4%L$HE FHBe LĬf2b0$brDcr%Lď4%L$bXDcXBL!4%L$bАDcЌBL4%L$ܔEFG܌B eLĬfg b (D$bDc$LĬDLďD$BL<'! !<'! !$"$},@ $$4,@$$$>$]$$,@$$  4@$$@$@!$4`!<'$!'௿\ b!$' <'!'د \! $@ !BD+@!#d+`!$ '(<'L!'p|xtplh!!H'X'\! !@XX\ ' @(40$`,$:$ 'H$ @ @!0$SH8$S L$S $"  !0$RH8$R L$R퀏|$(! '``$b$'9@  ` !@F!4(!$: !'H: '9@  @ !$CL@!$R퀏4`$U:@'X!` !$T@p(! 0!! 'X(!@ !! 0! ! (!,C$b'H4(!$:ď8(!$C@ ! !|xtplh'<'l!'PLHP'((!!  !L  !'@$ |$ @! ! ' @' $&$S8!@ $ H$ PLH'X<'p!'|xtplhP!!'(! !L ' !4 @! 7@!5(!x`0!`1 ! D4 $ !@(!X `0!" ! (!@`0! '0 !(!R$2 hR  !  !@(!X `0!|xtplh'<'!'Я,($4 ' '${@(!|' @!4'b'  $|(! '(!${ '4,('0<' !'xtpP( !P (!'XP @!PL 'XPp# ! FC! P@A@8!4C$&$:b9$@BCGCCCC C$C(C,C0C4C8C  $ @&` (!$ d$   (!@ !($)' $ @ @  (!` (!$ & @ !d$  &@ @ !$ b$ $0 $$ b$ $$$ b $ (!0!'X'9\$ b'9  !$䯣䏙诣ԯЯ 'Џ ' <'!'h|xtp|' !X$BZ` b' 쏙\ &@S@!L @ !@L@!'` !'X 0!`B@ $ @0!$b $b$b (!4$E=ȏ4$E=؏4$E=4" $=䏼$C,b@4$ctC!B\!@ !@(! 0!#'9hjpr#$d,b@$ $b b_$ b$<$ $|$*(! 'x(!'L| $"$*$DQ!C$'9  !   ! #Bb!b0B@$*xsL$b '9  !$C '9$  !@@  !'9 @ !W'hy'p#$d,b@$ $b be$ b$<$ $|$*(! '(!'P| $"$#$DQ!C$'9  !   ! #Bb!b0B@$#bI'9(  !@A'9  !@ !$"(B@@$"P$b&$${'' !(!  0!@@ !L(! 0!ͯ#$b ,b@`$ bh$ @(!"$0|(! 'T5$K@?!|'$B`(! 0!$2(!| 'X@)(!\ &@"L @ !@!D"$ Xb $ $C$ <<$  &sb*@<$ $ $ $@ 0 $$ 1$ @ "@T@8 @ @ 0$$H $ $"@H @$''" !(! `0!@N@ !L(!`0! 8!$D""@!0!D0$b@$$b@$$B׏D '"&*@0!|$*(! 'H #Bb!b0B@$*Hb$DD$' L$  !'9 @!$ "(  ! !@(! 0!'9 (!0! @ !  !  !"$C,b @4$cC!B\!@0$|3$"$ C@"C@0$  !" $#$d"@"D` @(!$ ' 0!'9  !|$ "$/(! '\\0  !;x&$(! $( $$  )#$bi@(!$ '9 &&@a$ $$Y"#$bU$ $"48L@ !$$* 8!B|$(! '``@8 `%@d#d!E#b+`)|$(! 'd$bd@$#$b$ b|$(! 'hh@$" $b$""|xtp'<'!D$$MЬMЬ` ``<'!'د$ Dx(!&M ! $ '9 $D4؏|$BM询$>@$Ő$ 8!$ !'(<' !'௿D۰&MЎ ` !' <'̴!'`x'!!@ !(!! $l$&$@ !  $$(!'($T $4B$  @ !DMЏ$$M$'d dd<'˴!'pD0!$CMЏ4BM (!$>H!b@b$B,B@$%$  ''9  `B@$! !'<'!'p$($ '!'<'ʈ!D(!$M!,@ !c$b$M&,D!<'8!'د \ ' +'(<'!'د \ ' 8B,B'(<'ɴ!'د \ 'D$CMЌb@ !b @$b$b$ !'(<',!DBM8B,B<'!DBM+<'!DDM<'!DBM<'Ȭ!D@M<'Ȕ!'௿  @$DEM0`4B$>x@$ D$DM  ' <'!'௿ !D @'D۰$EMЌC$P$@  ,  !' <'!'௿ !D @D۰$CMЌbP(%P$@ d e,  !' <'@!'د 4'$bBc  '(<'!'h$  !D$&"M!b@" ! `$@ ! $$C !$ '  $C'$  &*@&"MЌC $b'9 '<'!'`D!&pMЏ4$ 0!$>b! Cb0(!@$'  '$ $qM'9  `B@$! @!'<'!'௿ !  ! (! !@! !`! ' <'T!'|xtp$!!.@$$:@! $@!D$&$MЌbC'"MЏ$%$ "M' د '9  $D$$MЎ#b"CMЏ' '9  $$"|$1(! 'hh$b@!D$CMЌb@@!b@@!"@&0!|$1(! 'l$!'(! $T $$S0! 8!!  !@:$lb`$b$$  !@ $  !$C D$$BM!C$ l$b$b$  !$C D$$BM!Q$  '&*@ !$  !D$cM(!&$C*$D$$BMЬC CCDCM$b'9 '9 @!$@!|xtp'<'P!'<840|!!!$' (! !P  (! !ͨ @(! !0ͨ $  !ͨ '<840'@<'!'د  x'!!` !(!$l ! $'E@0! $Ù$ !|!$  ` !@@! !@@0!!E  ` !@@@!$䏿  !'(<'T!'௿$ @$4$@ $'9D @ @!`4B@$> !' <'!'௿$ @$L$/,@ $'9D @ @!`4B@$?( !' <' !'h!$ @'䏙x !(!@$l  $|   !@!䏿`!'<'`!'H$i!.@.$o$k@i.@$_$cD@b!b!&0Mp!b(@Vb,@Rb0@Nb(B@Id$۰ @D!D!P!B@< $$b$#$b$*$b)&&&1M|@C!C!Q!C(!'xC!D$X@C!C!Q!C!$cCD@!!$BM! !!C$#b$!$@x@!|(!'  $Y@r!D!' &M ! !@0!\ ' @6'' 8!' $ $, ! $-@@!r!R!&M\C!` !(! 40#@ ! &0!(!\` ! 00#@q@@R!DR!$cMC!Ctb*@xC*@@R!DR!$cMC!Cxb$@D@R!R!D$$BMb!`40"PC#'(!"  !(!DP$M d !d$ C p@$hC 8 @ @@ !D$Me(! 0!@ 4, x&*@<@ ! $@$'|(! '|@C!C!D$cMC!D$܏| D@b!b!&QMq!p( @$0@b!b!q!p, |(! '@)8 @" @0$H $@C!C!Q!P0@C!C!Q!P, @H @&DM$@C!C!D!F0$@C!C!D!F, $$@G!DG!4$cN|C!$?d $ڼtD@D!D!$pMP!B,@֬ x(!@C!C!P!@$@C!C!P!@(@C!C!P!@,@C!C!P!@0 @ ! !D $BM !@C!C!P!D$'۰ @C!C!P!`D$ @C!C!P! @$  '<'!'د $ ' '(<'!'x$'9p ''<'!Dx(!$M $h<'d!'د$ !$D۰&1$BMB!$&R4@ @ ! $` !D$  '(<'!@D!DD!$cMC!B(<'!@d!Dd!$BMb!$b0b(b,<'P!'௿$! $@ $$C  $$C !'9p '  $$C ! ' `4B@$?l ' ' <'@!'840,($ <!b!!!!bd@.pd W' @#$!!&1DD4l$BN`! !$Nd*"(! !@ &$b@ @&1&1$"&R&R@!&R*B &st@&t$840,($ '@<'!Dx(!$N` $H<'!DD!$cN`C!E<'!'Я,($ D!! !BN`P !&CN`&1*"@$c$bP$"`B@1(!4 $?(L  !@ !Q!&BN`b!B@`@DP(!$Nd d !`B@(!4$?  0!,($  '0<'!'840,($ $! !$(!|'8B ,R! ! <b!bd@ b @bT&* @$ct@ ؏'9ݐ $@!$ ؏'9ݐ $ @!$$  ((#(0(!4lb!((! ! 0!ʀ  !840,($ '@<'P!'௿ !p!D$BN`b!` ' <'!DbN`D (!$cN`$(@$c$bD$!De!$BNdb!`!<'|!'Я,($ ! !!!DD$BN`"!P$Nd%(!&R !&1$ @*B!*B@ `!,($ '0<'!$$bB <'P!'௿L C@ !C|$bB(`d ' <'!'ȯ40,($ 4!!$T?!% @ !@ @!@ !4 $?쏼@@ & @! @ !"+ (!@ !@&1,b4L&pd$&G $$?$  !   !c8!4L !$? $ b !4L&G $$@  $b !4L&G $$@$ $b&G $4L !$@< $c$44L !$@T$@l $c$44L !$@|$@ $c$44L !$@$@ $c$44L !$@$@ $ 40,($ '8<' !'TPLHD@<8L!!! !$|(!'  @! @(d(! !$|(! '$$@d  @ @ !؎ "+ (!$@&1%#$ bf8! $y@ !@!4 $@̏@ !4 $H@ !'9 (!df$t ${$(!'(8! @!(!ܯ', 8!(,C*@ % @ ! @ ! @ !%@ ! $(!| '00@$$@4B%l&Qd$/ !$ B4l !$/ $$B44L&Dd$x$ $$p\Xb\ ! &ep\TPLHD@<8$'X<'h!'ȯ0,($ h$C!T!B!!! !@! B CC!T!B"@ ! B菿0,($ '8<'\!'\XTPLHD@<8 Llh` ! @!'4x(!B $   ! @V!h @O!( !(!(,0 4 @ !@!d ! (h ! 0$0 (!@!B @l$y#bH$tl@dX @]洏4  !  !(!L @!  !&@̏ @! @H@ !4 &H @@8!f ! $y @ !&@̏ @!  ! &H  !'9  (!" (,Bbb${#b'8`@ !(!' '( @0!T`@8! (!# 0$b4b"c`B@4 $@ԏ 0!8! ! (! @ ! (! @!   ! &؏0 + @c'h + @S(!|(!$ ',, "4$,b ،l'90 ` ! 0 ؏(` !'8'9hl ' ( 4@ ` !؏(Pl'8'9h 'V!،l'90 ` ! (0 @ @!|  ! ̴ @ ! b ( ! '8 @!$|(!  0!  8!< !  (!ɐ !$e $l ( &$ @  &$  !`@(!0` !$B| `X &e $\XTPLHD@<8'`<'0!(!$ԏDDN <4B<'!'Я($ !! !&! @$ 􏙪(! ` !&1@&ʀ !$ "+X@R#$ D !`(! $ʀ 440$D($D $N$($ '0<'!'LHD@<840,(!! !@p#ʀ$B b !   440$D($D $N\$      !LHD@<840,('P<'l!'Я($ <4C$!+!|'$ &(!  0!"(!b$ $< @!@0!$ (!  %!#!($ `!'0<'t!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'d`\X<4C$!8!!&!$'h ! !|(!`! @0!$ (! @! $ ! '@!  !@!d`\X`!'h<'!'Я($ <4C$!+!|'$ &(!  0!"(!b$ $< @!@0!$ (!  %!#!($ `!'0<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'d`\X<4C$!8!!&!$'h ! !|(!`! @0!$ (! @! $ ! '@!  !@!d`\X`!'h<' !'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'H!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!(!$DDN <4B<'!'Я($ <4C$!!|'$~(!  0!$~b (!  @ !!!($ `!'0<'!(!$,DDN <4B<'x!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<' !(!$ԏDDN <4B<'!(!$ЏDDN <4B<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'Я($ <4C$!!|'$(!  0!$b (!  @ !!!($ `!'0<'!'\XTP<4C$!!0!|'(!+$  !h ! '@! '@(! @!0!$@(!  @ !@!  !@!@!\XTP`!'`<'!'\XTP<4C$!!0!|'(!+$  !h ! '@! '@(! @!0!$@(!  @ !@!  !@!@!\XTP`!'`<'!'\XTP<4C$!!1!|'(!,$ h !  !@! '@(! @!0!$@(!  @ !@!H $0@!@!\XTP`!'`<'!'\XTP<4C$!!0!|'(!+$  !h ! '@! '@(! @!0!$@(!  @ !@!  !@!@!\XTP`!'`<'!'HD@<8!!!<54B20 !@!@(!' !h @ !@(! '@&* @`!%$ !@ '@ ! '@!`!HD@<8'P<'|!$$b$dB b+@$`!<'$!'@<8<4C$!!8! !h' !@  (!`!  (!@0! !  ! ! '@!@<8`!'H<'X!'HD@<8!'!%$O\(!@0! 8!@!0B@ 440$DL$D $N</4BB0B@!440$Dl$D $N<4Bp" $Bb" @(!@ ! '' @(!@" &+!HD@<8'P<'!'tplhd`\XTPx!|'(! $  !04 $D@h @ !<C%< H89:;DH@8/90 !"#$%&'()*+,-.123:;|4<56@ 'tplhd`\XTP'x<'}!'௿<!4g$(!t$OC0! 8!!' <'}T!'௿<4C$ 8! <0!|4C$J(! !`!' <'|!'௿<4C$ 8! <0!|4C$K(! !`!' <'||!'د$ <4G$!!<|$J(!'`4G $K(!| '8!C#$ !'(<'{!'௿<4C$ 8! <0!|4C$L(! !`!' <'{d!'௿<4C$ 8! <0!|4C$M(! !`!' <'z!'د$ <4G$!!<|$L(!'`4G $M(!| '8!C#$ !'(<'zL!'௿<4C$ 8! <0!|4C$J$ !`!' <'y!'௿<4C$ 8! <0!|4C$K$ !`!' <'yt!'د$ <4G$!!<|$J$'`4G $K$| '8!C#$ !'(<'x!'௿<4C$ 8! <0!|4C$L$ !`!' <'x\!'௿<4C$ 8! <0!|4C$M$ !`!' <'w!'د$ <4G$!!<|$L$'`4G $M$| '8!C#$ !'(<'wD!'Я,($ $!!<4B!<4B|(!$J '&*`"!Q!,($ '0<'v!'Я,($ $!!<4B!<4B|(!$K '&*`"!Q!,($ '0<'u!'ȯ0,($ $!!!<4B!<4B|(!$J '(!$K|' &*B!`"!Q#b!0,($ '8<'u !'Я,($ $!!<4B!<4B|(!$L '&*`"!Q!,($ '0<'t`!'Я,($ $!!<4B!<4B|(!$M '&*`"!Q!,($ '0<'s!'ȯ0,($ $!!!<4B!<4B|(!$L '(!$M|' &*B!`"!Q#b!0,($ '8<'r!(!$جDDN <4B<'r!(!$ďDDN <4B<'rT!(!$܏DDN <4B<'r!(!$(DDN <4B<'q!(!$DdND0B bN<4B<'q!'௿<4G$!@!0!$ !| (!@!  @ !`0!$ (!8!!' <'p!'௿<4G$!@!0!$ !| (!@!  @ !`0!$ (!8!!' <'pD!'Я,($ !s!@o '@0!'X  (!  !B!3@$*$# CC!B0B@G$' Bb!b0B@&$*5$  !B!+@ !)$&$$*b$#b ' Bb!b0B@&$*$  !B!+@ !$,($ !'0<'n,!'د 8!$(!|'$$$$ l ''0 $ '(<'m!'Я,($  !(!! !$ (!| ' !D@(!@ 0! $ @ !0(!   l ʀ ,($ '0<'l!'ȯ40,(, !@<<B4BuC!F$   (!$  (!'< @!%<@$"-$$ $  '<$ $ $ '  %$$ |' %$ ' 0!$$ | '$ ' $$"-$ $ $ '<$ $ $'  %$$|' %$' 0!$$| '$' $$ 2 $ $ $ $  ' %$ " $| (! ' !' 0!2$" $| (! ' !' $&",B@ (!|' $ !'$Я $  (! ' %$ " $| (! ' !' 0!&",B@$ |$ (! ' !' $$ "$" $| (! ' !' $$",$$ $  '<$ $ '  %$$ |' %$ ' 0!$$ | '$ ' $$"+$ $ '<$ $'  %$$|' %$' 0!$$| '$'$   !!40,('8<'g4!'|xtplhd`\X!!@!, @<4Bu ! (!@ <4B4 $쏼<4B@ ! 'H@!@(!X ! @0!0!'P!#+0@(!`8!$ *$#$&1I'0+H!$dE!`C!F$  (!@!' ͨ$*  ! @(!$4ͨ ! $@ͨ$#'( !@(! ('0 !<ͨ@(!$bBc!2 0 !4ͨ '@&",B| (!'@%$  ' @!'C0!C!B'0B@@(!4 @q&1*"@&"󏙎|$(! 'PP@$ (! ! 0!' $(! 0!b%$ $ !(! $0!$ (!b%&,B@$ !(! $0!$ (!b%$8$P'8(!  ! !'@ͨ '@ !P '( !ͨ '@$  (! 0!$ (! $ 0!$ $ 0!$$  b%b%$7'8P ! '  !'@4ͨ &E@ !P '( !ͨ &E@$ (! 0!$(! $ 0!$ $0!$$ b%b%' $(! 0!b%$  $$(! '(b%&,B@ $$(! '0b%$+$P'8(!  ! !'@4ͨ &E@ !P '( !ͨ &E@ 0!$ $ 0!$$  b%b%$)'8P ! '  !'@4ͨ &E@ !P '( !ͨ &E@ 0!$ $0!$$ b%b% ` !!|xtplhd`\X'<'_|!'ȯ40,($ !!$` ! !@J<C!F$   (!@!!|'@(! $' `(!@(!$|@'%Q# ' `(!@(!$|@'$Q ' `(!@$Q &R4 $쏼<V4B&R*B@$ "$  !`(! 0!$ "$"&"4,B@$"$( (!$ `0! (!`0!!$$<$ (! `0! (!`0!$$ (! `0! (!`0!$< 4Bu %%  !!40,($ '8<'\!'Я,($ |!!$(!! ' !` (! $ !b@0! <4B,($ '0<'[!'TPLH, !@\<x4ButC!F$  (!@!\@A$|\$ (! '@@@.' |$(!  0! @$4"$|$(!  0! @$ 4$| 0!$ (! @$ 4$`4$ <+4B$ (! '\$(!|' B% !' 0!$$|(! ' !' $ @ !!TPLH'X<'Y!'Я,(!$ $  !(! $ $  !$ &,B ! &@$ *@$ ! (!'|@$$ (!' $(!'| $(!' $(!$| '$$(!$ '(!$ '(!$| '(!$ '(!$| '(!$' &*@(!$ ' !$ |(!$ '  !' 0!$ $|(!$ '  !' $&,B|(!$@ '  !' $&*@$ !,('0<'V!'௿<4C$8!!0!D ! !|(!@! @! $!`!' <'V!'௿<4G$!@!0!$ !| (!@!  @ !`0!$ (!8!!' <'Ud!'@<8<4C$!8!'!% !h' !|(!@! @0!$ (! @ !  ! $ ! '@! !@<8`!'H<'Tx!'@<8<4C$!8!'!% !h' !|(!@! @0!$ (! @ !  ! $ ! '@! !@<8`!'H<'S!'@<8<4C$!8!'!% !h' !|(!@! @0!$ (! @ !  ! $ ! '@! !@<8`!'H<'R!'௿<4G$!@!0!$ !| (!@!  @ !`0!$ (!8!!' <'Q!'௿<4G$!@!0!$ !| (!@!  @ !`0!$ (!8!!' <'QX!'<8<4C$!8!<(!|$ ' 4C  ! '@!<8`!'@<'P!'Я($ $!!<(4CDBN@!@, @!DBN@, @ |(!' $ ,B !($ `!'0<'O!'@<8$!!<14Bh !'@(!X $ !'0!'9/H 6DBN@, @ !0 $H| (!$ ' !' @<8'H<'N!'@<8$!!<14Bh !'@(!X $ !'$'9/H 6DBN@, @ !0 $H| (!$ ' !' @<8'H<'M!'@<8$!!<14Bh !'@(!X $ !'$'9/H 6DBN@, @ !0 $H| (!$ ' !' @<8'H<'L!'௿$!!<%4C, DBN@! @!@ DBN@|(!`0! $ !`!' <'K!'<840!!!<4B|(!$  ' ! '@$&.@$<4BP!<840'@<'J!'ȯ40!<(!|'4B $   !P '!40'8<'Jp!'HD@<8<!4B!3!0 ! h@@ ! @ ! '0@!0bc'$x$ !b(! d (!@!@ !@(! @! !HD@<8'P$b$d(C`$<'I!'Я($$$)<*4B<FX4BS<FX4BO $H$b,Bc,P' ! '! $!$!('0<'H!'ȯ0,(<4P!! ! @(!'  !' @!!!0,('8<'G!!!$@(! `0!<4B<'GT!!!$@(! `0!<4B<'G!'<840,(!!!<F4BCq !@#!x' !(! $ (!0! !h  !@ ! (!@&1."@@!c$b'x !(! $e ! 0!@@! ! (!@!@!<840,('@$b$d(C`$<'E\!(!$DDN <4B<'E!'TPLHD@<84D$$VB48,4$Q&(!,$U; (0dN$0 $@ @!440$D$D$N @0! dN<$(! $@ @!0444$BN$D$D$DdN<$ٔ(! $@ @!044$BN$D$D 0!ݯdN'(<$ج@(! $@ @!0444$BN$D$D$DůdN$@(! $@ @!0444$BN$D$D$DdN@(!$ $@ @!0444$BN$D$D$CdN$((! $@ @!044$BN$D$D0!dN$'0 $@ @!044<$BN$D$D$ƽndN$(! $@ @!044$BN$D$D0!YdN$,'  $@ @!0444$BN$D$D$B CdN$'  $@ @!044<$BN$D$D$-dN$'  $@ @!044<$BN$D$D$k dN(!$ $@!!0444$BN$D$D$@ 8!!TPLHD@<8'X$ <'?! $B !<$b$<4B($!<%*0 %<%<4B0$<0"$C$<4B $!<'?L!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'>!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <'>(!'د$ !4!$J !@!<4D$" ` ! !@(!@! @ !$ !'(<'=|!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <4G$! $<4gu$C!8!!<'<!'௿!<4E`8!$`0!$0 !| (!@!  @ ! (!(!!' <';!'د$ <!4C!8!$$3'|(! $3(!'  @ !! '!$ `!'(<';,!'د$ <!4C!8!$$3'|(! $3(!'  @ !! '!$ `!'(<':h!'௿!<4E`8!$`0!$/ !| (!@!  @ ! (!(!!' <'9!'د$ <!4C)8!$&$2 (! !|'@! $2(!'  @ ! ! < !$ `!'(<'8!'௿!<4E`8!$`0!$4 !| (!@!  @ ! (!(!!' <'8L!'د$ 0!BH$<-4B$b$*(!'$*$Bb!f(!  @ !!|$*(! '$#b$*b$$!$ '(<'7D!'د <!4C8!G!$D' ! !(!|@0!.'@! (!$􏙲x@ ! @!h  ! !@(! $ @0!(! $5 @ !  !`! $5 ! 8!(4F4 $@!`! `!'(<'5!'د <!4C8!G!$D' ! !(!|@0!.'@! (!$􏙲x@ ! @!h  ! !@(! $ @0!(! $6 @ !  !`! $6 ! 8!(4F4 $@!`! `!'(<'4T!'Я($ <!4G!!$|'$b(!  0!$b (!  @ !8!8!($ !'0<'3!'௿<4C8!$ <0!|4C$(! !`!' <'3 !'د$ <!4C8!$ <|$(!'4C !$ `!'(<'2!'௿40!4 !$D$N` $Jԏ`D`(!$t ' @! <4B' <'2!'௿!<4E`8!$`0!$# !| (!@!  @ ! (!(!!' <'1|!'د !<4E`!$h (!` !! 4Ĭ !@(! $2 (!4Ĭ(! ` !@! (! !'(<'0!'௿!<4E`8!$`0!$% !| (!@!  @ ! (!(!!' <'0 !'௿!<4E`8!$`0!$& !| (!@!  @ ! (!(!!' <'/!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'.!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <'.`!'Я($ <!4G!!$|'$b(!  0!$b (!  @ !8!8!($ !'0<'-!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <',!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <',`!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'+!'د$ <!4C)8!$&$1ؤ(! !|'@! $1(!'  @ ! !  !$ `!'(<'*!'௿40!4 !$D$N` $Jԏ`D`(!$@ ' @! <4B' <'*l!'௿!<4E`8!$`0!$' !| (!@!  @ ! (!(!!' <')!'௿40!4 !$D$N` $Jԏ`D`(!$P ' @! <4B' <')H!'د !<4C !$<4C'9L b!b!b@  !bxC!E @!! `!'(<'(!'Я($ !!$<34B'9L @(!#$B(b!f $; @ !!|$; '!$c(C!E '@&.@0!($ '0<''`!'د !<4E!!$'9L @(!0! !| $<`!  @ ! $<(! !'(<'&!'د !<4E!!$'9L @(!0! !| $=`!  @ ! $=(! !'(<'%!'د !<4E!!$'9L @(!0! !| $7`!  @ ! $7(! !'(<'$!'D@<840,(!!8!7< !@:'x(!$  ! ! ! !h @! !@(!  0!b@ 'bxC!E @*B &R*B @&s$*B @<4B'9L$ @ !؎'9L b!b!bxC!E  !@!!D@<840,('H<'#0!'د !-$! '9L$  !"'9L $P* @p!$Bb!$bD$c$&* @* @$"" '(<'"@!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'!!'د !<4E!$'9L @!<4E,b@ !$cC!< 4Ee  '( !'(<' !'Я,($ !!$<)4B'9L @!,B@$:<4B|(! '@"b(! 0! $: @ !!#!,($ '0<'!'@<840,(!!5!4< !@7'x(!$  !` ! !` !h @! !@(!  0!$cC!E '@*B&R*B@@<4B'9L$ @ !؎'9L $cC!E ` !@!!@<840,('H<'T!'د !$$(!b ` !'9L $E( $'9L$ !"$"" '(<'!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'$!'840,(<!4C8!V!$S'x ! !(!6$  !<! !@C4c (!$x@ ! @!h  !@ !@(! $@0!(! $ @ !  !`!@! $(!| 0! !8!(4F $@!`!840,(`!'@<'p!'௿40!4 !$D$N` $Jԏ`D`(!$@ ' @! <4B' <'!'840!<4C !$<'(4C'9LH '',L, '( !@@(! @!!840`!'@<',!'d`\XTP!!HX!W< !@9'x(!$  ! @ !@ !h @! !@(!  0! @L'8'HL 'L@!'@@(!"< (!؏H'9L0 $b؎d'9LH 'LH'(L'H 'L@@ ! @(!@!<4B!d`\XTP'h<'`!'840!(6$#',$L'b0! '( !@)$؏,'9L0 @! "'9LH ` !''(L', (,'(L' ',(!@ $؏('9L0 $"@!840`!'@<'D!'௿40!4 !$D$N` $Jԏ`D`(!$ ' @! <4B' <'!'௿!<4E`8!$`0!$ !| (!@!  @ ! (!(!!' <' !'௿408!4 !$D$N $Jԏ`DD0c(!CN$ ' @! <4B' <'!'د <4C!$hD ! !`! &N@(! $ ! &NЏ@! ! `!'(<'!'د !<4E$LD$QNȎ#<4E$Xb "L$BNȌDL (! !'(<' !'د !<4E$LD$QNȎ#<4E$Xb "P$BNȌDP (! !'(<'l!<4G$D $DNȌ<4G$b X$BNȌBX8!!<'!<4G$D $DNȌ<4G$b T$BNȌBT8!!<'!<4G$D $DNȌ<4G$b \$BNȌB\8!!<'!<4G$D $DNȌ<4G$b `$BNȌB`8!!<'!<4G$D $DNȌ<4G$b d$BNȌBd8!!<'<!<4G$D $DNȌ<4G$b h$BNȌBh8!!<'!'௿!<4E`"!$` !D$O4DhCO`<4E$b @(!$D $O4(! @!(!!' <'!<4G$D $DNȌ<4G$b $BNȌB8!!<'!<4G$D $DNȌ<4G$b $BNȌB8!!<'$!<$DBN@%!D$DNȌ$b<(@<4CDBN@ DBO\,B@DBO\!`!<'<!'PLHD@!!8S!R<D !@;x @ !$X(!| '88&"Nȏ`C|(!' $Zh @ !@ ! '@&#NȌb&+@D$qNȎ"+@(!D|pN$N $Yq%N,@<4Bp|$Z '@< 4B@ ! ' @ !!PLHD@'X<' `!'ȯ0,($ !$'$D"|'$N$XR(! !&pNȏx !(!$@$2 `NȮ0 Nȍ2$BC+`NȮ(#0,($ `!'8<' p!'௿DD|EN$N $Y!' <' (!'௿<4CpDEN,@D$b,B$N@$Y$b !  @ !!`!' <' !'TPLHD@(!'<#<h$ @ !4 $G@h$ @!"<C%@"B@(!<I4BpDx&N ! $ !@(!D $$&3Nȏ\0!$Y(!$ b@!@ ! 2!$X|(! '88!b@(!|$Z '@ ! '@8&+8+@<4Bp&"NȮ0N!TPLHD@'X<'l!'Я($ D<|"N'$h@(!,B@'4gp <8B0Bt$$Y@4gp%N @ !@! 2<$X|(!'4Gp &#N8!b($ !'0<'t!DBO`0B8B+<'H!'Я,($ ! !@ !4 $Gt @!(! @ ! @!`@8! ! ! (!@@0!``!D  !@!   !< 4C@@ ! <4C,($ `!'0<'!'H|!!$s (! '@' l  ! !0 $D@ 'Dl  ! !0 $@ (!|$s '(' !x(! $'0 !`(! $P 4C!E $t@$ $ X  !$4$b$<$'  $@ @!0444$BN$N4$D$F'$<$'  $@ @!0444$BN$N4$D$I$<$@'  $@ @!044H$BN$N4$D$Ɣ$$P'  $@ @!0444$BN$N4$D$E㯢$<$t'  $@ @!0444$BN$N4$D$H̯$<$'  $@ @!0444$BN$N4$D$H$$'  $@ @!044$BN$NX$D&fHT$$@'( $@ @!0444$BN$N4$D$H$$'  $@ @!0444$BN$N4$D$H<t$$'  $@ @!0444$BN$N4$D$Gt^$$'  $@ @!0444$BN$N4$D$FH$$'  $@ @!044($BN$N4$D$O2$ ' @!@' $֨ $@ @!0444$BN$NX$D$E,$T'  $40@ @!44&"N$NX&ED$9 8!!44&ED$N|$9 &'N&ED&M(&'N $Z!D@<840'H<'4!`B<'!'@<8xD'$ (!"P@ִ@G !D, <@ !h$4pp@"P@ p@@!$P@ @ @!$P@ $P@  !  !@0!04e($N $N '"P@L@@ !  P@ !@<8!'H<'Ŕ!'د D<ȼ#P@4Pp`` ! L@ @!$P@ @!! P@ ! P@@0!40e($N $N! '(<'!DBP@<'Ĥ!'`\XTPLHD@Dx' <!!! !(!$! 4QpbP@0@`$ @ ! (!dP@(!د0! 8!@D@!TdP@$  $@!$D@&R $B  !@0!40e($N $N PP@' 0! 8!@@!0P@ @ @! ' @! !dP@0  '   !@0!40e($O$ $N !`\XTPLHD@'h<'<!'`\XTPLH xD'(!!@ !(!!$ !< 0!cP@4PpxP 8!@(!` !`38  @!8!P0!@(@(!dP@ @!X@ (!4 @@!B h@d  !@(!  0! !@ @ !@! ! '(   ! @0!40e($O@ $N !`\XTPLH'h!!!!<'@!'د @!<<$`$H$hb P! "H$%&'()BCDEFGHI '(+!@$ +@ !`0!!$(!`8!(# #<4BB@(!$@d#C#D!E!<'!'د D4BP$P@ @ !',@ $ @b#b!C#@B '(<'`!DDPtdP|$JD+@,(!DD cPxJ#DCH!h!%Q,"@"%#$& ' (eQbcdf g h"Pt$Q%JM+@%)pD*P!DDDIPx%Q,"@"%#$& ' (eQbcdf g h"Pt$QD%JPtJ+@%)p$!d <'!DCPtDDPxC#D!$C<'!DBP|@ @!DBPx$B$c@`$BpD@P<',!'௿DBP|@@(!D$$CPx$g`b@fl$cpD#$4 $P (!$DDxCP|D$Q$c CPt(!$Dx $QPP' <'!D$fQ$C (!b$b(!!<'!'P D ' $ĎDQDFQD @P@ ! ABP$DFQDP $Q A@ !$44$PD$O $ W̏$$ 0! A" 44$<4$PD$O $ x'( !(! $n $ 4P$bPLEFL GHIJKBcPL,3$-+./0124((! $n A$44<4$PD$O $  DbP4 !  @&X  @ ! A@!44$<4$PX$O $ ܏Ԉ !$0! 8! D܏ԈDP$0! 8! DP0!܏Ԉ8! $ը 0!8!܏ԈD  $   '<'!DBQ!<'!x <'!'௿X ! ! @(!@ @ ! 4@(!$P` ' ' <'(!'` x'$ !(!$ X 'X`(!D$LDP'X 8!@!$0 $Djּ  ! @$D'@$cPb (! !$B b̏ (!4 $P <r4Ca Xb0D'@$cPb (! !$B b̏ $d444$P$P $PЏ X4)#$P$b%$b'@<I4CaD$cPb (! !$B b̏ $d444$P$P $Q X40$Q8 )<D0BcQC'@D$cPb (! !$B b̏ $d444$P$P $Q X4($QX0Y$B0B,B@ (!D$cPb !$B b̏ $d444$P$P $Q Y4$Q|DpPC$PCtCD'@$cPb (! !$B b̏ $d444$P$P $Q pt4'$Q  @ '`D'@$cPb (! !$B b̏ $d444$P$P $PЏ 4$Q i 'd d`D$bPdPE&H@! c$@!<z4G #g<4IB?h *%+@<C4ރ $@d#C#D!(#@!b,f(G:'+@@!<C4ރ $@d#C#D!8#0!  ! A"@!D'@$cPb (! !$B b̏ $d444$P$P $Q b$e(4f,g  $R$P*@#\\\C @C#C!E+@'hD4$cPb$R$B b̏ $d,44$ $P $Rȏ <4Ca 'l\<C4Hރb!0Ce,<z4B #Îg( tp $#@q#C#Q!#<4BB?(*E!R+@ '!H $@d#C#D!B#$! 'pp "!<4B~Q+@<|U4B"! 't t@&$ ! tt t @&1DP\  ! @(! P\DP@'x '| P ! @(!P @1'䏦x| ! $P  !$ , ' $C 0!@8!` !$P `!  !, $ $C`4444$BR䯱$R$P$S $c ' ' DBPh@ e,@,@$菃b Dhl$RPP&H <*4c&\2!"%DЏ *@C!#PEЎB!$B%B $ C$ b<<4Ca $o C$ b<4Ca<<4Ca4Ca<4ab C*@4a`4ab4a bD$CPDx(!$Q$DD&Q&%Q $ 󨏓4@!'(&QQ &"QCFG$QHIJ K  @ ! $&fPȏ44D$P$S(CP &Q @ ! &fPȏ44$S@$SL $f DYP`  DYPP  D ! @P DYP DDPtDCPxD#b!e$b efg$d  D܌CPtD'9̌DPxC#D!$ C @ !$܏$ '<'!'LH x'( !(! $ '@'@E  $ @WD@BP|+@P DM#PxC`!Gl@C8@DYP %   @PxC#D!$$2$@BDCD KPt$QQCJEFGH I  l܏$2$$ LH'P<'!'D@<840D!!P|@m!!&`(!`$DDPx !@<DBPxQ !$Q$B@M@(! @HK4BDPx"(!l@ 'Px"!@lPxDQ!&DQ(! $@!$x !(! $pDbP$B bPx&DQ(! $(!$Dx $QD@Q!P|+@&1p<4Ba D@<840'H<'!'د$ D#DDCP|< +14Ga"PxD<!@ !B&EQ$@&4ga  &DQ(!x@ $ "PxD!`Q@"Px!@l$Pxx(! ! $pDpbP$B bP8!$ !'(<'!D#1DCP|< + 4EaDCPx<4Ea !b@e!<'4!'HD@<804488D$BD$Sl$S$ $bP|@9!!DPx"(!@*4$fS@'  cS( $Px͠"!D Px@8!4#!$䏙$S' fb$h0$HB| bP|&RB+@&1pHD@<8!'P<'!DCPx`#!DBP|@!`H!b#i!$Hb@ bb$b`!BP|+@!<'!DHPx&!D$BCP|C+@!H!b#i!$Hb@ bb$b`!BP|+@!<'P!DCPx`0!D#C!DBP|+@b@b`0!!<'!DBPl<'!DDPl<'!DBP<'!DBPX+<'d!DBP+<'D!'8@D#D!,b#`@0!C ' $'$4 $S8'@<'!<E4csB C<'!,$B b!B($B<'P!$C <'4!DDP<'!'x DD$P$P| x $0'(x (! 'p'tDBQ0B84B ( p  @1 'x  '|| @$|px<DC#|C#4~C+@pP4~b!PtDC!C#C!PC#@$PPTD(!R0 0! R0D$PP D$EQDFQDPDP A@ !44$$S$O (! DDȌDPD&Q$0BQ8!'(  (!'XD$cPb$B bď  $'<'\!'840,( DbP@! $ p @ $'9 bP @ !$܏u$󼏙 @DYP DDPtDCPxD#b!e$b efg$d  DDDPtDQ#PxE#C0!$$l@DBPl@ !E  $ @)$܏$N $ $  ! @!DBP@$,44$ $P$S $c 4 $T, $$b $܏愌D $ (`&YP Pt#PxD#b!b$db efg  DCPtDDPxC#D! @ N840,(!'@<'!'D@ ͸ ! 0D2$b$$b $B@Eb DYP DDPtDCPxD#b!e$b efg$d  DDCPtDQDPxC#D!$C$Q '( '(444$P$P$T\ $d Dx(!$Q $cDbP@DBQ@*D`PYP DDPtDCPxD#b!b$db efg  D$CPtDEPxC#E!2@/ !0DYP DDPtDCPxD#b!b$db efg  DCPtDDPxC#D! @ $ D@'H<'!'PLHD@<840D!cQ!C!<4Ba!@DBPX@ $4 $Tx<4Ba DP|@"!!!& (!D$CPx$䏙r! !b$e @ }DPx !@w!P|&Rp+@&spDbP|@d!!DbPxB !@U&@(!x $dPx#"PD !(! $bPx$B!ClbPx#$%&'() * B!CDEFGHI J bPxB!@lDDCPxPC(!l$BP` 'DBP@ ͸  $!bP|+@&Rp4 $T<4BaPLHD@<840'X<'!'د D!R0(! 0!R0 D$QP '(<'<!!d e <'!'Я( '@&'DDP '90 ' ! (! !(!@ 0!D娌CP C! DcPlC@ ! ('0<'!'Я($ D!P'@@ ! Q(+P P ''90 ($ '0<'X!'plhd`\X D4D00#!BP|1&$PX$ &gPx @<G $0<&&PX6$B $ 6BP|@!!dPxx(! ! $pBP|&1 "+@&pDx(!$Q $ (!$Dx'8 $Q DDBP|0$BbPtDDQDDFQDEQD@Q$&( "*$QIJ K GHFQC,D0CQЏ D  !@0!,` $ (!$4 $S (!$4 $P L4DH8CPhPxD DDDEPpD$P(!FPl$&0Q C TXD`dCPdDhlDP`Dx !EP\D(!FPXD$\GPTD HPP 44D&P$TGnPȌTHIJ KLM$Q%QԠGQ䏄D܏4HIJ KLM$$RTXZP$P(!$ 8! @,$E4$ET؏4 $T䏼 &P$D0! $R0 @@!44$j$U$O ! $ !D4<@&P$U(8!  PD܏'( $ !plhd`\X'x<'!DBP<'`!'0̯ȯįx'$!!! !(!$$ !'$''0@ !`(!0!  8!@M@!x' (! $$ ${`" $@8$40$W@0!0! ' @!@'$4 $W<4baP+@4ba 4ba  4 $W4$X4$X$($ x $̏ȏď`!'<'P!'@x'0!!! !(!$ !''H$8D@ !`(!0!  8!@P@!4`@@ @@@$48$X4`@<4Px'  !(! $$ ${" !(!$H@@$(! ! @@!4 $X|<4Ba 4$X($ x $`!'<'D!'௿ $' <'!'Я( ! | $'''  8!@! $('0<'t!'௿ $' <'8!'p|xx'@!! !!(!$$lph !'hH$'lT'p`@ !`(!0!  8!@(@!P@|l \@,`p$ ' ' $4 $PD@h 7!4 $XD @($E<$Eď4 $Xȏ0 @(!4 $X؏4 $P@(!4 $X$|x'<'!'X!xlh'h'l'p 't@*@!x'(! $$$bt&b@ +(,$ ($4'l84l'8!$ $%'hx'@(!$$  !D$D'x '|HP0 xT|4 $P'@ !, $'8!4l\&D&e# 0! ` !(!x $$D DHx0 PT|l&D&e# 0! 8!!'<'! $ <'l! $ <'L!'௿菐4 &PX$$g%$ $@$c$ȬfTTh &PX܏܏H$ d $ D!' <'! <'!'hx!(!' $t$l' $t '<'!h <'~! <'~! <'~!| <'~!T <'~!'Xx'!!!` !(! $t    $ (!'<$P(*,.0246 8$ $l` ! $t '<'}!'`x!$t(!! '$(!'<$P$ $)"#$%&' ( (*,.0246l' $t '<'|!'`x'00 !(! $t$l ! $t '<'|$!'`x'!(! ! $t$l ! $t '<'{! <'{! <'{t! <'{X!'ȯ0,('''  8!!$@! '$b$h,I$'' 8!b- $! @$ $!$0,(`!'8<'z|!'<840!,b@l4$cO`C!B\!@䐂 ,QQ&4  !'  ! @ @ !$  ͸  $<@EF $(,E &B$!<@0! '  <@ !&E$$(!  娔E0 B$444$BY,<4$YT$Y\ (!<840'@<'x@!'د Dx!(!&R $ R '(<'w!'Я,($  !$!! !@!$x !(! $D bR@ pR@!b@!cp,($ '0<'w!'௿D@!$DR$GR(!H 4 0!(!`` !!' <'vx!'ȯ40,($ Dx!&2R@ !!!(!$ ' '<b4M<4FB? !@D#D!#@P#P!b!CD(!*%R@ <4G !g!*@$CDS T40,($ !'8<'uD!'௿Dx(!$R $!' <'u!'@D$CRb@b@b@D&"RB@(' ' 'DR$RCC**@$RCRD #b#a<4BB@b!$'  !$$B`A$c&"RE8!$Bi!d0H %*@d8!&"RB$@'!༯' 0! 8!@!&"RB@' 'DRb$RCC*b*@&"RDY zDERtB!B 0b0B@  (!_'<'rD!D$CR<'r(!'௿DPR !4 ' <'q!DBR<'q!'X $$ 0! <'((4@!$[4$PDA$$s  x !(! $n 4P$bYhDEFGL HIJKB cYh,4$-./ (! !$n+01235 ( <44($PD$[A$$z  !'<'p0!'H ! ! @$ !(!' @ b  ` !u$$ 0! A@!4($<4$PD$[ $ x'( !(! $n '+ 0!4`$ $Yt ( !P (! $n A$4(<4$PD$[ $ x !(! $n (4$bYhL DEFGHIJKB cYh,4$n+-./01235 !`(!0!8!   !䨯`(!0! 8!   ! '<'m!'௿H$n ''' @ !(!$x 8!$t C ! H (!@ !$t 8!' <'l!DBR<'l!'Я($ Hx!$d !(! $$T${ !V '@ !X < !h@ 4c @(!&X $@S!($ `!'0<'k!'د$ !(`(*+()$௢  !!!$ '(<'k,!D(!DR $#<'k!'௿ !D!@!  !' <'j!'HD@`!, !'4$&@! &P' $ &P@ !'8,@$ 8"HD@!'P<'i!'௿| !0!@!  !' <'iP!D(!DR $"<'i(!'Я($  @*Hb@$$q ` ! (!'' $r @!><܎'9 $ ' @ !@@(!  (!'쏄H@' )!H'X&y $ @(!& ! (!'8! @'hD&y $ (! ! @(! (!'쏄H@8!<4B@@!H؎  !($ '0<'g\!'௿H(!@#!$$!@$(! $T@@(!H@$0! $T@(!!`!' <'f!'د$  !! !@!x  !@ @!'90  !@< 4BHBC$b!H@$X  !@@!  !@!!$ '(<'et!'ȯ40,($ $!xHb  !(! $d !&(! $@ !$$  '@P!$@>HCDEFGHI J &BTCDTEFGHI J b@&%s@`!&Y     '"#$%&'()*+ , - . / 01'940,($ '8<'c!'Я($ !@=!Ph(@ ܎'90 <@$4u4p!  @ !8 $@ <4qHt@$< 4Bu @!<C%R@  !H@&0! &T@@!p !($ '0<'b,!HC$DT`$E(! <'a!'௿H8!!b ! @!$e 0!@!eX !! ' <'a!H$!<'aH!HB!<'a!'@<840,( 픯TPL\` !  @ ! @l@!(! 0! ! !@!P !`! 8  !   !h @!  !@0!4 $Y  @! @0!@ ! &%~|  @! @ !&%~| 0! @!` !`  !@ @!$"$"`8!@!  @ !   !DDR   !@<840,( 'H<'^!'௿X  (!@(D $@ !  $!' <'^8!'HD@x'  !(! $X $(8,@ !$$  (!X@@! @ ! (! $0! @!440$Y$Y@$N  ' !HD@'P<']!'840,($!B 4٬D $Z<$0! 4RR@L@!,@ !$# $@ <440$Z$Y $N)R`(!$# $@ (4<$l$Y$R$"'  $@(4<$l$Y$D0 $N@! @!ď !840,(`!'@<'[P!'ȯ40,($ !4!$^x !!H !@(! !T0! 8!`"@!<4BpB$ h@d @0!440$^$^ $N\ ` !*@)$ x@"Dx @!hD @ ! @! 0!044$BN$^$^ 8! !40,($  '8<'Y|!'8!!<4Bp&A$ $@ 440&$_$^ $N<4Bp$ 0!A@! $@ 440$_D$^ $N<4BpD#R0c$BR`4" x'  !(! $n"B0B@" "4' '#$_ ! $k$ P(!@ ! $nA0!4(0$_$D $N4 C$b$D@ !$BRد$n (!$ 8!@@!$ $@< B&௢044$BN$_$^ 8!<94Sp"0B@4 C$b$䨯@ !'$ 8!@@!$@!" $@ <440$`$^$N @0!<4Bp"@! @ !`!'<'U!'د D(!R0! !RďDlCRЏDBRb%`$  ! '(<'U!'<840<!4Cp$'x !(!$R !  !ܯ'92T @!<840`!'@<'Td!'840,(! !0!$  !2#` !X' @0!8!`  @ @!ܯ` !@0!'  8!@!  !840,('@<'S!'د X< 4Qp@!@ !4@$`L  (!($ $ ! @! ! '(<'R!'p|xtplh! ! !@!<$B&A(!Dx&0R ! $n$$ 0!$kB&D44$R$K $`XD&3R؏P(! $nA $@440F&$`d$^ $Nx<4Qp`n!D$b A  $@Y4G$` $\bd@d $A  $@64$$`($`b f@fԌ A& &􏙚 $@4$`쏅40$^ $N`& @!` !DDR$ `l ' X!$$B`A$c8!@>'X$ &HBp!d0K %*@d0!@&\Bp!d0K %*@d0!&@B&E`Bp!d0K %*@d0!&$ @1DQR   !F\X$Bp!d0 %*@d8!1鯧XG&B' b!dX0$ %*@d0!XX $༯' 0! 8!`( $,``A  $@i' 4`$a +@)&B!B 0cb0B@4 ! $a@$n\& C$b$'\'' !(!$ 8!@@!$<4BpB0B@$$b$ܯ,('(40'92T< 8Яb,b@$$bqb(!m< T `DԎRďD 0!RďDl@R$ BRЏ $@  $@4 $aX $@ 4$a40$^ $N $@  $@4 $a $@ 4$ȁ40$^ $NԎR(!0! Rďl @RЏ0B@@L@` !x(! $n$4$_' $k C$b$'$n !(!$ 8!@@!$ $@< B 0!044$BN$a$^ 8!<4Bp  !`$B`!' '`@oB@&DBS!B0b0B@ $А 8!B$BB"@-B@)"BC\BS!B0cb0B@'@x !(! $"(!BD\ 0!&@ !А8! $B$BB"@B@&D`BS!B0b0B@ $А 8!B$BB&1 "3DQR -  !@!`2@!\0Bs!c0BC0c` ! D\FА$8! @!  !`$B`@@!`@'  $@' 4`$b@40$^ $Nx|xtplh'<'E0!'@X $$֯ X $$'ܯ$,(0'98 $@'H<'D!'ȯ0X $'ܯ $'98 (!0'8<'DD!'ȯ40,(! !0!$  !@ !X 0!'  8!  @!!40,('8<'C!'௿0 @ @!(!Dx$R@0! ' <'C8!(!D $R<'C!B&<'B!'Я,($ $ 2&! ' '@$0&쏙$$ @!$ @!,($ '0<'B$!'Я($ h !$4@*$bl @!$8 8!$~|$'  ' !@0! '  !` &$<  !($ '0<'A!B&(B <'@!B&(B8B<'@!'p|xtp!<دh $d@!@2$"4$b'0! 'h$C!!$B(!D(! &1!@*#h$``'$( @0!@'@  @ !!|xtp'<'?!'HD@<80 -!*<b@%c`!f<e$b(@<b<@<b@@<bD@ <bH@<bP@<4Bpb@ ! !F!@D!e!C!$Bdbb@4bb@bbbL@$ bLb @<UU4BUVC#b b,@$b,b0@$b0b4@$2b4b8@$ b8d,e0f4g8 @!0X 0$ @!0 @!0 @!d$0e(fgch@4h$ ( $b0@ @! $0@4$bp $(0@@! $0@ 4$b40$^ $N0!h @!0 @!0t @!0d @!0d  @!0de @!08de  @!0 @!0 $@!0dD @!0 @!0`d< @!0 @!0dH @!0(dL @!0@dP @!0 @!0~  @!0v @!0n4D8&b$R (!0&b(!D0! &'Rȏ0&&$4$`$b8! 0&8!܏$ $G(0$R(! 0!0&&$4$`$c8! 0&8!܏$ $F0$R(! 0!0$Rȏ< 0$"Rȏ4&d $c0@@ !p $ C04&d $c,0@ @ !p$ C C0!HD@<8'P<'8!'ȯ40x'(!$  !$ !'92T @$ 440$cL$^@$N 40'8<'7L!'840x' !(!D $$R$ԯ(! 0!DbR@ !$'92T bR@$ 440$cL$^@$N $Rďl 840'@<'6@!'TPLHD@<8! !&I ! $@ 440$ct$^ $N8 $ @!@ 440$c$^ $N8 $ @!@H @4x$ $c $ $@&I|  !@0!440$c$^ $N&I! $8 $ @!@ @! $@u4-$d$ $@|  !@0!440$dT$^ $N8 $ @!@@! $@H4$d40$^ $N^ $@!|  !@0!440$d$^ $N! $8 `@!`!  !(H $㠏  $@!|  !@0!440$e $^ $N! $8 $ @!@ $@ 440$eP$^ $N $@|  !@0!440$e$^ $N8 $ @!@ $@ 440$e$^ $N $@|  !@0!440$e$^ $N$ @&I&I`! $8 $$ @!@q@! $@|  !@0!440$f8$^ $N8 ' $`! @!`! $ !(!x $($4B ! '92T (@ $@ 440$f|$^ $N $@|  !@0!440$f$^ $N $@ 440$f$^ $N8 H @!@$4x $g $ $@|  !@0!440$g@$^ $N4$g' $$1b $@>440$g$^ $N5&I8 $ @!@@! $@ 440$g$^ $N $@&I|  !@0!440$g$^ $N&I $'4$ $h0$1b $@.440$h@$^ $N%&I8 $$ @!@R@! $@&I|  !@0!440$ht$^ $N&I $8 H @!@$4x $h$4x $h䏼, @ !(!$ 8! $@|  !@0!440$i $^ $N $@|  !@0!440$iP$^ $N! $8 $$4͜@! $i@ $@|  !@0!440$i$^ $N8 $! @!! $ $@|  !@0!440$i$^ $N8 $$4͜@! $j@@ $@|  !@0!440$jh$^ $N $@ 440$f$^ $N8 $@!4x $g $@|  !@0!440$g@$^ $N8 $ @!@ $@ 440$j$^ $N $@&I|  !@0!440$g$^ $N&I $8 $$4͜@! $j䏼@ $@|  !@0!440$k$^ $N8 $ @!@ $@ 440$kL$^ $N $@|  !@0!440$k$^ $N8 $ @!@ $@ 440$j$^ $N $@&I|  !@0!440$k$^ $N&I! $8 $@!4x $h$4x $h䏼 $@!|  !@0!440$i $^ $N! $ 8  !(!$8! @!@+@! $@|  !@0!440$l$^ $N $@Z|  !4H$lT@N8 $ @!@@! $@ 440$j$^ $N $@|  !@0!440$l$^ $N $@|  !4$l܏40@0!$^ $N'9I $  $@ @!440$m $^ $N@!TPLHD@<8'X<' p!D(!DSP $)<' H!D(!DSP $*<' !D(!DSP $)(<'!'د$  !! !! !4D@$m h@ !D @T @(!$!D $TD$BT B4bT !@$m !$eT @! !$ '(<'!'Я($  !! ! !hD (!@!! &$V@(! $!D$BVb &%V@!@!($ '0<'!'ȯ0,($ ! !!D ! !hD (!@!! $!&$Wa @(!d  $@(!&W@ $!&W@ &%Wa@!@!0,($ '8<'!'TPLH!2$$Db '@h&T@h'D $D'$T $!&TD' @(!h'D (!&@@(!$@D$BT"@!TPLH`!'X<'!'TPLH!3$$Db '@(&V@((! 0!$D'$V $!&VD' @'D('D(! 0!&@@(!$@D$BV"@!TPLH`!'X<'!'د$ !!V$$b1$BDx&W@ ! (!$ 񨏑D $ !@(! $! !0 &%ST@6$D,&$ST &T\T\-$D$Wa $!DCT\`$PT\D &%Wa@ &$&$Wa !@D$BW@B@!$ `!'(<'@!'௿DD$b,Bt$T$T@0!$b$b @@0!<4Fp!' <'!'௿DD$B,B $T$T@! @!<4Pp!' <'L!'௿DD$B,B$V$V@! @!<4Pp!' <'!'௿DD$B,B$V$V@! @!<4Pp!' <'d!'د$ !!(!<D4BpDx$QT ! $0 ! 0!P $)@2@!DUH@$UH4$m $ADV*@$V*($ $ADVk@$Vk4$m $A$  !@<4PpQ!$ '(<'!'௿DDBT$T(!B0B@!<4Pu @!<4Pp!' <'|!'د$ <!4Cp!!Dx(!$QV !@$ $ !P"H$*  0!@!@  ! @<4PpQ!$ `!'(<'!'د D! &V<&V (!@ 4cp @ !<4Qp ! `!'(<' !'Я($ <!4Cp0!Dx(!$QW@ !`)$B @ ! 0!P $)(@!@$D   !@(! $! !$D $Wa@<4Ppq!($ `!'0<'!'௿DD$W@ $Wa@!<4Pp!' <'!'د h!&0 8!! !(!!  !@(!X $  $ @ ! !'(<'!'د h!&0% 8!! !(!!  !@(!X $@ e @ ! !'(<'t!'د h!&0f 8!! !(!!  !@(!X $   @ ! !'(<'!'د h!&0 8!! !(!!  !@(!X $@  @ ! !'(,,!<'! !D@bT4BbTbTB0B@ <4DuDBT0B!<'!'د h!&0* 8!! !(!!  !@(!X $  @ ! !'(<'!'د h!&0 8!! !(!!  !@(!X $@  @ ! !'(<'`!'د h!&0 8!! !(!!  !@(!X $@ + @ ! !'(<' !'Я($ D !$ !`! @ !h @!&$U@(! $!&$U< '@!@ !D@U  ! &%U@! !($ '0LL!<' !'د h!&0 8!! !(!!  !@(!X $  $ @ ! !'(HH!<' !'د D ! !`! @ !h @!&$V@(! $!  ! &%VՏ !'(<' 0!'د$  !D !!`! @ !h @!&$Wa@(! $!  !@! &%Wa@!@!$ '(<' `! <' D!$ <' (! <' !$ <' !h <' ! <' !'@<840ִD$b&D8c&$4$S8' < $m(, 4P@ "SP440$m$m $Nh@ ! $@ @! @ !4$n p$SP @@! @ !4$n<40@0!$m $NY$SP$+(! $@ @! @ !4$nd$SP$*@(! $@@! @ !`0!044$cN$n$m($SP@(!$) $@ @!$SP$)('( $@!!  !0448$cN$n$m$ @8!!@<840'H<'!$!d'<'!'x|xtp$C'bp' x !(! $<'` !x(! $0'` !x(! $$B'  !@ !4#$Po $@ ! $@ !h'd (!@` !4 $Po   (!@$4$Po< $@!0!440$od$^ $N( B'@0!(440$o$BN$^ 'i ' |B'xtp' !$$$`!<'p!Ԍ <'T!'tplhd`\XTP@4P! !!! !@@$$ @!,  !@!$@  $@@!4/$o@  !@(!'H 8!@@* $@@!4$pB#H "$H`b(H $@@!4$pT40$^ $N @ !Ր(!Ր !6 'H@@$ $@@{!` "hD4 $W@@ @!dh @@!0$SH h$ @@!0$TH@hD @@!0$UH4hD @ !0B@@<$Fd0$FB|B0B@8$G<0$GB|2@L$BD0$BB| @0$B 0$BH  @0$C 0$CH4,$(B؏44004$BN8$n $^@!tplhd`\XTP`!'x<'(!'د @!H!C$b,c `0Fx0C$`0B@ $! B0,E$!Ð 0! 8! '(<'|!($  <'X!'௿  $@!<4Cp`!' <'!'د$ ޠ$! h@! @!,$QBDޠ @(! 0!4$ $q@8! '($ '('د ! !!  !  !'(<'!'0̯ȯįPD<6pbW!!$BbW!!诠?`!=0B@B!0B@$DCWd P@6p@!&B@R  $C$b$B @0 @ !d  (!P@QخP؎$b  @ !P@ !4 $qďPpB@4 'XP @ !P$B,B@  @ !P@<4SpB@4Bx,B@4 <ff4cfgC'ÏPd# ! @D#b!b!CBxȏx,B,BP!D(! $DBxP,B,BP!4D P !CxP@0!,c,cp!4d`$q $0P@P P !p @(!P@ P@! P@!0$VHh P@!0$QHh P@!0$SHh P@!0$CH0B@4$Fp0$FHB0B@4$Bp0$BHB0B@4$Bp0$BH@4$Bp0$BH@4$Bp0$BH $@4$Bp0$BH4Я(, !$p 8!P $P@E4 Pޠ @!PDxx @!PDh @!P @!@!P@h @ !P@ !0$DB|Bxȏ4,B,BC!F0$4$BN ($p$^ $0PB0B@@ P@0! 'P@<u4Sph @ !P Pp @(!P@ @(!P$C,b@P<4$cZPC!B\!@`@ !=(! @ !9P0!0!8!@ ! (!.0! 0!40!䏙@௢0!@ ! (!0!@ !$b< 4Sp@ !4@ ! P@!4SpB0B@D@W@ P$b`!@ ! PpB@4 'XP 'X@(!CȎB̎De!$B +PBCȮE<b4BMB@Bx4,B,B$q$fq$cQ!4Dxhp| lCxP,c,bQ!D !Cx P,c,bQ!I<b4BMӍ#$ %b&''xA !(0189@%) 'hB@%)  $P@_4 PCx,c,cޠd! p $WP,Dxx b!PDh @!P @!@!P@h @ !P@(!0$EHBx,B,Cd!c`!$c0'x0 $4(,8B,4<H4@0$BNDL$q0$^ 'hP BxP,B@b$Bb  @ !P @ !P`!̏ȏď`!'<'(!'ȯ40,($ !!!0B@B_$0B@F &@  !@M8!3$Ȏd $@!@C8!B 0B@>$ b ` !#` @ !b.8!# b)$'8!$8!(! &&@8!$"" 0B@8!$P! !@ @8!$`(!! 0!@@8!$@8!40,($ !'8<'0!'ȯ40,($  h!D! !@ !!0 $ @  D @<y4TppD  `0!@.  $'$ @!D p `0!@  B@ DD  (!@$ @  (!@0! ' @D @$C 4B $@  @< t#4u $D C(@$` C dȌF $( @<B (t$ 4u  !40,($ '8<'x!'Я($  h!D! !@ !0 $ @ @! D @<44SpD  (!$ @$t<` !"4ud b(@$` C dȌF $( @<B b(t$ ` !4u   !`!($ '0<'!'د (!4$B$qܯ$ $ b'$C !<4Dp !'(<'h!B'<'H!'د$ !x ! !$ @0! @(!<@4CpE '9 <@4cp!$ `!'(<'!'lhd`\XTPLH!p!$! <4Bp$(0c $(`,$h @ !, $*@C$.bD  Bh4BB$( ,@!<@6wp !8@! ! !0!4@8! $q询 <@p@ @ !$C%'  (!' (! 8< @ !@h80 p@(!ۤd 0! & @B tD  6euÐ@8!@ !$ 0!@6eutD  !/h< @ @! @!&  ! 0! @8!@(!@ B 8D   $$@ C b@q(@.' 40P4bBQb@0B@  4@0! ',@B'0 '4@'(( (! (!, ,(`(@@ (!@0!x &D,  !'$(( (!' ( (!< !  !D, @, ! !  $ ( , 8 < t< 4u !p@(! 0!@!!lhd`\XTPLH'p<'! < \$(, $ (4Bp<'!DBW<'߬!'௿!Xx  !X ' <'`!'௿!Xx  !\ ' <'!'Я( <4Hp$ b @'9  @@!(!'0<'ެ!< 4Bp$ '9 <'`!'Я($  `!$"0B@ b0B@< @$ t<;4u0$B0B@0b$ t<.4u@<$ t(4u@ (!$  $b<$ t4u &$Ð !$ 8!@  !' Ð$ 0!@ $$ t<4u !($ `!'0<'ܴ!'Я($ ,! D d4Wf$ 4G@@!d tK<bBB0B@b B0B@X @B4BBD  Wh @!d$ @!8 @ ! !0!4@8! $q쏼@ B @ !d t<4u0d  @(!@!@!8 @ !t  !d @(!t !($ '0<'ڄ!'Я($ ! 0! !<@!t@ 4uD  D 8 1`!Q"Q $0B@ P  C e @ !`! @!B hD  ! @(!"`!($ '0<' !'xtplhd`\Xx!!!'(!$8 ! L`!b@bPuʯ$|' 0!@@!D8< '@@!8`b@ <@<t$4u<@bBB0B@ <t$4u  !<4Tp' 'P@@!P$C <4Bubz @f@! @ !$< @!$\ @!@! @ ! (!0d $ '(!8! @0!<4ut@" !B0B@ X0B@ @$$ @ !@ !t @! !@(!t @ @0!x$  (!@}` !P $ $$<4Bu t  !$@(!t $& $ !<' $xtplhd`\X'<'Լ!'Hx' !!!@ !(!$8 !b$0B(T c@`!b|,@(!t 0!@@!,B @ '9p @ !@t ! @ D @(!t $'9 @ !@@t,< 4u$DF $ $ Z'Xx !(! $8Cd`IX (!  !@ @!t@ ! $dt @(!|`B$btd< 4u$G Ð@ !$ 0!@td< 4ud" @  !G ؏X  0!" dB @$Dd$`@ !D 8 D t< 4uE'9L $ @!<@ ! $@!d!t,< 6u\6p <T4Bp`Mb@I' b|,p 0!'9p ' ' !@*&d,`! @' '9 @' @''9L '@&e B@0! ,@<'  !<'  $'<'τ!'௿ @ !( $|D4(0bW$q$D$N@! <4Cp`!' <'!'௿$!@   @ !' <'p!'ȯ40,($ !!!!`@!r 0@@!<,4TpD D "#`" $h @! ! @(!"B@ " ! (!x @0!!s40,($ '8<'!'ȯ0,($ 0!!!! @!0  !p @(! !(!L0!@`8! @@!1@!0,($ '8<'(!'Я($ @!!$0!@!<4Cp0'9` @! ! (!@0!@ `8!($ '9 '0($ `!'0<'d!'<840,($ !!!!P! @<X4Bp`V !r !@ !@(!p !@D E0'9` &D0$$$@\ @ !4@ @!Dh @! !@(!0ۤ 0! $ @!  ȎE(DF @!@ !(!8!'9 0!@@!s !<840,($ '@<'h!'x|xtplhd` d!D !! !'  !x(!$@! ! ` $@/!B@+B @%!b0B@$Ð@ !$0! `8!@$ !0! &@ $b0B@C b4BbB B0B@BVB@V*@B$B,B@BC$b!B$BB D \ @! @!<4Bp0d` !$  @(!.`"$  e@ ! dh @! !@(! "B C#h$ h @!$0!(4@8! $#Bb@ BB0B@<b%#BC$b$$   dh @! ! @(!"D  (!`0!8!'9 @!"@< C% "D (!x$  @0!!@!D E8,c0B@0!BFB@F*@$\T X` !@(!0d'8 $  !(!x$P @!B $ &@ !T88<<@D$ D@Ð,(H0$ 0!@% !$ ' 0 @!@ T ! @0!@BB BB0B@'P 'T@C bB0B@3$1<4Bu@X \ (!@0! 'X@<@ E @0! 'X@X `F G$'X$ @(!X@@!@<C 4Bu$#0B@ 0B@0B@$0B@0B@$0B@0B@$ `8!@!<4B<t ! 4ut  ! !@(!t !R0,($ '8<'!'TPLHD@<840!! $,! @!0 $ @! U0' '$ !'9L '(@@! B0B@_`[ dp @(! !$Ð0!@G8!p @?&($  @!@5$ h@ ! h @!@ ! @! 0!044$BN$^8! $rt @ !@(!t  !,@<4Bp,s($  &(@4@! @( @!  !G ($  $$@@! $@ 440$r$^$N @0!B0B@$b$$ @0$ $@h  !@ ! @!0!@8!044$cN$s $^t @ ! !t @(!,`<4Bp,  !,,bTPLHD@<840'X<'8!'\XTPLHD@<8!!0 $!! @!U0' '$ !'9L '(@@!S` dp @(!@ !e0', '0@\@! 0B0B@9`I($  ',@)@! $@" hD @!bhD @ ! @! 0!044$BN$sP$^ 8!e !',`$ '4@@!e !'4 @ @!B0B@$b$@+ $@! hD @!bhD @ ! @! 0!044$BN$sP$^ 8!<4Wps`@`($  &$@!$ @/$ $@ hD @ ! @!0!@8!044$cN$s $^t @ ! !t @(!<4Wp.\XTPLHD@<8'`<'!'ȯ0,($ !!  !" @< @(@! @ !@!@ !`(! 0!$R # `<" @@!<4Bp "@8!l&f@@(!$   !!0,($ '8<'!'\XTPLHD@<8!!h $0 ! @ B0@@!<4Bp' '$ !'9L '(@2@!h0 !', '0@(@!0@$ '4@@!($  ',@ t  ! !t @(!h ! ',@!$ @J$\   !@(!0d $ $ @!@!h ` !@! hD @ ! @! 0!044$BN$sP$^ 8! ` !t @ ! !t @(!<4Wpq!\XTPLHD@<8'`<'!'Я($ !!!#@! 8!Ð0!@$ < !t4u @8! ` !f0'9 (!<4ut@$  !($ `!'0<'!'د  !@0!C <`4Bp @!t@ @ ! $ t @(!! '(<'!'د$  @!B @<U4Bp| 0!@B@!D C(0B@&` B @@!B$@<!B @<B$@<4Eu4Eut B @<B$@<"4Pp 4Pp`!B @!B$@!t< 6%uB(@60p 60pt @ !D t @(!!$ '(<'d!'<840,($ !!!P!<h4Bu`<c4Buc B0B@0B@Ԡ  c 0B@0B@ t< ! 6u?6u"$@0b@   @ !"$h$ C$@Ch$ @(!$4\ $s@c$b$$ c @ !0B@b+@0B@bnD+b*$$ '@h$ @ !4'90 $s@d 0B@cC*@0B@bCC*b*$t$ '@h$ @ !4'90 $s̏@d 0B@cC+@w0B@zbC+b$h$ @ !@!, $ $@e< ! $d@]Ub|d% I$ b $  ! ! !x @!$ @!@ @ !@&8! `(!@<4Tut-(!b.$ c @ !0B@b+@0B@bD+@h$ @ !4'90 $s؏@t<4u  !" @,*0B@#e B0B@0@0B@B0B@"0B@ X @$C$" <840,($ '@<'|D!'d`\XTP!!!,(!@B0B@Pa<,$ B 0B@E $D,E @ d@(!'  '$@$@  $D,E @  !@(!'  '$@$@$ c@(!d'( ',@."@?<8<40  !@<$ 4Pp@  !4`$s8$B 8<D4E @ @(!'0 '4@4<@<  !><4cC$ @@ < @ < !\@8! 0!  < !x @0!@<$ 4Pp@#  !4$t040@0!$^ $NJ! d@(!'8 '<@q&p@(!8!`$`0!8! (!X @!@@! $@ @ !@0!440$t`$^ $N@ $@ 440$t$^ $N<4BpB @"< @ $@440$t$^ $N < @<4Rpd  0c`bb4Bbb0B@%Q 0\  !$C ` !$0d $ @<4Bu 1 ` !LHY!D @LDDE @ d@(!'@ 'D@D &dDL0<@ !C% @ @!(!@0!x &d@<$ 4Qp@   !@0!440$u$^ $N4 ! @(!'H 'L@$ ! $@@!440$uD$^$N0  !@ @!&d(!x@0! @!d`\XTP'h<'r!'@!!B!!!@!Ԡ B0@ !@0!4`$0 $qЏ@<B@<24Bux' (! $8'XTx !(! $8B@@!b@!@`e`!|d(! 0!@F@!dB @@' Ð|x $@<td 4u/@`xb9D|b4dE   !@,Dx|  !@@!@@ dV x@|Dd't  !dt @(!d@ ! '@,0B@ !' ' @!'` !b0B@ `(!b@ 0! !0($ '  '@! @ !`]`pB@!@kB@gbO,B @K$ $h@,D @!,hD 0!@8!044$cN$^ $u| $ޠ@D  ! @!0!@8!044$cN$u $^ !$@0! 8!@@!B@@!B@ D'9` <  !F $@! !'<'m !' 쯰诼x!!!' (!$8 !$(T !'!!@m'Xx !(! $8B ddp @(!@UdB0B@(!  !@Ed'9  !)  !@6d0B@@0@ 0!؏x !(! &'9  !@ <b !$B'9 b@ $t ! 4u$Rb@." $@440$u$^ $N@ 0B@'9` <@&<@<4Bux' !(! $8䏼ČbCB0B,B$B0c`կ(! 0!@@!Ð ! $@`̯@!<4BpÐ !$ 8!t@<0 !'9 $t@<0`a'̏u' !'9L 'ԏ@@!(ԏЏ $@ @!$` dB0B@$$b @7Џ $@" hD @!(hD @ ! @! 0!044$BN$v$^ 8!t @ ! !t @(!<4Vpsk!Ð !$ 8!@<t6u !E '9F0 $@ (!t<6u E6p$P! 0!8!| $3!|(! 0!@@!Ð ! $@t<4u@'9@  !@'98  !@!@O ! '؏@@!@<;4Pp @-@! @ !$@8!Ð !0! @!(! @8!t<` !6u$f0'9 @ !t <6u 6p@@!x ! 0!@! [@R܏b0B@ 0c`  !'9@ @L'܌D '@"܏b0B@0c`''98 @!t@ @ ! t @(!'܌D '@t< 4u t  !@(!t B@" @! !0 $@!@(& B&@0! ,t !  !@! ,t @(! , @ !, <'  $ 쏰'<'a`!B' <'a@!'௿d !@ ! @@!@ !B\`!' <'`!'د$ !! 5!<$ @&@!D   @ !@@  @ !(!x @0!@   !<4Bp1$ '(<'_!'Я,($ 8!h @!4$Rv`h @!4$Q@ @hD 4$B@ `0!f4$vd @8!,($ '0<'^!'د !*!0B@ E @<4Q$ !$ (! ! '(!0B@$`!<']|!'tplhd`\XTP!!!!@'<4Bpx` !(! $8L`C b@?pu$@(t" !  !@ !t <|' 0!$@t< 4u @ @@ B B0B@0B@d !| @ !@@!DW$C`W$b` !'9* @Wf$"# "b @B@b "e b(d&" 0c`$"4B"0B@"4B"0B@"4B"0B@"4B"0B@<"C%"0B@<"C%"0B@<"C%"B0B@<"C%" !6 "@ @ $@0!x$"@@ $@0!x$  (!@<-4Rp"0B@$ %"E @@!b D p  % @ !( $@b hD @0!440$v$^ $N  !@ t$<4u $'H &@@!!F &H( @ !@<74Rp !@$𠌰 @ ! @$?0c`E$ (!@!(!$ ޠ @  ! !0!8! (!@! !<$ ' $@!tplhd`\XTP'x<'Vd!'hd`\Xx!!!P'(!$8 !b L@P!CQ`$ $@@440$v$^ $N6 !b (t  !$t@(!dt 'PP'9* @ @ !t$<4u $'H &e@! ! !<' $@!!hd`\X'p<'T!'د (!4$B-D$v$,$ $$b' $C !<4Dp !'(<'T!'Я,($! $ ' ,@$$ <.4Cp<*4Cp$$$0b@ $1@0b @$B0B@$$" ! '$ @ @!$@!<4Bb%!,(`!'0<'R!'Я,($ !@D!@ !@(!' '@@!@(! 8!' $$@@$F$(@(! 8!'97 @!<4Cp$,($ `!'0<4Bp<'Q!'௿0<4Bp$` ` ! 4 @(!!' <'Qx!'௿0<`4Bp$e 4 0!' <'Q$!'௿0<` 4Bp$e 4*B8 0!' <'P!'௿< 4Cp$ 04@ 0!`!' <'Pd!'௿< 4Cp$ 04@ 0!`!' <'P!'௿<4Cp$0@ 4 0!`!' <'O!'௿<4Cp$0@ 4 0!`!' `<<@<4Bp   <4Bp<'N!'د$ !$$c+C!@ ! &1@*# `!$ '(<'N(!'@<840,( (!!!X@! (($b,B @<04Bp$B+@b!@  @ !  !`0!8!&'9<  @ t @ ! @(!t  ! !@<840,('H<'L!'د $'9=  '(<'L!'د '9=  '(<'LD!'ȯ0 !!A, @0!H!'(`8!(!$B+!@ !H'9<  0'8<'K!'د$ ! @<4@<+4BpB0B@%!b @`0!bB0B@&0 $ $B @(!d ' '@!$ '(<'J!'XTPLHD@<8(!<4Dpx$b !D"WU:&"WĎ0B@<4Bb$஢ $(@'<  !($Wď @!@ !"Wį(؎@!C&"WČB@!C044$BN $wl $^(<4DpB@!D0&WČS`A(!ݬ ` !@!(B,@!s\ @ !( !@ @!(Dh @!( !@(!0ۤ 0! $ (@0!@(!D@$W،B$C$t (`(!'0 !( !$'0 8!(03(!ݬ ` !(@)@!B @%$ (h@D (Dh @!(@ !ؐ @!( 0!044$BN$w$^ 8!(0 (r&WďDW &Wď($Wď$ #(a <4Bb$" !$0! 8!(  !( !XTPLHD@<8!'`<'FX!DޠDW <'F8!'د$ #!x$dDb @@@! &DW (! &DW(!$ @0! '($ '(<'El!'D@<840(_!x$b[DݬW $( @!( !p @(!(@ 0S- $(@&  !(@!  !(0$BB|'؎&$044$BN $w $^((&WD@<840$ 'HD@<840'H<'C!'ȯ40,($ d! !!@!S !x$bO$DbW@I !T &bWČBRC$?$DDW @6@! @ !< @! !p @(!@$b $bW&bWČB@D$BWČB$@$ ! !40,($ !'8<'A!'XTPLHD@<8(<4Rp!! #@ !#x$b !ޠ  !$(C @tD '0(@@tD '4(@$#04b! ! .(D@ bWQ<"C%خ"bW@<`!8 $pWĎ (D#b+`1 $(@$DW ( ! @!@ !BWď(F`8!g"#؏404$BN $x4 $^(DW (D$&SWĎd 0!(@/@!  !(   !( @ !(1@0#d00!0 (!( !  @!(@ !4 $x(  !($ BW@8$#b4<U4Bp $(@)<  !(DWď @!@(!"؎CWį('` !d&BWČB!@C04 4$BN$$x$^ 0!(<$4Bp< 4Bp0 ! &PWď(% !d BWď(8 (@u#u!  (!@!B0B@@ ! (@ !XTPLHD@<8!'`<'<!D(!x$bW@W <'@!d $@(!'  '$@$ 䏰$'9 (!@$(!` !0!bt8* '9 @@!d @(!'  '$@` !1 &@@! $@@! @ !@8!`0!f044$BN$ $^@!D@<840,('H<'!'x|xtplhd`(D4(!$0! &X (@ $(@440$$^ $N(DDX$ (䏄,'ُ $ (l$ $'(X (!0! H(,'9P $( !DCX`HdDDXX'9t$B XH(S`@h'H (!(XDDXXE!e+`XX $(@ ,40$0$^ $N(,'ُ $p($P,! ` !(@! ` !@!(L!!`!b @B@d  !(@<4Tpb hV (@ @!( @!( !0!0@8! $ @ !(@L<m4Tpc$b$ $('L$h @!b$ 0 b0 (@ @!((!@0! 'L(,Ў $(LD  $@!( "J$cb7۠ @(!(@@! $(@<44,$$^$ƀ@! $(@7d $ (@!h (@!,$R8  !(@ !<$FH,$FHg" @!C"4 0,$BN$$X $^(  ! $  (  !('T (!(T (  !(DbX$BbX ` !|xtplhd`'<'!'د$ DD,X"X$b! @(!X, $Џ%X, $D,EX $0@D,EX@ ( $`D,EX$ $ '(<'!B(<'!'௿|D( @!D@ !X$` !$BX$b!' <'4!D@XD@XD@XD@XD@X<'!'xtplhd`D!!BX !XPT@! @!<4Bp@ (!@0! 'P@'<4Spx(! $8 PL`TXT !@@! "1@ $ $@P,:$ $p @(!@?$ $E$D @4| !' 0!@  $@%,$8` $@,$<40$^ $N @@ B B0B@𠏥$ 'T @C `!$'X 'T @B0B@ $b$$b$$b$X@(!  !'9X X@!  !T@c` $@ ` !@0!,40$|$^ $NT X `!xtplhd`'<'ܼ!'௿<!4Bp0 <d% !'9 ' ' <'8!DbX $BbX <'!DbX $BbX <'!'௿D謌BX @! @!$!' <'ۈ!'ȯ40,($  !!!'" @$ X@$  @8!0,44$cN$$^ $ZЏ (! &D B @2`! @@!<'4SpC 0$  ! @ '9  !@@! $@`!0,44$BN$$^ $ZЏ`!40,($ '8<'ٸ!'\XTPLH !@$0B@!x'((! $d +!0d$ $ @J@!b@D @ !h @!@! bhD  !0!,@8! $ @ !#@!d$0 $  @!  !h @!  !@0!, $ @! ! @` ! $ @X,440$$^$Z $NJ< $$ C$$ h @ !@! b hD d 0!P@8!'(  @! @ !  `8!Pd  '( @@!$ $ @  ! @8!0(44$cN$$^ $Z쏼  '( !\XTPLH'`<'L!'௿d @ ! @ @! @ ! (!\@ !!' <'!'Я,($ 䏇(!,$B($$珸 $b($C!<4Bp,$' $(@ $@r<,4,$8$^e$ƅL,$' $`@(! $@Z<,4,$8$^M$ƅpD,$0! &GX@$ $@A<,4,$8$^4$ƅ,&'$$  8!@$ $@%<,4,$8$^$ƅ䏙'$ƚ 8!@(! $@ <,4,$8$^$ƅЏ0 $N<4QpDX 0!DX X !,($ '0<'!'௿h  @(!,'  $쏿' 'د ! !!  !  !'(<'!'௿h  @(!,'  $쏿' 'د !!!  !  !  !'(<'D!'௿h  @(!,'  $쏿' 'د !!! $b  ! $ b !   !'(<'T!'௿h  @(!,'  $쏿' '௿! !' <'!'د $!BC!$$$$P$Xb$ X"BCX @$#T `!'(<'!'쯲诱䯰௼   !!! !؏ $p @  @ ! R< 4Pp$C,b@<4$c[C!B\!@@u(!x'( ! $ Ƞ0! !' @ !' ! @`@!h( ִ @ ! @@!<P4PpH  !C" bx"x$$0,  ", 0#l"h2"n4 '( 6"X !C% " @"@!p$ @ !b$ ԰ \ bD  b @<4Pp  ! y$b$P @&D @U@!'8` ! $ @-@!h% ` ! @&@! `(! @@! $ @Vh # @,40$$cN$^ @0! ? $ @h CG #,40$0$cN$^ @0! $C؏ $ @h C,04$cN$$^ @0! $C؏ ` ! $b$䬂؏\ @!$  '#$b"BSx'x@ !(! $ '8 !x(! $<  !(!@0!  @ ! @- x$ b ' !$L @0!$L ! @0! @ !0!H(!  @ ! @! 'x wp !'įįȏ 'ȏ  @ ! @(!0 ! 'ȏ $@!' !'̯̯  0!  @ ! @ 0! ! (!  @!  0 @@!<"4Bp  !'ЯЎP @0!  @ !@! @P @ !  !`` ! @(! @! !M@!<4Pp0$ '(!' ԏ  @ ! @!@!5`! 4$'$ 8!  @&@!̏&8#(! 0! @@!$b $ @ ,40$$^ $N \  ! 쏲菱䏰'<'Ą!'h|x0x!!(!'8 $0'P(!x $0H !'h h0 @ !0@V@!4'h $0@I@!h̎ 8# 0!0@(@! $0@6討 @!0hD 0` ! @!0 0!0,4$BN$$^ 8!E\'P  !0 !(!x $ 0EP'l  0!0@.@! $0@討 @!0hD 0` ! @!0c04,$BN$<$^ 0! 8!0xl '80@@!<4BpbD (!0@(!'8 8!0!'9 <$b$b$bQ'8p@ !0@PD (!0@(!'80! 8!'9 0@u@! $0@n討 @!0hD 0< @!0` ! @!0c04,$BN $$^@0!  8!A|Gl$ 0@9@! $0@0討 @!0hD 0< @!0` ! @!0c$0@4,D$BN ($$^@0!  8!0HJP'hd !'p h0 @ !0@@!p\ 'P0\ '8`!0|x'<'0!B(<'!B(<'!B(<'!B(<'!'x|xtplhd` $<'@'(!!!!$$  !(!x$ @!  !(!x $ `(!@8!P  !!$ 'X 0!  @!8!@ !@0!X `(!0! 8! !'9  @!\  !  ! \  !! |xtplhd`'<'!'`|x0 ! !0p @!0 @!@<R4Bp,€ ! $L0@@!<G4Bpx'P(! $0'8(!x $0  ! 0 !p @(!0@p@$ 0p$ 0 $ (!'h h0 @ !0@@! $0@H 0` ! @!00!@8!0,4$cN$X$^44@ !B'h$ 0! 8!@!$0`(B $0@H 0h @!0` ! @!00,$BN$4 0!8!$^  !'9 (!@!0@$b $0,$ 0b$hlh$ 8# !& 0!0@!@! $0@PH 0h @!0` ! @!0,0$$BN\'P @ !0$@ !x (!0 (!0$ P'l@(! !@0! 8!0@+@! $0@H 0h @!0` ! @!00,4$BN$$^ 0! 8!0xl ! '80@?@! $0@#<H 0h @!0` ! @!00,4$BN$@$^ 0! 8!0<4Bpb (!0@(!'8@8! !0!'9 <$b$b$bL'8p@ !0@P (!0@(!'80!@8! !'9 0@O@! $0@HH 0h @!0< @!0` ! @!00,4$BN $$^@0!  8!=l|$ 0!0@6@! $0@H 0h @!0< @!0` ! @!0$@0,4D$BN ($$^@0!  8!0  !0HJ4'h !0! h0 @ !0@! 0 !p @(!0@ "p@ 0"p 0\ '80\ 'P0  !0`!|x'<'!'XTPLHD@ ! ! @! @! @!<@<T4Bp@(!<O4Bpx'  $$  !`@(!'8 8 @ !@4@!4'80! !$ @8!@(@!"@#$d $0$,$ ""b"h#n$"# !'9 $8$ 8#&%@ ! F0!@!\ ' !XTPLHD@'`<'!'Я,($ !!,䏙$B`!$``(!$! $<4hp,䏃(!$$x$$P1b($B  <4hp,䏃$ (!$續$Pb($B <4hp,䏃$@(!$|$P b($B @!Pb(<4Hp,($ !'0<'`!'௿h! @0!, $@(! ' ' <'!'௿7!0B@$ 40,$^$N@$  t &(!@$D  ( (!' <'!'௿h!D ,$@(! ' ' <'X!'د$ !!O!K'9x @ @0!e @ !< @0  0!$$$&@  @!@ ! (!80!$ @8! '(@ @ !(!$ @0! '($ '(<'!'<840,($ !!Q!@U!DDE !@!@C< @ !@R@B$D t '@!6*! 0!0pE($  !@b(!$$ @$ C1  !R!@!<840,($ '@<' !'௿E! (!@!$!' E!F$`!<'!'௿!!@@ ! @ @!@@ ! @!`!' <'!'9 <'!'ȯ0,($ !!!H@!?<`@4Bpp @8"b@2<t $ !$P @! !p 0!" ! @(!"@B@< @ !#@(!bDD @b<4Bp!0,($ '8<'l!'د$ !!.$,!*$p(  p@ (   !@$$($ @ !@$p($  !@ $B#C+@$$!$ `!'(<'d!!E($8! `0!<'<!'Я,($ !!!'! (!@ @(!@! 䏤'9 @ @!' '@(!@ 0!!,($ `!'0<'H!'@<840,(!!!!$ X\D! ! !@P <44Cp ! (!`! 0!@!@ @ !(! @0!@!<4Cp䏤$'9 @@!B@ !'  '$ (!@0!@8!!@<840,(`!'H<'!B($<'!'ȯ0,($ !!!&!bS@b0B@b0B@&d $@(!' '@!0,($ '8<'!B( !0B@$`!<'`!'<840,(!!!!!'x@ !(!$*` $䏙PE($P $$< @8!<840,('@<'!'Я,($ !!!!   @! l@ ! $"!,($ '0<'!'Я,(䏙䯦$B'9' 8! @!   @@ !P !,('0<'H!'LHD@<840!!!! $(`d!*@e!V+$b0B@ `(!@! $ !ܯf  !@!@ !(!`0!@8!@!  !(!0!&g "!"! '$d'  @(! !`0!\@8!# !(@ !BP@! (ܯ(!0!&g "!"!쎤E($'  '((!`0!@8! !LHD@<840'P<'!'Я($  !h !@ ! $440$t$^@%$N  `! @ !$., @!@!$!  8!,4$,@$^0$BN <4Bp($ '0<'!'د 0!'9x ' '(<'!'د$ !0!'9x ' 0!  @ ! @!!$ '(<'!'@<840,( !!!X !@B@!0d@ !$  (!"  ! "" ` !"$ Dh @! ! @(!"@ @0!' x  (!@   !<4Qp @ ! @ ! (!@! ` !  !    ! $@ !hD  ! @!0!@8!0,4$cN$\ $^ !@<840,('H<'|!'ȯ40,($ !!(!8!0!&@$$ @6@!%@0@0!"0B@($  @!@ ! (! @!@ !@&& #%@8!f&$ @!40,($ `!'8<'!'Я,($ !!<4Bp@Z< @S"cb D( ' '@@܎% @ !@@ @0!䏙0&D $d@C<@( |0 @P@3@ @0!䏙0&D $d@%<b$Bb"@ @0!&D䏙0 (! $d @!@ @ !2<4Bp !'9T (!!,($ '0<'!'ȯ40,($ !!!!@0d $ @ !h @!@(!4:$KԌ@9B@5P !@!"hD (@$,0!$ @8!$< @$Cb$(% $b h$ @(!4$} B@B % & B0B@$D"0B,G$C"0B@$V$P, $"0B@(,$O $"0B@ (,$O $0 $N  !40,($ $'8<'!'D@<840!!$ (!@`!0B@ `!P$$ @!$`;0B@" h@1BD Dh @!0!@8!0,4$cN$ $^ $@`!$hD @0!,40$$^ $NÈD$ @ $B D'  '$@62@]0B@YB0B@TB@BB0B@J< 4Sp@B@!0d@ !$  (!@("@ @0!'(x  (!@ @ !D @!$@(!0! '(P @!'(  (!# `<4ub4p  !0B@+`+ $@ BhD Dh @!` ! @! 0!0,4$BN$@$^ 8!!`!`!BB0c4B`Bް @ !@ !'9T $'9 @ ! @ !`!D@<840'H<'<! (!<' !'د$ ! !(! !@ !0!@(!'9 @!@!  !!$ '(<'!'Я(䏙䯦$B'9' $ @   ('0<'!'ȯ0,($ !!!!$,d(*h !@#C`,@ !u$, @$B@&1C`0 *@C`u@ !b$@$B ! (!@!<4Cp`!0,($ '8<'!'D@<840,($ !! !@ !!|$, !d(@!h @!@!<s4BpbQ _ $p @(!@L"@ !Հ (!-$@)V& !, $,@V ! '@ <Հ@ ! '@!<4Tp, ! $,@@!&"@@ (\@ ! $ 1 d( cB0B@r($b$b!D@<840,($ 'H<'!'<840,(  !!!P !@!|D($ @!@!0 ! T32D"X0$cX0# B0B@6B""&2$D( @(!@S $@L,40$t$^ $N@  $@:' D @$ ,40$$^@$N   ! '@!@$ @ ! @0!,40$$^ $N @(!'  '@@ ! !<840,(`!'@<'`!'د !0!@8! (! '(<'!'Я(䏙䯦$B '9' $ @   ('0<'!'@<840,(!!! !!! !$C@ ! (!@!@ ! (!0 @(!R@n(!(P ' @! ! <  !@(!̎  !&  @ !@G@ ! (!@ !$0!t '@7(!  ! \(!  !@!Q @`#`( ' S (!` ! (!p 0!@@! @ p` ! (! 0!@@!   `!@<840,(`!'H<'!'Я($ !!)!h& ! @ @! @! !@8!0 0! $ @ !@(!`0! @! ! @!!($ '0<'!'ȯ0,($ !!!E !F! @ @!$' '`(!d@@0!!0,($ `!'8<'!'௿'9 !@ !(!d0@! @!`!' <'!'<840!0ۤ!$  !P 䏙l(' $,@ !$$ 0!0 $N<840'@<'~!'\XTPLHD@<8!!!!0$4pJ!4F<4 @] $$4 @ '  '$@$@ !4 8!@M$@(!'9  !@ @!4B0B@$b4Bb40D @ @!` !(! @0!@! !䏦$`(!8!'9  @!40(D ,@ @!` !(! @0!@'(<4Rp`4$(! 0!@@!( @!<e4Rp<4RpX$$4bR0B@L0b@J(E$D @ !䏤$ 2$È @*,$B%, '(@ @0!$E ` !@ !䏦$`(!8!'9  ` !$ @!', '$@ޠ( !@>@!B*@; (!ݬ( &1GE48 !0 @!@(! !@$'9 @@@! ` ! @0! !`(!@h8!䏦$'9  @!` ! $@4*( ` ! $@@! @(!d'0 '4@@!\XTPLHD@<8'`<'x!'@<840,('TT' '9!X !@3@!B2b@p 䈏 T $#`B1"@䏦 T !@(!'9  @!2b@ D T!@<840,('H<'w!'Я,($(!C$0B!@0!䬃'9T $ !'  8!@0!,(!'0<'w!'Я,('9 !@@! !0B' $@8!  @!,(`!'0<'v|!'Я($ !8+0!!@(! !<8@ 4Qp@(! !0@b @@! $h@@ ! @0!,40$$^ $N` !($ '0<'u|!'840'LL' ( '9 $@K@!PB2"@#p L`(Bb8(  ($ @!$($B`$ '$DE($ '(@L@ 2"8  @!2"@! !840'@ !( $`(,E$ ( $`(,E%,<'s!'د$ !䏄,$B!$@`(!$p$0 <4hp,䏃(!$$P$$P b($ @!Pb( <4Hp$ !'(<'r!'د$ p!E(0! !@(!$ @@!$@!$ '(<'r4!'د !! @@ !'9 @  !(! @0! '( '(<'q!'௿h! @(!, $@(! ' ' <'q!!E(08! `0!<'p!'Я,($ !!! E @@   ! @0!@䏤 (!'9 0!@ 0D' '@ !  <4Bp,($ '0<'o!'Я($ !!BQd @(!' '@$ &!($ '00@B4BB0B@4B0B@4B0B@B<C%B0B@<C%0B@Œ<C%0B@4B 0B@B4BB0B@4B<'m!'د$ !! 𠌢 Q@ ! $ !'(<'md!B(0<'mD!'د$ ! @  bP`!' '@$ '(<'l!'Я,($ V!0B@ $@ ,40$$^ $N$ t &$" @+  !@@!D (!$R@!  0!@@8! l$ 0!%$  $ $  (! $ $  ,($ !'0!0B@$`!<'j!'௿<! @!' <'j!'<840,(!!!!!'x@ !(!$*` $䏙PE(0P $$" @8!<840,('@<'i!'Я,($ !!!!   @! |@ ! $"!,($ '0<'i !'د @! !& (!x @0!@!<4Cp `!'(<'h!䏙 $<'h!'Я($ ! ! !@!!@ (! ` !@(!D &1@!2*@!($ '0<'g!'@<840,(! ! !e ! @!@ @!, $P  !Dh @!(@$,0!$( @8!CE B0B@4$Fw@<$FԐ0b@,$G0,$G80B@,$B@0$BHBB0B@,$Bd0$BH, $px @ !@@(!, $B0B@,$E0$EH, $/ 0!8 ! @(!'$D @ @! @!` ! (!0! @8! !(!'9$ `0!` ! $0D'  '$h@@<840,('H<'d!'Я,($ !!!L !I! 3 (! !@(!'9 '@'@ %D @@@! (!@0! '@ @(' (!   !,($ '0<'c!'د 0!'9'8 !@!@ !ݬ@ (!  ! @! ! '(<'b!'Я($ !h !!'! @ @! @! !0!0@8! $ @!` !@@(! @!  !@!($ '0<'a!'9'8 $<'ax!'Я($ !h !!'! @ @! @! !0!0@8! $ @!` !8@@(! @!  !@!($ '0<'`!'د ''9  '(<'`@!'د$ !'9 ' 0!  @ ! @!!$ '(<'_!'Я($ !0!$  ! (!' !'9$ 0 $N ($ '0<'_!'840,(į$  !@ ! !" @`!#0B@`!4b@"$$  (!% $ $d  @ !0 @ !@Z@!\  !0 @ !@!Q@$E$ 8  ! ! @!@3$ @!@$ h@$ ` ! @!0!@8!0,4$cN$L $^È$$ @ $B 0$'  '$l@  !`!840,('@<'\8!'PLHD@<840!!!!'!$<  !@ ! (!@@! $@0,4,0$BN$$^$Ǝ $H<4Bph @!ˆ  !@!`"@3 &$$D @(!  !@ $@0,4,$BN$$^$Ǝ 8!<4Bp 0$'  '$h@|D(0 @@! $@I0,4,$BN$$^$Ǝ:Q =B   @ !pBC @(!`>B  @ !@1@! $@0,4,$BN$$^$Ə0 $H<.4Bp  pBC @(! @!@ @0!&$x @(!@<$ 4Sp@0,4,$BN$$^$Ə<PB0B@R!P | @ !@@! $@<0,4,0$BN$$^$Əd $H<4Sp$ ! $$!  ! (!@@! $@c0,4,$BN$$^$Ə0 $HSP%@L!! p 0!T! !@(! 8!&1@!@&0B@B4BB"*@.*(,!,& @a@!,B0B@B4BB @(!'( ',0! !p@(!@8!`A\ @@@ !0 $ $ @!@ L xx @! !h @! 0!0,4$BN$$^ 8!  ! @(!l @ !  !`!PLHD@<840'X<'S!'د 䏇(!,$B$Я$@ $,b(0$C !<4Dp !'(<'SP!'د h!D $h @!(! ,$@0! '( '(<'R!'௿ !  !' <'RT!B(@<'R4!'ȯ0,($ !!!bQ? d@(!' '@ | @ !@!@ 0  ! @ !@ ` !x @0!@ !@!<4B<<4Cpd  @ !!4Cp0,($ `!'8<'P|!'Я($ !! bPb  !@(!' '@($ '0<'O!'ȯ0,($ !!!%bSd  ! @!(!@0!\  !@ 𠏥 @ !@!<4Cp`! D@(!' 'h@0,($ '8<'N!'99 $<'N!'99 8!<'Nl!'د `(!,$$8 $b(@$C !<4Dp !'(<'M!'LHD@<8x'!!$` !<!0(! 4Qp !0 $ $,@.  @'@!BD4B C@ (@0!'0x (!@!`(!d ! ! '0 @!  !@! '0  !LHD@<8'P<'LX!B(T<'L8!'د$ ! !@(!@ !p !@(!D @ !$ !$ '(<'K!'د$ ! ! !@(!p !@ !$$!B!$!$ '(<'K!'௿!hP (!,$@0! ' <'J!'௿! $b$ b !' <'J(!'௿h  @(!,'  $쏿' <'I!'௿! !' <'Ix!B(P<'IX!'௿!!۠@ !0B' <'H!'د !$,$@4! ',@䏙 ! (! $? '(<'HX!0! $<'H<!'د$ !! ! ! 0!@8!$ @(! '(<'G!'Я($ !! !' '@&&!($ '0<'Gl!$C,b @)4$c[`C!B\!@<$Bԏ<$B܏<$B״<$B䏂<$B쏂,$B,$B(,$B4,$B<,$BD<$BH<'F!'`\XTP8!!HLhD 8L@!  ! @ !@0c8$E`$R$- B0B@$W$- 0B@$M$- 0B@$I$- 0B@$A$- B0B@$N$-  0B@$K$-$ 0B@$C$-( B0B@$V$-4,,0$L $>L8B 0B@], $xL8 0B@$b,b@$$b b $ b,$|,$ 8( $S`L8 0B@$b,b@$$b b $ b,$,$ 80 $ԏ8L$b h 8@(!( $R8LC$ b3!D@DD 8@0!0$E,$Ex<& $8 @(!8L'@D 'D8h@0 $ԏ80 $N8D'H 'L8@`\XTP'h<'A!'D@<840,(!!!X!<4Bpˆ h @ !ˆ @!` | @ !@@! $@p<,4,$$^c$Ɗ P % @ !$#B0@CB 4BB B0B@B 4BB 0B@B 4BB 0B@BB 4B@B B0B@B 4BB 0B@ŽB 4BB 0B@B 4BB 0B@BB 4BB B0B@ŽB 4BB 0B@B 4BB 0B@ŽB <C%B 0B@B C4BB $b$"B$b$"B$b"B"0B@B C4BB $b$"B$b$"B$b"B#$b3$ "@<  !#̌e @ !@@B<$ 4Sp @h Dh @!#0!c,40$$cN$^@8!b"@*@! | @ !@G@! $d!e@ ! &s@@ $@g<,4,$$^Z$Ƒ (!@0!x &D@@"b*@^\ B0@CB 4BB B0B@B 4BB 0B@B 4BB 0B@BB 4B@B B0B@B 4BB 0B@ŽB 4BB 0B@B 4BB 0B@BB 4BB B0B@ŽB 4BB 0B@ŽB 4BB 0B@B C4BB $b$ B$b$ B$b B0B@B C4BB $b$B$b$B$bB$bJ$ @<4Sp   ! h @! ! @(!@*B<$ 4Sp @h Dh @! h @! 0!0,4$BN$($^8! 0 @ !Bb ޠ  $@h $@<h Dh @!0!@8!0,4$cN$h $^<^4Sp | @ !0@@! $@1<,4,$$^$$Ɗ$D @ (!@0!x &D@ $@ <,4,$$^$Ƒ0 $N<4Sp  @(!'  '$@ ! @(!@! @ !`!D@<840,('H<'6x!'௿<4Bp0!8!<4Bp$$BC (!B0B@$ '9= @8!!' <'5!'௿<4Bp0!!<4Bp$B@ (!B0B@$ '9= @!`!' <'5P!'د$ !(,䏙!$`(!$@$  <4hp,䏃(!$$$A$ P b(T  @!Pb(P<4Hp$ !'(<'4!'ȯ0,($ d!! !<4pp,@$$  !'0 0!$ @!!0,($ '8<'3!'@<840,(d!!!X !@<*4Bp @! !&1!@2*U%`,Ўd $` !' 0!d @!!@<840,('H<'2!'HD@<840,( l!!!`d ! @@! @@!  !  ` !   ! !<4BpF@!hܯ@ !(!0! 8! @@!` ! @(! @,@!<4Bp"# $ @h ` !  !h @! 0,4$BN$  $^  @ ! <4Bp"! !HD@<840,(`!'P<'0!'840,($ l!!! !@ @! @!@0!`8!@ !@(! @ ! ` !!<4BpP @! !`@ (! @@!  !!840,($ '@<'/L!'840,($ l!!! !@ @! @!@0!8!@ !@`(! @ !  !!<4Bp @!` !`@ (! @@!  !!840,($ '@ ! @B0B@$`!<'-!'د $! !h@@ !  ! @(! @ !@!! '(<'-8!'௿ @ !t ' <',!'\XTPLHD@<8$ !,($ !d! !!!!@$!h  !@ @! @! !0!0@8! $ $@! @ !$$ @!0 @ !@!$*t ! ' @i*@*$ $@!*@ $ 0!@@!'$ $$ @!PS3 0X,  !@)`,Bb! $,BE  !@$$,d E !  !,\E0! @!@ d@(!d'( ',@@w0,(,D @ @! @! (!0!@8! '0 d@(!d'( ',h@ 0@0!( $ $ @!@' !W,$SD,$SHh  ! !h @!`0!0,4$BN$P$^ 8!0   !$   !@!\XTPLHD@<8`!'`<''!'Я,($ !!!@ ! (!8!@@ !!@!!f @ !(!0d@$ p  !@b p  !<4Qu$<4Qu !,($ `!'0<'&!'Я,($ !!!!$ xb ! $ !@!$@ ! (!@8! &@@! < C%,($ '0<'%!'Я($ <!!x4Bp!!(!$ @ !0 0 ` ! !($ '0<'% !'p|xtplh0D!!bX@!X$BdbX@\`<34Cp0B@-!p  0@$@! @"! $0@h 0@0!,40$$^ $N0< 4u0!Bޠ 0$Q :ݬ  (!0@/@! 0 !p @(!0@$$($b  0@B('9]  !00! !@'X &10<4Bb$&1@$bb@Yxȏ4,c,bU!D$$ $x0,B,Du!q  !0#$b! #0@6ޠ 0xx @!0h @!0H @!0h @!x0d,c,cu!f 0,4$BN$$$^ $00p@4 '80$b$b @= $0@/h 0, $  !#,B@ !  (! $0@h 0,$040@0!$^ $N00 \0pb@ 4 '80 '80`@~<b`4cMC4$q$Dq$BPHL 0 @ !0  $ 0@!'H$B@ $0@@ޠ 0xx @!0h @!0H @!0 !h @!`<b4Mg0xd,c,cd!c(0,4$c08$BN $,$d$^'H 90  !0x,c,bD!E,bD!`B4(!@ ! E0p@`$Be! +ďp  !0`  @ !0\@@D\`!$\ $0@/H 0  @!0h @!0\ @!0`@!,$G,$G0,4$BN$$^ @0!0< 4u0X  !0\|xtplh`!'<'!'XTPLHD@<!!!!4Pp0!! ! $@0@ %@0! '00 ! $ 0`(!x@8!' @!0 '  !8@4,4B, @(!'4 '8@!@8BB0B@,4B,bA,4B,b0B@,4B, 0B@b4Bbd @(!\ 0!@b4Bbd !0! '' @!!XTPLHD@'`<'!'HD@<840,(!!!!$$$h4 @8!'$ &&Kԏ`@$$$$$@!$,\&$Ɠ (!@a $@Zh @0!,40$$^ $NIbD | @ !@(@!hD  !&%Kԏ4$FhD  $$Q!@0 ! @! !0!@8! & @ @ ! $@@!'  $@!@ !p  $@w@! | @ !@j@!  @ !  & @\b0  !@Ub | @ !@HbB@`b$ b(0+'$x `(!@7(!$0! '$@/c `BC < C%%B 0B@ &,\ !$Ɠ (!X@F ! (!@ D $d0 B     !` ` !$ YQUBAQ$b'$@b# | @ !@/@!hD  !@0!,4$4 D 'P$ (!@ h @ !D @(!@< BC%Bt<4u @ !t<@ ! 4uHD@<840,('P<'D!'\XTPLHD@<8!ph !($,0 ! !p @(!@ $t`𠏤h (!,@߯,pȎ(d @@!t<4u  !~t@ $$e  !` $ cb '9]  !@t`$   t !`(!0!'9r 8!(t`(!'9e0 0! @ b 0B@<4Bp0`p`}{$&c B0B@) $ !$@(!BS 0@! p@(!d'  '$@ !d  (!y0B@'9] `(! < b%;0@20B@a ]2 @ !p @(!@De @ D 610B@B0B@X @",B@$b 0B@$'9] `(!  @`(!'9^ & < C%ή[$Y\  !@!<\4Bb$  !@ @!@0!0t $E @@!<4Bu (p@(!d  0!@ @!<4Bu  @ !5B0B@4B  !(!0d $F @<4Bu  @ ! !`(!0!8!'9r (`(!0!'9e0 8!_0\XTPLHD@<8'`<' !'Я($ !!8!$0! @(!0<%'9r "0($ '0<' !'TPLHD@<840<!!\!h4Pp@`<c4Bp!@!䏥\ !$Yy$`0!@8! @H0B@:&,b!@2!4$c[C!B\!@$I $bTCb0B@> @4@!0d$$  $ "@!$hD  ! @(!@!"@#`@ ` ! (!x @0!@   !<4^pd D@(!'  '$@!P` !w (! !X (!@@! $@I,40$8$^ $N?(D hD @(!$,\ $p@D " D @!8 @ ! !@0!, $|""<C%"(X,䏰,'9]  !@PBȎD( @@!t,< 4u,< C%9$$,D (!%'9]$,$ D'9]  (! , @,$  (!&D'9^  ,<Cd%C d@(!'( ',@bw<4^p !0! !@(! `8!@!䏥\ !`0!@8!$Yy !TPLHD@<840'X<'l!'TPLHD@<840dX!`<-4Bp`XD (!$@! PX$bP4 @7<C$C2(  @+B0B@% @@ `  @0!@<4Bp`` $X(! `d ! @0!@!  ! ' @@! <4Bu$X($b(  @@!@ ! !@!B(ȌD `,2V$B@T@!4+ @%h @!0$SHh 0$BH,Θ`0!$T@8!  ! R@ @ ! @@!   !   $ @$'H'9 H (! 0!, $\ $'90 'H  '( hd`\XTP'p<'!'ȯ40,($ !!!{!y< $d@q@!x' (! $x'@` !(! $d' !x(! $d@ !`0!,8! $$C $(! @ !,Q@!`8!'  0!DDX$ @ @! ' DPDX0! 8!@!  @ !  $@$''9 (! 0!, $Џ$'90 ' ' 40,($ '8<'!'௿菄,,$P!$ $!,<$$ $ʘ!,,$<$X ' <'@!'د$ 详04,!'$'9  ! ',@!''90 $!$ '(<'׬!'د$ '!'9 $P  !''90 $$ '(<',!'<840,(!!$S$' `! ! !P0! 8!@ !(! @!$$R0@! ' @!DCX$1b$$"! ! $@'$`! $<b4M8!,$d()1@0#00!0 0#$@! '$ !<840,('@<'!'د 䯠8! $ '(<'Հ!'Я,($ '$'9 (!$4DxD&X  !$Xx0!菅,$R@! $$Xx@!,D$  $XЏ$Xx@!,D$D $Xԏ$Xx@!,D$ $X؏$Xx@!,D$ $X܏$Xx@!,D$X $X$Xx@!,D$ $X䏼$Xx@!,D$ $X菼$Xx@!,D$( $X쏼$Xx@!,D$X $X$Xx@!,D$ $X$Xx@!,D$$ $X$Xx@!,D$ $X''90 $,($ '0<'D!'د D $BX!@!'9P t (!  '(<'!'ȯ0,($ D!$cXC!!@!'9P  (! @0!@!@$ $@''9 @(!`0!, $$'90 '!0,($ '8<'Ѱ!'840,(D!$cXC!!@!'9P  (!$ @0!@!@$ $@' '9 @(!`0!, $H$'90 ' !840,('@<'А!'ȯ0,($ 菒D!$Q$' ! BX@(!$' ! DP$QXq!d &* @$4x ! (!$'90 ' ` !@!@X''90 $!0,($ '8<'`!'840,(!!$' '9! !P@ !T`(!0! 8! @!' '90 $!840,('@<'Π!'د$ '!'9 $  !''90 $$ '(<' !x <'!'LHD@<8!!!( @$ <j4Bp$R@! ' 0!` !x (!(!,菑D'9 $|$Xx@(!@!'$'(','9p @" $@$'0@! 0$Xx'9 @(!, $$'90 '0,@ $@` !(XE 0!'9$  !('90 $ '90 ' !LHD@<8'P<'!'LHD@<840,(诤 !$''٨! !QBQ$dB^&X[.b@$$ (!SR$b.b@$$b ;b"$b5Ȏ$ (!.@$ (! !X @(!@$ (! ! @(!$ (!@!P*@(!d$  !@(! 0! D ļ&X!$ @!$eB$&X!D $$P0! '$B#@! $@@!''٨$ DDXx'9  @0!, $$! '@!LHD@<840,('P<'!$0!'9 8!<'!0!8!'9 $<'Ȭ!'د ! !(!@$  Q!$! '(<'<!'ȯ40,($ 菂DD!!$'9PXp 'qX@ !X2x .eX@T !4c"(! $@(!D,BX@$ $'90 '!bXD dX $'90 '$40,($ '8<'!'ȯ0,($ 菒D!'9$! 'PX !X xCXb4BbDBX@ $'90 'TDX(! $`(!,@$BXЌD DX ''90 $0,($ $'8<'d!'د D0X X @!XD  $D,BX@$, ! '(<'Ĵ!'Я,($ !$''9 !@!@!D,BX&@$% &1DBX@0 $N''90 $,($ !'0<'!'ȯ40,(D菙BXx!$@ ! 8! (!'9 @E@!$$ ' @;$'9 DXx'9  (!@0!, $P$'  $'$@$'9 $DXx'9 @(!, $$'$'90 !40,('8<'8!'xtplhd`\X菑D!!$'@&@ !"X@!@  ! (!@!$î"X@DBXt@-@1!&-x'  !(! $&-b!$$ (! &R(0!&s@$Џ%'9 @ !'9  @!'9$  !B@D,D$$X$ @X$,D$ $X$,D$ $X$,&( $(@$i(($ib?'D,菙$$tD'9 @D@$m( $@B'H&$ H, $$,'H $@,'L&$ L, $|$'L $@'P&$ P, $$'P'90 '@'90 $!xtplhd`\X'<'<! $B- !'9  <' !'ȯ40,(($B-!%$8!'9 !@!@F$ ' @$'9 '9 @ !&@(!, $̏' '90 $$"!DCX$1b$ $@'$'9 $%, $$'90 '$!40,('8<'p!'௿#0B@ @$d p @(!@'9` ' <'!'Я,($ DBXt@G!D菅,$Xx$R$(0!8!@! @8@!,$Xx0!$<8!@! @-@!,$Xx0!$T8!@! @"@!,$Xx0!$l8!@! @@! @$Q ! &1D '9` $"!,($ `!'0<'D!'Я($ <!4Cp!*@&$  $''9 0!$$P ! $ 0!$! $'9 $$ '90 '!($ `!'0<'P!'ȯ0,($ !@H! B'9$ @: Ef.Pg( @ !@ !h @!F@(!'9 &D@ !'9  @!'9$  !  !D @@`>$ d (! Be @ !@ @!&D(!x @0!@! $@$''9 , $$'90 '$!0,($ '8<'!'Я,($  ,R`|!4$c[C!B\!@ B$B@h@e$DE-ԎdXx''''9p @S@!@I!,#!C!E'9 $dXx@(!0!8!'9 @!@$@! $@'$'9 dXx'9 @(!, $$'90 ''9$ @ !&1"*@菤'90 ^!$P͔! !@U@!! $@O@! $@'$'9 , $$'90 '8'$~| !$ $(!, $b-@!$B.T!E$b-!D &$b-!B@D$CXt`$ !$L\$  $@$(! $ @!DSX$dbH$e $@'$'9 , $ $'90 '@ !$P! $!@ ! $@!@%$$ $e@$e'$'9 , $X$'90 '$ebJ$f $@'$'9 , $$'90 '@ !'9 $$@ !'9 $@@!$ $f@$f'$'9 , $$'90 '$fbJ$g $@'ď$'9 ď, $$'90 'ď@ !'9 $$@ !'9 $@@!$ $g@$g'$'9 ȏ, $($'90 'ȏ$gb$h $@$''9 ̏, $X$'90 '̏@ !'9 $$@ !'9 $ '  !x(! $l.P'(, !$ƹ $d@@ !DDXx菑菅,$W&&Ҁ$8!! @#@!&1Ҁ8! !(! ! 0! !(!x $l.P !,$d $ƺ@@ !DDXx, 0!8!$T! @@! !(!0! ! 8!$ $h@$h'$'9 Џ, $$'90 'Џ$hbJ$i $@'ԏ$'9 ԏ, $$'90 'ԏ@ !'9 $$@ !'9 $ @@!$ $i@$i'$'9 ؏, $쏼$'90 '؏$ibJ$j $@'܏$'9 ܏, $$'90 '܏@ !'9 $$@ !'9 $ @_@!$ $j@$j'$'9 , $T$'90 '$jbJ$k $@'䏙$'9 䏼, $$'90 '䏼@ !'9 $$@ !'9 $ @@!$ $k@$k'$'9 菼, $$'90 '菼$kb$l $@'쏙$'9 쏼, $쏼$'90 '쏼 $ @ !'9 $$$ @ !'9  (!@1@!$D菔 &5dXx$ &10!,Θ$$$  $."dXx$ (Θ0!$c-(!, $D&1."@$ $l@$l'$'9 , $p$'90 '$lbH $@'􏙀$'9 , $$'90 '@ !'9 $$@ !'9 $@I@! $@$''9 , $؏$'90 'a@ !'9 $Z ! B$B@ND$ !JCXt B$B@>,X $7$DDXx$Q ! `8! ,Θd$`  $@'$'9 DXx ! @(!, $$'90 ' ! !,($  !'0<'\!'௿ !(!$ @@ ! !!' <'!'௿ !<@$ @!$!' <'!'Я($ D!BXt@6!4$$$!@0@!  $@'9D " h@R$$ @0!$ $'9 @!0!$ '9  $`(!'9 $ #$($ `!'0<'X!'HD@<8!!!!$@$  $@'9x "$@DBXt@'9D  !"$@"B0B@80%4@   @ !@!h @ !@0!0((B@$g 0$GH4,4B$@ !  $@(!'0 '4@8'($Ɗp'  $ "$@M$'9 $" @$F$'9 $菐`0!$'9 $' $&  $@h @ !& 0$BH& @0!$! $$h @0!$! $'9 $$C5DDXx -#$"B0B@'$$&  ' @h @ !@0!0$BH@0!& $ $&$$'9 $'9 $@ @ !x' (! $ "4B"HD@<8'P<'!'Я($ !!DBXBP ! (!'9x $'9  @(!' '@ !($ '0<'8!'<840,(!!! 0B@B @$ & 'S(!"D  $ @ !bD+@b`dd D@(!' '  @H(!d | @ !@!@  $@:'$&$ $, $Џ$'90 '$"(!D $  @  &Dx @0!@  "D  $ $ '90 '<840,('@<'!'ȯ0,($ !! !`JHF(! $@ b( @! !0!(@8! $ @!@! "h@@ ! @ !(! $1 d@(!' '@ @ !b4Bb0,($ '8<'!DBX,Bm<'!'Я($ , !@r@pBB0B@jB$@ '9D @ !B$@\ | @ !@O@!F$$ '9 $$`0!8!'9 $ h ` !@ @! @! !0!4@8! $@@!@ ! (! !$ @!@ !(!'98 @0! ` ! !($  '0($ '0<'!'௿!!'9  p @(!@'9 ' <' !'د , !@X V0 RB0B@8"DH!(! $@!" $D( "BL@B@픎0  #eL @ !(" @(# b4B b" DB0B@ "菿 FDE@'98 '( '(<'t!'840,($ !!^0B@X @T@P$ '9 '@@$ d Dp @(!@, !PB$@(!'9  P$$s$`! $0!$`! $ 0!$`! $'9 $ @ !@!'90 '840,($ '@<'!'Я($ D!BXt@X!V@R @N@! @'94 $@'9D @!Q bs$0B@h @!0$RH 0!$ $Q ! $`0!$  ! $@0!$ '9  $& '9 $  ($ `!'0<'!'<840,(!!! !!#0B@!0B@0B@!" @DBXt@$ @ &'9 `0!@!'94  !" @$`$$  !"!@cb&R !$P! $ !! $&  !'9 $"@ !F '9 $@0! !&p! $" !F$! $"B0B@h$ 0$BH@0! !&Y  $&&p !! $& !$! 0& !! $& !$C " @DDXx # #4cB0B@1#8'$$Ɗp' $ "$@'0$FH$&Y  $$(h @0!0$BH@0!&Y $ $& &y$ $& $"4B "$<840,(`!'@<'!'XTPLHD@D$1!#X!!!b'!X (!@ !D0 @!'  '$ @d#C#$D!C!(! ! `0!#X@!$1b!'( ',(@d#C#,D!C!` P#dޠ @!! $@-$'0'9 0@h @ !<b,$BBD<b4M%,8!$()1@0#00!0 &0#$'90 '0 @ !DCX$1b^!s`Z!rBs@*$ '4@$'9 4Dh Dh @!@ !ؐ @! (!0!,@8! $H$#'4 $'8@$'9 8Dh @ !ؐ @!(!@0!, $h$'8'90 XTPLHD@'`$! $$`!((*@*#`!<'d!'XTPLHD@<8!!!  (!!@!$ ''9 '菙 $$ '90 'b @f d$ @ @!(!@0!x ' @@! $@'$$'9 $, $$,'$$ @ @!(!@0!x '(@@! $@',$'9 ,, $$','90  @@ ! @@!ޠ   ޠ @! $@u'0$'9 0, $$'0c픏 ( F.P @ ! @!((F.P @ !@!F.P$$Q  !pt $h  !@0!$ ! $0!$$P! $$S`! $$C$F.P ! $h  !@0!$ ! $$$! 0!$!0! $`! $  (   !  !!XTPLHD@<8'`<'(!'د D 4FX! ! `(!@!T  ! ! '(<'!'د$ !!4!$ "D'9$ @&$@$@! #@ dE$'9$ d'9 @@!"E  @! @@!$@!$ '(<'!'د$ !$ !((!"D #(!d8$  B #(!dB P $ #$b(!@ !B@$  @B$ '(<'!!D$e '9$ D$'9 <'d!'Я,($ !!G!D!'9  @<!D'9 ( `(!@4!bE D'9$ @q0'9  !@(!% D @!bE D'9$ $@(!bD $ B @ !'9 8 `(!!,($ '0<'~!'\XTPLHD@<8!' $'٨ P,&Y  !@B(!0$QH@  @!c.P(Xe8! ! @!&YP0  !@B(!0$QH@ ! @!c.P(eX8! !  $0d0 $  !ޠ0 @! `b@3` $@'$'٨$ $ hD  @0!,e  $$1'$ $@'('٨$ (, $<$'( @@! $@','٨$ ,, $l$','90 s0  !B!0 B`0!0d @0! B$cE4BdF B@!B @0B@ @0!&x @(!@4  @0!&x @(!@ @ !DBX@hD Dh @!Dh @! (!0!,@8! $!@!`!c@1`!  !  !0 ' '90 $\XTPLHD@<8'`!&&,B<'y !'䯾௷ܯدԯЯ̯ȯįd!! ! !p @(!@0B@0b@D%X$Px!  !@!$X (!@@%DBX@0B@B0B@(!茆'9x2B8 0 !1B80'9 (!@!莤(!'9x $ !(!'9 $@@!DBX@+hD @!B0B@h @8!0$GHB0B@0$F 0$FHH(! $ 0B@R$'9 ''P !x(! $'p` !x(! $8' !x(! $4'$x(! @ ! <D$`DX,4BC%,$P$` !|$Bltxp   !$'90 ' !'9\ (!  ! !@(!'9 '  !@!䏾܏؏ԏЏ̏ȏď'<'t!'0ȯįd!! !` !p @(!@d !D崌FX`(! 'P$'诠'9 'p !(!x$ '@ !(!x $8(!$4x  !<|D`DX,p4BC%,$P$@ !$Bt x  !$'90 'p  ! !@(!'9P 0!  !@!ȏď'<'rh!'TPLHD@<8!!$C(cD(4$0(, !` ! @!@!!' Q!ED  @&0pQ!B@Q!B@n!$'9 '(',`%`!b@!b@0$ @ @!@ !(!< @0!1 "@"B@*, ,@ !0  $ @!$',$ 8!'9 l @ '0d '4@!@ !@(!,   !$'90 '(!TPLHD@<8`!'X<'o!'௿!8 ' <'oD!'d`\XTPLHD@!, !@ !e  ! @!e @ !@!$' $S,`! $V usq$miD (!@b@!CB0B@B0B@XB0B@UD4 (! $ 0B@G !(!'9 0!(!D $ @(!8!D0!dX$ @, $@&'$$`! $, $l$h'$(!'9 8 @ !, !04B @4@! $@&$'(`! (0'9  !@0  @ !0!,e $ @8!$'90 '('9D ', @$@! $@'0$`! 0< 4p !@0!, $$'0'90 C0<d4B,b%$  $@ $@'4$`! 4< 4p !@0!, $$'40 ! &@ @!(!@0!<  !@ $@c'8$`! 8< 4p !@0!, $ $'8D0'9 @DD菥,$Y'9  0!@ @0 $@"'<$`! <h  !ؐ @!(!@0!, $<$'90 '<'9D ',( ! $' '90 $  !  !  !,@!DBX@ ,FE  $h,d`\XTPLHD@`!'h<'g!'Я,($ !8!!6!(!D$  $ (!@(!'9 (  !@$ !"!BD $ *@!"@ 菤'9$ @ @!$' '(!@@0!!,($ `!'0<'f!'hd`\XTPLH!!$' &Y$ ! !ޠ @ B0@900B@ ! @-& @ @!'$@0!x (!@$ '($@&Y (, $$'90 '(1 $ޠ @~@!$1DXQ', '0,@d#C#0D!C!D$DX0! 8!XQ', '0,(!@d#C#0XD!C! S#$ @!@>$'4'9 4 h @!,$CBD,$C<b4BM")@E#E!"0#,$B̏,$B䏄,$@8! $'90 '4DCX$1b\`Xrs$$ '8@$'9 8Dh @(!, $,'8'90 $ $'<@$'9 <Dh Dh @!@ !ؐ @! (!0!,@8! $H$'90 '< 0@ @O $@H$'@'9 @h @!0$THh @!0$SHh @!0$RHؐ  !(!0,$BH$\`0!@8! $'90 '@ 0B30  !@ @! !(!x @0!@ $@'D$'9 D, $$'90 'D&1i ' '90 $!hd`\XTPLH'p<'^p!'\XTPLHD@<8!!!$  (!@!$$ $@$''9 , $Џ$'90 '$"@5 !菤 '9  @ $@(!' ' @ (!菞D$& '$X@'9  !@(! DBX'9Dx @$ '9 l  (!@V莤0'9 @'9   !'9  !5$ޠ @$&$&%'9%@ $$'(&0, (" &2 @!"" $ & l  (!@$$ $P (!  (!@$0 @qB',D '0 (!@& lD'9h @]D'9  (!!/0" !D  (!@+(!0 @FB',BD '0 (!@& lBD'9h @3$B (!D'9 !0@4&$$'9$  0!@*@!0 @', '0 (!@& l'9h  !@ !$0$ B'9  (!@0B$$&٧0 '(`BED'9  0!'9  !0$T! @$'9   !$ޠ $ޠ $bG&0D% $Y'9 0!@6@! $@&$'4 4!  !@  ` ! 0!,@8! $&٧0$ '4'9D @ !$   !&%'9%@ 0! $ 4BX@'9l $'90 '$!\XTPLHD@<8'`<'V!'D@<840,(DX!X! xDBX@ $XBB B0B@ $"$'9 D&XB!Uh B@MhD @(!,'9 $dXx@(!0!8!'9 @!@%&X $@&X' $'9 dXx'9 @(!, $0$'90 ' &X0B!D $H'9$  !X !B8!E '9 0!D@<840,('H<'T$!'Я,(!!P!'Я,($ @!!!, '@0!x  (!@$ '@$'9 , $$'90 '<4Ppt ! @0!@! (!@' !,($ '0<'=!'Я,($ !!!$L  @!$ b $t !(! 0!&@!@@$ b $ Ќ  !,($ '0<';!'௿'9  @$P ! &@$B Cd$C$!' <';H!'ȯ40,($ $!!!!$,@ !'9Ô &d@<4BpD$X@ ! !8 $<@@!X@<@ !,$Dx(!, $ƀ<4BpyX $ @!$"*"@$" C.t C.pC.xDCX$B$B 1&RD,BX$ƨD,BX$@ 菑D'9l &d'9 @ !0X@ !X x#Xb@ !E '9P `0!&R@$$ D ` !'9l X@, $  !X!40,($ '8<'8!'௿DBXt@ !'9:l @!$!' <'7!'840,($ L!! !@!$,D` !&('9Ô "X@!<4Cp$  $"X@@(!, $< @ !@! &0"X@$B| D"X@0 $N<@ ! $d@@!"X@<,@(! $X<$4Vp'9l ` !'9 &(0!D@DX (!   !"X@$, $ǀ$b$ '9:l @$ '9 $  $ '9l !D@X840,($ `!'@<'4!͜ 0!<'4!'TPLHD@<8'0!(0 $!@ DPX$$D$BXx(菥( !$Tɘ! 0!@@!(菅,D$Ǡ&F$S' `! @b@!(D$U@! @V@!( !! 0!@@!(,&FD$$Ǹ' `! @@@!(,&FD$$' `! @2@!(!D @*@!( !! 0!@o@!(,&FD$$' `! @@!$ DBXt@P&F(,D$ ' `! @E@!,8$` $<$ @!@'4$'9 4(D'9 @(!, $x$'90 '4(D'9 @8! ! D,Θ  $Ȕ   !(D'9@  , &Ȭ, $؏,$D,$D  &Ȭ.", &<, $`&< ."TPLHD@<8'X<'/!'쯲诱䯰௼<,&ed $Ʉ@@!BL@ b+@$bd    !@ !DجDX  !D$rXb$sXX$sb'(, &Dɜ@'($  (!@@! $@$''9  (!, $ɴ$'90 ',\ !& $A !,\$ $@r&\', $@k $@'ď$'9 ď, $쏼$'90 'ďD &Dɜ@ $@A'ȏ$'9 ȏ, $L$*' $@,'̏$'9 ̏, $ʄ$' $@'Џ$'9 Џ(!, $ď$'Џ'90 (&ed $<@=@!L@  ! b+@$ec @!$ b$ b$ b$b  !@@!  !  &$@0! !D4bX $Kԏ   !DBX@($B\BX $@'ԏ$'9 ԏEX, $$'90 'ԏ,ִD $L@ !$T "X(!$8Dx&Y  !$XX 4'9:l @ ! @# $@'؏$'9 ؏, $\$'90 '؏\ DDX&Xx'9ɘ $@ Xx'9@ <c4Dp菓D'9͔ $&dY(!x $ @! )&1  !'(!x$ @!  !BxDx @ !(! $  !(!@$  &dYd!B׬b픏D $&dX(!x$ @!&bX&1@ ! !*#`,'$| $ !D+bX쏲菱䏰!'<''!'D@<8D!BX@k! @a@! a!" @]!"0B@W!DBx&CXC!DM!h B@($G 0$GH" ,' $ˌ$  &QXBx\Q!D ' @)< $@$'0'9 0BxhQ!D @0!,ex $˔$'90 '0!<4Bp@!D@<8`!'H<'%!DBX<'%h!DBX,Bm8B<'%@!'௿X @ B @D'9 !' <'$!'௿D$Xp !$0! 8!Xp' <'$p!D(!D[P $0P<'$H!D!$c[X 8!<4B'b$d%¬!<'#!'د h!&0 8!! !(!!  !@(!X $  @ ! !'( 8!<0B4c $ %0B! 8!<0B4c $@ %B0B!<'"!'د h!&0 8!! !(!!  !@(!X $  @ ! !'( 8!<0B4c $ %0B! 8!<0B4c $ %0B! 8!<0B4c $ %0B! 8!<0B4c $@ %B0B!! 8!<0B4c $ %0B! 8!<0B4c $ %0B! 8!<0B4c $ %0B!<'!'h | x t p$ h! l !(!! $@!V-$x' H !(! $@' (!x$@ $@$3(!,(! $hV@!X' @ ! (! $@!$  @ ! !$ $V@!@ !(! $@S (!@ ! $PX ! $@S' X ! $$C$ ! $V@!x' $ $$ '  ' h@ h,@ ' 0!(! ! h@,C@8!` hH'   !' t ' X' @(! 0! ! l  !H  !@(! 0! ! (! $X'( !`(! $'(@!`8! !' l@ (! @ !@a (! l  l (!CX@0!' X$` !` !`(!0! @J'  ' l@C l@ !  (!@0! l9$ (! ' X@0' X'  ' l@( !`@ !(! 0!@' l @ ! lC l ' @ ,(0$t$D $N! ' ȏٔ ' Xx(!$ '  !  $d @ ! @ !$!h  h @ !@0!,(0$̠$D $N! | x t p' <'!'ȯ40,(  ! @ !< $  @! @ !, $ $  @! @ !< $d ((#D(d[P@8!$c.!$0P 0! ,(0$̴$D@$N40,( '840,('8<'L!'p(0,D$&%D &FN[X&[XB0c` 0G,'$b $8,$͜,'$b$&[X,$'$b &%D',&GN $( '$&%D,&FNC$H [X<4Bb$<4Bb$<4Bb$[X'<'!'د D<Ȏ#[X4B$b$#[X$0! 8!$$0! 8!"[X0B@SDB[`@M'(,$d$\ &g\ $' 'x@'x !(! $\&e\$'9k &F[`$C<,$\$p&G[`  !  !,(0$΀$D $N"[XC%"[Xx&D[`(! $D<4[X<4Bd$b$d$Dx[X$[`(! $ '(<'!'௿D<$[Xb%0B@[X'9r( 菿'9s ' <'0!'ȯ40 !0!@8!0,($cN$Μ $D$D C[\40'8<'!'Я($ ,ִD $؏$@ !h "[P$[Pp @!(!, !$0P$@$菅(0$D$N$[P<`! @!!,(0$$D$N !($ '0<'!'0̯ȯįD0'(C[Tx !$cC[T$(!$(Dbp&N  (!$菙0!$Bw,< ( $@8!,&ED$< $, $π&ED`0!,[t !@&$ϐ$ $`! $[t@0! $$@$[t <@4L@' [t &ED`0!,@$ [t  DX &ED@0!,&N $(̏ȏď'<'P!D<4B[Xb$[X<'$!D< [X$'9r(C% [X<'!D<4B[Xb$[X<'!'௿DB[`@$'9r( <D[XC%[X' <'T!' (,$B\$А@8!'($֯  '((0,&D$( &'N  '( $&D,&&NC$ '<'!'x|xtplh(, $L(@<DC[Xb$@'9t 0B@#DB[`@ <'9t (t4Bb$ B[XC[X<4Bb$<4B(b$C[XC[X<4Bb$C[X0B@<4Bb$0cB[X`v!D"[`@p'(, !$&0 &'[`( !&%[`'9k 0!$(C   !(@$(08!&0&'[` ! $($8!,'0 $p( '0(&eD,#$8(,$B\$l'0$ѯ  (&eD'0,&N $(( '0$(C < ,&eD$Ѽ &NB[XC%'9r($ B[X('9s (D<4B[Xx(!b$[XD$ $[`(Db[X0B@5(0,&%D$ &FN('H !,$ $(&%D0!,&GN $((  !$(C <,&%D$$ &FN(b[XC%b[Xc[X<4Bb$c[XD<@B[XC$@'9s (|xtplh'<' !'HD@<840(!!@!P0! 8!(@@!bP  (p @(!(@}" @w $(@a$h (@!<$TH$h (@!0$PH$h (@!0$RHX$  @ !b(C$b4$F䏂<$F̎"@0$B 0$BH"@,$B0$BH04 ,$BN$$D$^ 8!(B@<X$  (@!<4Rpsb@Dd (d d( (`B@@! @ !(@!@$F$S,0! $|(@!HD@<840'P<'H!( <',!'د ! !@@ ! @$$ @@ !  @@ !   @ !  (!! `!'(<'8!'د$ !!0!@-!"@  (!C $@@ <4BpC%, $,@ @$D<4BpB!$ '(<',!'ȯ40,($ !!!! ,` ! $=@8픠@ $P(! @ !@@!<44Rp $'9 @(!@*@!h$  $%د@0! `8!$ @!0 $$ @(! @ ! `(!"@!40,($ '8<'!'Я($ ,<$Ҙ $d@!@"$,@ !$ '   !$Kb(bL@$i$Ib  ! b$kb !$$ !($ '0<'!'X x'(!! !(! $ 'H` !x(! $( xLxx$P $$Hb4 '9L b%!"@''p@0!8! $ $<d@ ! 4TpB! $P@!+@ B b!bB0B@&&D$ $  $ $ &1"@DC&1&1$$  $  $ $ &1"@EC#`$ b$ b$P$ $ &1"@EC&1&1$P(Q@$S$A(B@$O$# C ` !?$X (!9;!'9  !` #<4Tp$[ b.!, ! $] @&$4#$B\X4@$\8$&g '9 $P @4$B\`$ b$ b $ $ &@DC&&` !'9 (! @ b$@!hd 5  !!C$) b  !Ҩ $( @@!4$B\@ @ ! (! @b <4Tpd'9 @(! @@!C$)b $hd b$ de4@0!48!td`$ @(! b (!` !0!` !$'9 ` !'9 $ ` !'9 (!d 0b@0B@$( (!D 0!$ v@<pt 4Tp @! ! 0! !,@8! $菼 @ ! @!@!$B,B @ !4Y$B] (! @ !$쏆4'p$Q ! $\䏼 @ !4E$B\ $ @ !(!4't ! $\ @43$B\d$B ! $ @!hd  d @!h @8!0$GHb de!0$CHpЯt0!  @!4$B[Юbd@  ! db@ $F$S,d$Ҵ 'p  $ @0,4d$BN$$^ 0! 'p@ ! $ @'9 'HT  X \ ` x'<'!'Я,($ !!'9L !$@!E!$b$"C0b@3B0B@00d$ $ @(!@!, $  !@h  !@ !@0!,Θ $"hD @ !@0!,Θ$0d ! $ @ ! @!@h  !@ !@0!,Θ$ `8! $@ <,40$$^ $N<4Tp  !!,($ '0<'!'ȯ40,($ !!!@5!Qh"  !@$$`! $h @!0!,Θ@8!$L  ! X@$  @0!,40$\$^ $NR40,($ '8<'p!'௿h  @(!,'  $쏿' <'!'௿!      $ !' <'d!$ $ $  <$Bď($B,$BӠ4$BD<$BH<'!'@<8!$$ 0!@!$ <@4$ '0@$2 !' $ 8! 0D$B[$n $@  !DY[   !@<8'H<'!'840,($ !L!!TP!X ! (!+@ ! @!$($r!C$)b &s&R "hD @ !`(!\@0! @!@!@1 $ $;(! 'L8!.@$$</4B<+4Bh  !@0!44$~茄$h 0$BH44 !$~@0! @!<4B!840,($ '@<'t!'د ! !0( '(<'(!'د ! !0, '(<'!'د Ѱ! !00 '(<'!DB[<'p!0!(! $0<'L!l$ $0<',!'@<840$$ 0!A@!,,0$Ӵ$ $ND$D[DP@ !$[ $nDA,,0$$ $N @ ![$ @<840'H[$ ' !$$B`A$cBE!2Q$3b%&D0! 8!A@0!,,0$L]$"0B@' $n䨯 '' @ !'$  8!$ CK,0S=,$$x $N, $Ԡ$((B,P D'$D[E0 '(@( ! ( !, $Ф ,$$԰ $N,,0$$ $Nv<'!'x|xtplhX!,`$ dX,4(4&$$݄$WP $쏼X&$,4,$T${ $P@ dD4 XUdhD Xd0 @!X  @!X@ dhD  X@!0$RHdD X@ dhD X@!4$Q@dD  X@ dhD  X@!0$PHdD$ X@ dhD$ X@0!0$FHdA0$GE0$G,$0B@4$Bl4$B询B0B@L$B0$B䯢0B@,$B4<$B0B@($B<$BdA4$B=܏<$Bk 0B@4$BЏ8$BA`$(0(8$BH,<04,P@HLD$8 0!XD'`D[E0 'dX@%., $XФ X|xtplh'<'\!'௿<d 4Cp @!<4Cp`!' <'!'د !!  @ !@ ! (! @!! '(<'|!'Я,($ ! @ !@(! @!@!  ! D'D[E0 't@,($ '0<'!'د$ !BP D'D[E0 '@$ '(<' !'د$ !!!B4Q D@0!D[E0 8!@$ '(<'!D0!8!D[E0 <'X!'Я($ !,!$8 !|D0 @~@!D b[$B@!b[b[Q+@q[$$,4@( @ ! @(!@` @ !, $D | @ !  | @ ! | @ !  | @ !@! @!$@ @`@ @0!(!Dx $[@Ф !D(! $[  !Ф !($ '0<'t!'`\XTPLH!,!$P !' ` !x(! $D+T!C0$bP<p$@ B @B$@ ,,0<$`$$N4Qp$" @hD @0!,,0$ָ$ $NC<4Bb$b%@ !$CC($b!D!0B@!$@B0B@`!6#0B@`!6#D`!$4q4qhD  Dh @!CD4,0!@8! ' @ @! @ !,$$B0B@ B0B@@!$U|D4 0!$ ' @@! @ !,$0,0@0!$ $N,@B@ @(!,pD @,,0<$l$$N4Qp ,D @ <ؐ 4Qp,$פt '@@lY@ !,,0$$$NC(bA E( @ !@ !h @!D4@0! `(!@!  ! `(!  !,$ PD40! 8!@ @! @ !,s$Pl@ ! $,,0$؄$ $N<4Qp E<4B($(%E@ !(  ' Ф  !`\XTPLH'h<'T!'ȯ0,(!$- $D4 Q%$xC0$b ! @!$hD 0!@8!0,,$cN$ب $$$H $ '$ ' @0,('8<'<!'lhd`\XTPLHh! !  @!@O0B@Ih  !@ @! @! !0!(@8! $ @! @R !@B@ !,,0$$0! $N<4Bp $D @  !`!h$0 !@@ @! @!@8! !,0! $E菼@0X  (!0毢Dh! @ !C@!$%b&0H$H  !@ @ !$c0C!E, ! $@D`0B@DhD @ !@(! @!(B@ !0B@@(! '0< $@ @0! 0.¯0 !%$,\ !$  $@ &$  0.¯0@0!$,\ !$, $@ ! 0.¯&$ 0@0!$'9 4 $@@`0 8<4 .'8@0 @0! '4@@+ $@0! '4@@ @0! '4@144 $@(! '<!4 <4B@!` ` 0@0!, $e菼@0 @@ 0!,,0$8$ $N<h@D @!"[$B "[@!$<g4BpF$$ 0!' @!x@ !(! $ @(!"[ȯ(D !$ $B[$n8!   !L $@ @!$0*@ ! &10*(0,$$$@$p `8! @ !@  !, (! ! $'[0!0,,$BN$t $!lhd`\XTPLH'p<'!'ȯ40,( $!$B(P D' D[E0 '$@$ $,,0F$ٰ$ $N)#0b"A $b ! @(!h$ $0 @!G0,,$BN$$ 0!<4Bp40,('8<'T!'<840x'!$(!! @ ! $0 $h $@0!0,,$N$$ $ ! @(!$ @!!<840'@<'d!'௿0$Tb$ , !<4Bp' <'!<(!`4Bp0D`$[ <'!'\XTPLHD@Dx' F[!$  !!(!p ! (!8!D,T[D$T$8U[$B`$$B (b0$C ,,0$d$ $N,$0 $ڐ$쏙l $菼(!0!,DD&dڜb[ &G[@ ,,0$ڤ$ $NDx(!&[ $n$kD,$[ $Џ�$[&dڜ$$ 8!@ ,,0$$ $N쏙$0$Ɲ$ 8!@ ,,0$$ $ND[(! 0!D[ !(!0! !\XTPLHD@'`!<'ʘ!'د !!h !  @(!  !@(!  !'( 8!<0B4c $ %0B! 8!<0B4c $@ %B0B! 8!<0B4c $ %0B!<' !'د !!h !   @(!   !@(!  !'(!<'d!'د !!h !  @(!  !@(!  !'(! 8!<4B'b$d%¬! 8!<0B4c $ %0B!<'!'د !!h !   @(!   !@(!  !'(<'Ƅ!'د !!h ! $ @(!$  !@(!  !'( 8!<0B4c $ %0B!((!,,!00!<',!DC\D(!$3PC\ ` !<'!DC\D(!$3C\ ` !<'!DC\D(!$3PC\ ` !<'Đ!DC\D(!$3C\ ` !<'\!'د  !! !h@ !  @ !"@!<#$b `(! @!<4C<4C `!'(<'È!'Я($ !' p @(!@t(@'<C% 4@@ ! @<DlD\ (!"@!<4C4Cu($ `!'0<'l!H 0!!<'4!!@ !<'!'د D8!F\$ !l'b @$ `!'(<'!'840,( ! ! e($ @ !  @! (!$ @ ! ` !t @! @ !h @!  !@8!(4f3 $  !  !@ `! $3$1@8!`!  @ !   ! <4Bpd4  840,('@<'!'840,( ! ! e,$ @ !  @! (!$ @ ! ` !t @! @ !h @!  !@8!(4f3 $  !  !@ `! $3$1@8!`!  @ !   ! <4Bpd4  840,('@<'h!'840,( ! ! c0@ !&3p!e 0!  @! % @ ! ` !t @! @ !h @!  !@8!(4f3 $  !  !@ `! $3$2 @8!`!  @ !   ! <4Bpd4  840,('@<'!$B3<'!DB\<'!DB\<'d!D3<'L!'<840,(!$b0Bc0!$ @ !E3 @!D$P\$b @ !,\ $`D$P\h @ !ִ @ !@!@ <4Pp  !,$hh@ ! `(!@@! @ !,$ܔ,0@0!$ $N @ !+h @ ! !@(! $@ @ !@0!,,0$$ $N0  ! @(! @ !p  !@ @! @ !,U$, !$3 $@ @! @ !,B$$b쏃$BƤb3X $B$b 쏃$B b3X$B@b3$3P !(! $@ @! @ !,$L !$3'  $@!!  !,$|,0@0!$ $N!<840,('@<'!'د !! !'9τ $@  ! $'9τ  '(<'!$,0C#,0E` $ဏ,0B@$@,$ ,$ $<'!'<8p'8$ ' @$0@,B$@ $P0B2<0 6!<8'@<'l!'௿0F $,$$$<! $`!' <'!'`,$ $\'(!x $(!$0x  !$',,`$$ݰ  '$, $⨏!'<' !'د ,!$ $ @!4A ! @"@!#,,b @!h$菙 !@$$% ! $ %"$H" $0 C @!,$ $ '(<'!8!D0!$E, $<'!'د 0 @!,$FL4$F@,$GT,$G`,$ $l$b @8,@$ d@$ @ $@ $ b$8C8,G$%  $㜏$"$$8",$ $ď$8,P$ 0!$*@$ $@$@$'9  $$,$ $ ! `!'(<'\!'௿,$FT,$F`,$ $   !' <'!'`$$(@$'1$$.!,$P $$$L$','$ $$$L$'$,'$ $$ $ L$'$ !!'<'!'௿,!$ $$ !􏙝LC 0C\`7 ,h !@ $<  $D$$! !,h@ $`  $E$$,0c$`$ !' <'h!'د$ ,!$ $ @!̏0a !,Bh@ $帎  $C!  !$,h P!0(@$@@!#h+@$e @! $$F $$% ,B$B$ '(<'!'௿  @ !!' <'!'௿ $@0!,@! $  !!' <'8! <'!'ȯ40,(,!$00 $'9ߘ ' ,h !@$L `! , $ "@!$, @!A$x"hR&, $ $G hb", $Я $$  $$! !40,('8<'x!'௿,$ $ , $8!' <'!'௿<!$  $( @ , $T !<'!'௿,$ $h $$' <',!'௿,$ $|, $猏!' <'!'௿,$ $稏` !' <'x!'௿,$ $ȏ( $菼, $ $, $T !<'!'诿 ,&3$$ $( '@!N,$8 $( ' $,@$d,$ $蘏 p`&'@?$` #3$b,$ $$,0!DD\ $ "3@9,h$ $/ C3$b$, $8$DD\  0!@$,h$d,$  , $Џ  '<'p!@0$CD<'<!'د$ 􏅀,F$$ | @$, $D'9ߘ '@@%D  &\ @$,h$p\ $ 0!@ $,h$$ , $ď$$ $@$,$,$$  $ '(<'!'Я,($ !!!, !$H 'Q!&1*$ b&,($ '0<' !'<840,( $!!6!N$,(! 0! &L &L `(! @Q`0!h,DE $h`8!  E$BT $ &$,$h $ !(!, $L A@!,h$눏,$`0! $  !<840,('@<'!'ȯ0,($ !!!p$$x,<' !(! $$+$d@(! !  !',ͨ $菼  !$G&dLl(!  0! !(!x $&dL(!0! $@8 ! (!@2!0$ !(! $&dL(! 0! $@!$+$  !Q!BP$@  !$B&G+`!d@ !@0! '!$0,($ `!'8<'T!'H,' $L@ B$,$C$ !,$ $$'<'!,(!$0!'9 8!<'!'௿0!,$$A'9 $' <'0!'௿,(!$,0!'9 8!' <'!'௿0!,$$F'9 $,' <'!'௿,(!$D0!'9 8!' <'@!'௿0!,$$F'9 $D' <'!'௿,(!$P0!'9 8!' <'!'௿!0!,$$G$P` $0c'9 C' <'4!'௿,(!$p0!'9 8!' <'!'௿0!,$$H'9 $p' <'!'ȯ0,($ $ !$,$UL (!$$! 0!, 8!$,$윏,&f $츏&! &fЏ !'90 @(!(!0!,$! $̏,h&f$$8!,&f$$ !0,($ '8<'8!'쯴诳䯲௱ܯد,$ $$bLHIJ Kc!,$UL (!$$8!įȯ̯! ԏ,@(!$$68!! ',@8!$`0!($  !'90 ' (!'  $ `0!$,h@$ $,$8 $ !,h$$$ '!쏴菳䏲܏'<'`!'\XTPLHD@<8,,$$b\MHIJ KLc\ (!$TL0!$!!$ &t$(,04,, 6&t&' =$, &(!0!! $A&SF&&' *$, '`(!0!! $A&Q'&' $ & (!0!! $!&&$'   !,h$$$ ' !\XTPLHD@<8'`<'D!'\XTPLHD@<8,,$$bLHIJ Kc (!$TL$8!!!$ &t$(,0,, 4&t&' =$, &(!$! 8!&SF&&' *$, '`(!$! 8!&Q'&' $ & (!$! 8!&&$'   !,h$$$ ' !\XTPLHD@<8'`<'0!'PLHD@ ,,,$bEHFG cB,(&e048<!, &L &L@&E " @!&H,&g$$@ '(" #  !,h$$$ '( $PLHD@'X<'!'LHD@,,,$b$JFGH Ic$B!$&DL $(,046 $$& &&DL, $ '8@@!$#8C$#<C !$,h$<$ ' !LHD@'P<'!'௿,,$L $L@!$,A$X $,0!$ $' <'$!'௿,!$ !$$$`! 0!,,$L $L 0!$,$ !' <'p!'840,($ !,!$$!! $!! $,$8 $c,`0!$d $  &s@, $ $̏$,$#$ $m*b$, $ !(!, 0!, $菼T  !@!| @E$B&B*b4 8$K $ˏ$,$$$  $3 ,$ $($ ,$$$D $*b,$ $`$ ,$$$| $*b !*b@l h,$ $ !840,($ '@<' !'HD@<840,(帏,$F$!$$ $$,,$ $@@!0 !F(!'9` 8!@$, $<$3 $d@ @!,$ $8$ $@@!D@ ! (!@Ȭ !  (!$C' (  !@!8 ! `!   !@4$Fԏ4$FX,$ $X@,  $t$ @$q,$ $ $񐏼 !S! $ڤ !(!$ $Q@!4R ! `(! !(! @! h,$ $񬏼 ,  $ȏ$ $r $!   !h,$ $!HD@<840,('P<'`!'8,!$ $$,$2$,8$$H$l ! ' @' ,$$X,$ $򈏼 !'0! 8!@, h $򴏼$ $H$ $  @@!, h0$쏦 !$R` (!@! 8!@' !(!  0!@, hN$4  !  @@!, h$T $ $$ $ !@(!@! 8!@w !؏' '@!$b, h $|$ $p $Z`, h$ $ $H,Ĵ'  $؏@ $`,$b ,$ $, $L $$ $H $h` @,$Gt,$G􄏂,$G,' $ $ 4  !,$ $`!'<'!'௿,XD $ $, $  @ !ȼ@ \0 \0 B4@@ ! h ' <'!'HD$&\4$c@a$B,$ $8􏒀  @ !$B4, $PD4${b4D*@Bd4&\4b!e0$(% e&\4'  8!$ $ $d4༯$' 0! 8!A@! DX @0!$07$<@&\4B4Bq!c0BC0c`#$, $l D4 @(!@ @ !@0!$, $&&\4,0!$$ '<'!'௿ $h ޔ $ @! x@! @!!!' <' !'Я($ !!!!q!(`F !$ &1*" @&@@!($ '0<'!CBC%0B+<'`!B0B8B,B<'4!'د$ !(!Pl ! Q !  (! !$l  '($ '(<'~!'<840,($ !,!$د$`0!!S 8!&P !x(! $ FCDEDŽCD E F Q B S U !&E쏑'9  B#`F@F!C!B@$, $C%` !@C!E!Y (!@V(!X&D$ $@x&D$(! $ 􏙔 $@ $,$0,$$X 0!$4B $܏0!&$0$GB|,$$|$0B$&$0$GB|,$$$<840,($  '@<840,($ '@<'{!'د ̈́$6 6 '(<'{`!'8x'` !(! $􏅀,$'$ $0B@ 0cB $$,N$$Bb  $$,B$ $$*@b!d!b@ @ !4$K $%@C!E!Y ` !@ L @0!$,$$ @$L$  @0!$,$@ '<'yP!'Я($ ո!! ! !,0! !$dL@ @8!($ $`! '0`(!($  '0<'x!'௿ @ B@$ ' ' <'x8!'د 􏅀,$ $!4D@B0B@0c$($B0B`H@ XB0B@ " 4B" '( '(<'wL!'௿,$c$ $` $c$$c, $؏D ' <'v!'0ȯį x' !(! $ x'($(!$ ! ʴ  ! ,h$@8! $ $l,,$B$.$0 ! $ ȏď'<'u!B<'u!'ȯ0,($ !,c0b!$<$ 8!qBD20B8B0B,b!B0B@0!,$h $%6" bX  ` @8!$B,B@ $,0!$ $<R4B,2"$ b  $&f, $ $Dc@C!D!Y  @ $,$&f &g$H ` !̈́(!0! 8!!0BB!0,($ '8<'r! !c08B,c0Bb80B!<'r!'Я,($ !,! $ !,C!C&$@(!& $<,($ !'0<'q!'௿􏅀,F$L $!' <'q!'د$ 􏙺4,b @!$g$0B$<$f@!b诧C!G! <@4c h  !@0!$, $h!$ `!'(<'p!'Я,($ !,B!$0! $ $,@$ <4B"BB"!,($ '0<'o!'د ! !!@!  , 0!$ $ !'(<'oD!'LHD@B0B@R(!x $@ !(!x $ (!,0!$Q'8 ! 8!@@!, 0!$ $쏙8$(! 8!@@!, 0!$ $,, 0!$ $H ! ! A<4C<  @&D}@B4B B@@0!L$ $C&'9  ' $' , $hӄ A ȏ66$ $A*@ ȏ66$ $B  @@0!ȏ$ $D@ @@0!ȏ$ $Eո @&B$C,h$$ &GB4B B,G$ $0B@ 4b" X 4B !LHD@`!'P<'k!'د !!(!@ !!<hB0B@4c  !@(!X  0!! <@4c! `!'(<'j@!4C0B@$ !!<'j!$C$0B@$ !!<'i!!쏄8!$$'9  @(!<'i!!쏄8!$@$'9  @(!<'ih!!쏄8!$@$F'9  @(!<'i8!!쏄8!$ $'9  @(!<'i!'د !!$"X&$0B(!@$ &$&X $@&$F&BX $@&$&X $ ! `!'(<'h@!'௿ְ h,@$ $$$ $!' <'g!'د 帏X$&%!$ &&%X $@&B&%FX $@&&%X $ ! '(<'g !'8 '@ ',h$ $$' $ $,$ $!'<'f@!'د$  !0!$,h$@0C`0H $$ `!'(<'e!'د$ !! !$,D@ $( D ٬0! ! $< 0!,h$$@4p@B  !, 0!$d $!!$ '(<'d!'௿D\@!$B@@ ! \@\C`D8B] (!@` !! \$bD!@\`!' <'c!'0ȯįD!!B]!@M$' 0!8!$ $ $&q' !' 0! 8!@$@!@0!8! $ $༯ !' 0! 8!A @! C$b@0! B!B 2cb0B@$ȏď`!'<'b4!'\XTPLH ,D$ $q\ "0B@!D&\Čb@b @"Ab$@'$$$ $ A @!,$$ @0!@ !$ $ @'@,$%$@ !(! $   !$ $ A @!,$ $0 $@ !$ $ @  !,$$` $  !b\$DBA '(,$ $ $x&\$@ ! (!#\  ,ed$* ( "\D $  ,00B<$60 $$ #\@@(!p$8< ! $ AI!  !@!$ b (b@$$b'8;b3$7'!$$B`A$cBr!d2$ %d'8&(!!$$B`A$cBr!d2$ %'8d(!&0! 8! @!,m$@[8@c a  ! AN  !@!$ b%(b@`I?$b$b6$@'!$$B`A$cB'(b!d2$ %d'8&(!'8!$$B`A$cB'(b!d2$ %'8d(!&0! 8!  @!,$,$ $, #8@,$$T $, $|d$ $$3 C $,$ $ b\$$B$c@a$Bg\$@!Bg!d0 %4d DB]@b\8b\D DC\$b,$$ 0! FF\XTPLH!'`<'[ !'௿D\b0B@ $b@$d \D8B] (!P@d!d \$$b$0!!' <'ZP!'LHD@<840,( `!$b`0!@,g$ $ $,$( $ $f $$ b@$,$L 0! $, $| $$b$, $ efD<0!B\D $ D\D $ @$,h$u$\$'' $ @$,$ $f\D $ @ @!$" $v" 8!,h$ $$\D @!$o b $ȏ,$ $\ B$b $b `0!,$$$$ 2c$bO$\ԌD d@! D*@`0!,$$$񏙉d,$! $,$p $( fg,$l $),0!$ $ $,h$ $ $, $ $,h$ $ $,$D ! fg ,$ $h ! !!!D$\D @@ !!@!*@!#f#$!cQ#b+@ u# #,$ $ $D!\D @@(!f 8!$$+cg+@ (!,h$ $ l$d ! 0! !g !0! $ !#,h$ $ Q$, $ I$$V$vQ$f?!$$b8$6!, $ .$D''\ $ @L$\D $ @@!VQH@8!f_$ $bU+ !@U$, $ $b ,g0!$, $ ` !,h$|$$p DB\D LHD@<840,('P<'RX!'ȯ0$(, $ '0'8<'R!'ȯ0$ $( '0'8<'Q!'ȯ0$($ '0'8<'Ql!'<840,(!' !!$ !!$$B`A$c'$$B`A$cBf!d2$ %d $ !`(! 0! 8!@@!"# lb!}!$bz$u  !@!$b*(b@`H'X$b$bO$Q'$$B`A$c' !$$B`A$cBf!d2$ %d' &(!'!$$B`A$c' !$$B`A$cBd!d2$ %' d(!&0! 8!@!$$$B`A$c' $$B`A$c,$@ $, $ $w ~$,$ $<840,('@<'N!'840,(' !!!$!$$B`A$c'$$B`A$cBh!d2$ %d $d !@(!`0! 8!@@!@ $, $w$u$bt$u  !@!$b+(b@`H' \$b$bO$U' !$$B`A$c'!$$B`A$cBd!d2$ %d' &(!' !$$B`A$c'$$B`A$cBf!d2$ %' d(!&0! 8!@!$$$B`A$c'$$B`A$c, $0 $ $, $T$w840,('@<'K!'@D&\Ď"@!L$$ $$DX$$R\&T@\`(!$$  !` !$!'௿D $]@!$,h@$4 !' <'>0!'௿'9'  (!$(Dx $\ď!' <'=!( !@$D!d^<'=!'Я($ D!8B^<!D+@,!Dx(!$Q^ !`%$  !D,`$B^b!g $T  !$(#d`0!'8 Q !@ ! (! @!!($ '0<'<!'௿ $$$DD$c^b$^$툏bbb $$$  !$,'  $`<';!DB^<';!'௷ܯدԯЯ̯ȯį 􏙲x'!!%! !(!$ ! ,$'($$ @0!  z@0!,"$@g$ ("9 ! @!$,$@0!$ &1,$ $ \$gI,h$@0!0$ b 0B@E0!  (@8!L (@8!L$(@8!L$@8!L$$ 0! 0!,@0!$ $@ 0b $Bb,$P$ 0!'$܏؏ԏЏ̏ȏďe$'<'8!'H!􏅀,$`!$ 'Ж0B@',$ $,g'$ $$$L0! 'T,$@ ! $($&yP0 @8!@B,"@ !$($䏙@`!g #$@E!C!F&yP0Q @8!$,@#$@!Q!`0!` b*@ ,h$  $$$L 0!􏆀,@ !$( $(@8!쏆'9P0 $$, $@ !D @`!!'<'5!'0ȯį$,<'!!@@$<BJ 8!,0!$X $1@0#D0D`0!(! 0@!P+,$#@$!`@!,$$$ ''<"0B@ '8'9  (!(@0!&C!C0$b$`$#0B@0B@ (!D'9 0!(@'|'$(! '(%'X '(&1L& l0!|(!$$ ( !'9 @!(!'<'!'XTPLHD@(!<08'9!! !(p @!4( !\(! 0!(@&40@$D'9l (@ ! (!'4@8!'0$ ((!'8X '<($p*(!\ 0!(@ &0B@$D'9l (@ ! (!@'4'0$ ('8X '<(0Bb4P0(!\ 0!(@&0B@0c&`$D'9l (@ ! (!@'4'0$ ('8X '<(08lp<@ !0!0 (!$$ (@!'9  !!(XTPLHD@'`<'!'@<840,($:!!! b!$/b$ S&&1'9P f ޴(! ' @!#"# @ $ bQ1R(# @`! $ b$ $ @ !BC&1 '9t Q*8B @ !@(!0!b(\ !$ $@  !,\$ $@$?b @ !$?b&&&1 &1 $ b$ $ @ !BC&1Ҵ  (!0! 8!0$R@! (!@ @! @!D @!! "#b! ` !c$ b$ $ @ !BC&1  !(!  8!@<840,('H<'!'د$ !;H!9(2@8!H0!@b!b!y 8!$ ,y0!$M$ 8! !  B     !$ '(<'x!'D@<840,($ `HT'9! !@!"!@#0B@0B@ (!H'9 0!@@"0B@','9 $#0B@ B0B@ ,&$'9 ' @ !@!&4&'! $EKԏ @ !#@ !$S8B0B@)B0b@ ,&'! $,'! $ @ !H$$ (!'948# $S@0!&,'$0b@$8#H$'94  (!@0!',!$ "0B@$y,'$c,'$  @ !@!V*@'!&b *@!`!'9  !,(!$ @0!P0! !(#'9d !'9  !*@ !'9 !4@(! $DKԏ!T " !'9 !"@0! $T&&'9d &'9  !&1L"'9 @ !D@<840,($ 'H<'!'@<840,( !0!I !eF'9d $  &N E, $ĎQ  -"@)P  !f $E 0#Cd$TX$$!  , $ԖfHBCd$$8!!   &N @<840,($'H<'$!'د !,! $쏼0 @'@%&0B@0!$'9l $,@$ %$'9d $0 $N00 $N '(<'!'د$ !,! $ !'&40@ 0!D'9l 0!$,@$L &1<ff4cfg#Ï0Cb#C!"$N $<ff4Bfg"CC#b!#0 $N0$ $N '(<'!'د$ 0!@N!= @'@2&0B@,0!D'9l  0!'@!$ ',ͨ@$ ͨ '', $T@ !'9  (!00  (!'9( @ !$$ '(<'(!'ȯ40,(޴!B@ @0! ' @@!$?b$$@$ b$$ @@ !BC$@@ !"@@ !'9  (!" @[ (!=@ !4 $$@ (!@ ! (!'9( HD& ޴ '@@@! !@$ b$$ @@ !BC$@@@@ !'9 (! @(!@ !'9ԏ'9  !@@ !'9  @(! B@, $h40,($'8$$$ P*@!88! !@$ !% *@f!$` b`@!$ !!%C !$@@!$ !% *@e!$ b<'!'د 0! $ $ '(<'!'LHD@<840,(!b($D!' !!$$$  $f(b$ Fx0 $ c$b($b x$C!@e$b $$B e$gx $$$ cb$$cb C!Ubc$$BCC! C!Td e$@!$b*@`!!"!xC C#&"&$ b$ $ P!C!Tb$ Q!P!C!U b$  0!P!D!P!d!Q!Eed$ e! ! !b@tb@k!b @'9 ey ` !@0!@!( (! bcT!C!Qp $R"@,  !@!,,$r*@`!d$&db! C! $P"@ !  (! @0!bT!^ @ (!$!C$ *f%Cb @'9  !b&*@b&*@$  !@!bf$$BF x$$  ! $cb$$cb$F  *C!0! $D (!bd$c@\$BD$(a$,!$|GEF |C!$p$dc$ b $$ D%&Ccd$$cd@D!$E0$E,!$KEFGHIJ C!$p$d  @ c$ b<$$ D%&C0$cd,$ !$LFGHIJK  Cd!C!$p$e    c$ b $$ D%&Cc$b(b C!@  &eg&e &d$ $ 4 LHD@<840,('P<' !'Я($ $ $!`(!@ !$ $(@ !,$ $(&1"*@(@ !$B $`(!($ $$ '0<'T!'D@<840,($ !LC` P!$b(R!@!b!b@'9  ! (!@0! @!d !(! 0! 8!'9  !C !' $@!$b@`$(!0d$ (!@$C$(@$ $$b]0BL$ $bW0B+(D@$D$A $B$bL0B1$Z$bF0B`&s@&R$S$Bb*@&s$BB*@{&Rx!$BB*@p&R$Bb*@j&sg!@c&R`a&s_$R,UX&"@ P$,B@!0c$.bG&"V != @'9  ! (!@0! @!b!P&`  !$[b`(! @&"'9 &"V *`0c$ b;(b!@$C$b@(b@$ $b;!b$ b*!b(bD@$D$Ab!b$Zb !& *&*@$&@!@&$b!b@$$LP`Qb !$| !$ $2$D@<840,($ 'H<'T!'د !"0D& (!$BC!  !$0!x (!$"'&D$$B"(# # $((0!& $$$'(<'d!4 <'D!'د$ (!(!,%0C!C#!!(!'9 0!@0B@@ !P(!@0!@$$ @(! '(",$D '94 '($ '(<'8!'ȯ40,($ (!!!D04`D!(!@d!D#ˆ!!, (!D'9 0!@#0B@yB0B@,$E,$EB&@($G,$G菙` ` !B@BB0B@X ` !@!"B0B@ B0B@#`p!C&"H@b!b!y $P#@0!$ (!p8!y $,p#Dp!@8!$ 0! "0B@pX!b@($b8DEFGHIJc8Bdcefghijb40,($ '8<'p!' 쯰诼 !!B0!84̯D!D#@e!!@(!0!'9 C! @u!B@n$y @!B B0B@,$E,$E`F  !   !@!" @!"B0B@;BB0B@ "0B@C`!C'BH@b!b!y $W#$@(! 0!8!  eey W#!@0!$ 8! '9 @(! @$ !(!0!'9 $ @ (!0!@8!'9ɐ  @q$Y @(!d@0!$'94 @!  !(!d`0! 8! '9  ! $g && ௢@ !8$$f$fIC!@!% ЎB 0B@!@(Я'((! $B 0B@;$*9T$ =$'X@(!80!$5$ @X'98#  (4@'9 0!@ b!@(!:$,0!$'9 ( @ '( @@!@$Bخ$ !$YX  !@!B @%BB0B@i$y @ !(!P ؏  !(!,d`0! $ (Я'((! $B 0B@$*Tg ܏8$F0 $ $  $ $ '( @@!@$Bw$ t$YX  ! @ ! @! @  !,d$(! `0! BB0B@!Bb&$$$ & & $, $ '9  !@!B @B0B@$% $"#`'D0B@~0B@}$b"0B"(!0!@8!'9ɐ  @ $#"4b "4b"$B  `'9 ` ! '9  ! &$ &  $ $, $B $c 0B@" < ̏ȏ @@!(!b$LB0B&s@$ B@'!&1@!0B@` 0B(!@ ` !'9 @ B0B@"@&L&s@&1 S!S#R!B,B 쏰$'<'u!'0̯ȯį !'9 ! $ !  ! !$ b&&$c$  $ e&@$cD`䯰x! @ $܏ !@! xB@'x'9 (! @!`!!"@900B@/2`(! @ ! @+B0B@$0 bP@ ! &e @ @ !@0!b!B P @ !\ `(! @&1L&1$&1L"&"@_@!C!C$b6`(! (!'9 $ @1`(!xC$ b$=b $ $=x$bxbED%B0B@ $ xbD$bx&xC$ b$=b $ $=x$bxbFD8B0B@xB@*0'9 'x @5@!!!@(! !`0! 8!'9ɐ  @A@$4B "0B@ !܏'("8B0B@ @,%$"8B0B@@T!D!$eb4Bbc`$0B@e0B@$eb "0B@ ܏  ! @!@!@$@@|$'X' !`(!'9  @ !(!x$@ ! ܏$B`$Bd$n诶\`0B@0c` 0B(!@ ` !'9 @&1&L@ *"@$*"@$$BE&"E $c@ !$BBe  C @)@@!܏  ! @b@ !` !'#$L`@$c !!b!@=`!0B@10B@.0B@ ''9 (! @#B0B@ b@bB0B@@BED& *W!,e!$B0bt&!&L&@&s D( $F(B$ DFx0 $ @ !'| '@! !@,!G&P&Q  !$ (! $ |0@ ! ' G ! (!$ $|C C!CC!C#b!0U$&P&Q  ! (!$ $B( $B@ !,$ $B(& $B*@C($$cBC  ! (!$ $  @ ! ``W$bU܏! !'9 '(" @[#0B@O0B@ '('9  (! @B`$B$B0B@4`2B0B@’@(0B@!"H@b!b!y $ (!0!8! y $ 0!8! @!$@&1L"@& %+`k,$8x'((! $," @Y#0B@M0B@J (!'9 0! @B"0B@'('9  (! @ B@0,%$P'0! ! @!! " B0B@,$E󨏂<$E䏙`&  !B @,$El<$E,ͨ  !   !@!B @!BB0B@B"B0B@ B0B@#`!C&"H@b!b!y $U#$ (!@0!8!eca$^\@ZeXey U#!$ 0!@8! P (!  !'9  (! "0B@!@('(! $ @"0B@G$*E$ K$$ (!0!'E !$B$  裠'98#  4 $%ԏ ԯ쏙@Џ܏'9 0!菼 b!(!:$,0!$'9 Џ 菙 'Џ @@!m$k$0 $dN$ d$ (! @"0B@!'X ` !@!B #@x0bB0B@V$ @ !(!P  %, $p `('(! $ "0B@ $*$ $ $  'Џ @@!$$0 $DN$ 'X ` ! @ ! @! @,$$"B0B@!"b&$'9  !@!B @'(!#8B0B@ 0b@,$ $E`@$BC`&$0B@0B@$bB !0BB0! 8!'9ɐ  D@ 04$B`C4B@$ƮB`'9 ` ! '9   !'9 $P! !  ! ,C$b@ ܏܏  $c"0B@ ܏  ! "B0B@ !'( 0!'9p @8! &1L"@&R @@  ܏܏  @ ` @ 8 $̏ '9  @Dp(!܏pDlhBY 'h @, $+1,"$,$0, $L `0!, $,% $,%$,`(!$ '9 $̏ȏď'<'](!'Я( @аD  ('0<'\!( !(!$0e`b$PE <'\!(!!F$`@$!E0P@ ` !P,` ! !`$@!  ` !<'[!'tplhd`\XTP|'9䌵 !@!!x'(! $0$b@ (ৠ( $$,$.*0$EH,$EP ! !"  ! !@! !$F&D (!0! (!  ! $ B1(  ! !!&@(H!@!b4$BOb*@$!$  &&%4"0@0!'9l @*dR!(C2(`H&RD *0!$BHbq&s!1$@&s(@4!0 @'@%&0B@0!'9l @&*dR!(C2(`H&RD *0!$BHfb&s!0 @`!&b( '@;&*@z@  (!@!a$Ba @<4B4Bb$` !ab$ !D@a @<4B4B@ !840,(!'@<'J !'D@<840,(!P$ @!޴F'  @!P$CPD$ $b$ P@!BD$bP@ ޴ 'P$$@$P$ b$ $P@ !BC$ !EY $P@!@ !$'9 @@!, $h '$@@!'9 @!PC`bP@(!  !P@$@ $: @ ! !! @!$F&$ (!@(! !  0!$ "R(bB0B@ b@B@&DDaX(! 0!(!( $ԏ $$ !'9> &@! @ @ (!DDaX 0!'9  !$  ! '$@}@! @ !ey .$D@<840,(`!'H<'E!'PLHx'!(! ! $, ! (!B'9>$O *PLH'X<'E`!'د$ D(!Dc0! !Dba@ B@pa!  ! !$P 0!DbaQ!Da'9 $a$Dc DY`  D$ D` '($ '(<'D!'|xtplhd`\X D!Dc!0! (! Dba@ !B@pa!  !  !$P 0! DbaQ!Da'9 $ a$Dc DY`  DD`  H,$bdFDEB cd$䧢,Bt! ! @!! L! @!! P '((!x$, T H0C$D,, $Dx @ 0!,$x, $ , $D @ 0!,$, $  ' @'' 0! , $Dx @ @ ! $B:, $ @ @ ! <:,b'@$',b@$:<,b@$,bQ@$P< ' @# @ !@!@ C`$| !$@$ #+@$ ` !0@0!0|0!@0 !$ , $ @,$Bx@! !(! $  !"@&+@,\ !$ $ @ !C,C&"B,&R(# @ !  @ !# B!C&1 ,\$ $ @$ ! $@&& ` !#P+ @`(!"PB&R @ !  @ !# B!C&1,\$ $ @ !,B&(# @ ! {&1,\$ $ @ !=$;@7&&` ! #(P+,\$ $ @* !,x' B(!$1  '@ 'D @'䏦@D` ! $2 @&` ! #P+ @`(!P @ ! 3&1,\$ $ @( !, $) @!@! ! @ &$ @! @@!& @ !#P+ @5!P`(! @ ! 5!$Q$)"&1B @ !  B!"@&B+ͨ(!  !  ! 'X @!:$(R#T!8$4F` !(! $T @aH$ "e$"c$"a$ ".$hpXҴ''((#0! ! 4 $%ԏ X$௢t x \@0!x $ Xdp'9 0!p b!p$"$DhDaXX'H8! E(!H @$X p$"'HDȟDaXX8! E(!H @X p ` ! @@!'9P  !   ,@$ $% ~$X p ` ! 0 $N$ "҈!#$/b$:b&0(LL$bBc,$ !$ ! L,ͨ $菼 Lͨ  (! $ b$ &CPP(!$R @ ! (!'9> '(@!$ "W <4B",$D,,$Dh ,'9 @!F @&4&$:D(!DaX0! 8!pDY $pY p$P!  !L! !  !P! T!  $$L8B,Q|xtplhd`\X'<'6p!'HDHD!c̯!(! 0!Ba@!!`B@Pa!  ! !$P 0!BaQ!Da'9 $aq$c DY` $ DD` $\| !$ $'(!x $t$t$pl  4 '@!',0!$@$$, ! '$@ ! (!' '@ !&0!8! @!$"0 $N@ !(!x $! !(! $$'<'3!'\XTPLH!!'9 !'$,x !(! @! `(!ͨ  ! !,ͨ $菼 !ͨ (! !'9> (!@!'9  ! !\XTPLH'`<'2t!'د ! !(! 0! @ ! '(<'2!'TPLHx'!! !(! $,  ! (!B'9>$O *TPLH'X<'1!'د B@ !B (!޴ !@0!@8! @! `!'(<'1 !'د$ ޴!B(!8!F ! @ !@(!$ '9 '($ '(<'0!'9 !<'0t!'د !! @ !  !@!&L! '(<'/!'د$ !!!D   ! ! @(!@$$$$ '(!0'د$ !!!@@! ! ! ! @(!@$0 !$$ '('د$ !!0B@ @  ! ! @(!@&L$ !'(<'. ! 8!<'-!!0$BH  @!B@$!$4!<'-D!'௿!@$4 !' <'-!0$BH$!<',!'௿!@$ !' <',|!0$BH$$!<',<!'௿ 0B@$$ !' H`b "<'+\!'Я($ !!!0B@ !@&$S$@ !0!@&L @&1 !($ '0<'*!'Я($ !, $d@ !@$ @!| !$ ! 0!'$@!  !' $@P!|P! !$$0 ($ '0<')!'د$ !! !(! 0!@8!$ @ !'94 '(<'),!'௿ 8B+' <'(!'@<840,( ! !!! !@! b!@ &4@!B+ @`!`!@D@0 $N '9b  !. ,$D,$D(! @0!Q!  $E&E@B@$O0# !$'9X  0 $N &4@<840,('H<''!'௿!0 $N 0!0@ !$H'9b ' <'&!'ȯ40,($ DDDDahD,$Bal!!!b!$p$&d2 &gad@@!DxdadRa`0! (!2*@ !gad@ !$@$$@8!@ !DDDCadu(!C! !$aXa\@ (!a\(!DT!$DdbaTDx$2 DaP$0!,D$ $cЏ@ @!,D$$$c$ 0!@@!Dad : !x(! $40$H $:̏!D'9 !ba@!daP ! &B!`$RDBaR!@HDC`LDC` !40,($ '8<'#!'Я($ $!!@?!(@$ !p!B!l, $ @ ,e $!  !f@!F*@ ,e$" $J$B0B@` !DP (!9 !*"@ 0!$$<@!fb4@!( @$ ,X@ ! $%܏&!0B@ ' !(! '@$ CBp'@(! @ @ !@!쏲菱䏰`!'<'!'௿$!!8!(@$!2 !. *!0B@8! !`(! 0!@8!!  !$ 8!!  ! $ ! ' !' <'!'Я,($ $!!@R!(@$!U!} !' $ @!B@B@ <%,$%菄, $& 4Bb!,B@ ,%$&, S$0B@ !(!@0!B8!$0B@>C0B@86(b@`0!$4X@ ! $󤏼+!0B@ !(!0!`8!0B@G 0B@8@ !`(!$~| !,($ '0<'8!'Я,($ $!!@G!(@$!vJ!r !' $ @!B@B@%, $%, $&S$0B@ !(!@0!B8!$0B@>C0B@86(b@`0!$4X@ ! $󤏼+!0B@ !(!0!`8!0B@G 0B@<@ !`(!$Ʀ0 !,($ '0<'!'<840,($!!Ps!(@$!v! !'  $ @@!!@ Bb!b0B@ & B@<E, $%, $&4B"!,B@ B"+@BQ+@ ,GEF $&TS$b0B@@ !`(!0!B8!D0B@b>Q0Be@86, !`(! $&+!0B@ !(!0!`8!0B@G 0B@8 !`(!$~| !<840,('@<'!'د$ $8"!(@$!2 !!-! ! !@(! @!@,$ $& !, ! $&!0! (!@ !$  '( !$ '(<'!'@<840,(!!!X6!, !$" ' $C,"@ ! Bb!b0B@&@ ,B@@,E $&؏$˨@(!0! 8! !˨ !@(!0! 8! @<840,('H<'T!'@<840,(P!!!X6!, !$'  ' $C,"@ ! Bb!b0B@&@ ,B@,E $' $˨@(!0! 8! !˨ !@(!0! 8! @<840,('H<'!'` $!!!(!(@$!!"@ !P'4'<,'0','($'X'4 ,'0','( !$'X'< '8 @(!8<$B$c8$S<'('X'H $ $'( $ C8`0b3\,b.d4b)h8b$l<b%0B@ '( _0B@ '( T '( Nb, $'l G$0&#@C!D $BB+ `@0!@0!&#@C!XE ` ! .! '(" @` !P"$<,`$Bl04,$'(4,<0`,$'$l(8 $ $'!<'!'௿0 0 ̨ , $ ܏X 䏅 Ք $ԏ菅 @ $ ˨  t   P ̏ l  , ȏ x , Pռ t D !' <'0!'<840,($ P!!!L!!@ ! !q@\C# (!@ ! 0!@0!"@&sLb&b@(!%@T!^!@B0B@!  !@ !LB0B@!4B!<840,($ '@<'ݐ!'د $'9  '(<'P!'Я($ h! ! e@ !'9 h@ @ !  ! @(!($ !'0<'ܨ!'D@<840,($ @P!!X !@!!픏0 ! !0!@8! & @$  'W ! (!@ !h @!C@ !${b70!P'9@ 8!@"0B@c`  (! '#@E '4 ! $@@I!h @ ! ! @(!@9!@ E𠌥 '  '0  !@ @!(!@0!< '@ &  @0!@! !D@<840,($ 'H<'٤!'د h! !C@ !${b(!  '9@ h@ @ ! @(!  !@(!<4E !'(<'!'hd`\XTPLH!!!+!x'` !(! $,$<픯(8 4Q@ ! (!@@!<`0!$,8! @ ! ! @!g (!<^4T!!@X!"4@WE"8@A<#4Bb$`<B@ BB0B@2@0<;4TC0B@(B0B@4bB %8 @ !@@!D (!@0! $ @``(!@0! $A@!&1L"@&R `0 ` ! ` !(!$<4B 2@, $', $(!hd`\XTPLH`!'p<'!'ȯ40,($ h! !!H ! ! @! 0!`8!D(!dc௢$ @!0@ @ !  !$ @(!!40,($ '8<'!'LHD@<840,(X!!T\`d!@!!!  !E4!TB@0B@ !X\'9( @ @!, $((<4TpF8"$bB@0B@Ѥd ' @ @X (!@@!B4Bͬbc0B@4cb@cB0B@C ,bbxd @ @8!F8 !(!'9 @!Ďd @QFE@8!KdPb>8!x @ @8!F8 !(!'9 @!Ďd  @!F8@ !, $(T@!@h @ !@0!8! !(!'9 @!  !  !(!'9 @!b0B@8 F8@ !, $(\ @!@ ! $ @!@h  !@0! !(!8!'9 @!  !  !&RL&R  !E@0!, $(h!&RLB@&s !LHD@<840,('P<'!'د$ h !@ @! @! !0!0@8! $ @!$@ @ !  @ !@!  !@!$ '(<'!'ȯ0,($ 0B!!!@!DT$ Dc $ @ @!,,0$($( $N%@@DP`(!$c0! @8!@!0B@$c0 @ @!,,0$($( $N ! !!@$B@!$0,($ '8<'d!'840,($ !! !I!c `@<4Bub=cbh@` ! dh @!` !ؐ @!` !ؐ @!@0! 8!,$) ` !` !ؐ @!` !ؐ @! 0!,8!$)@ (!<4D840,($ '@<'!'௿ 􏄀,!'9l$)t @(!!' <'˄!'h|xx!!!' $(! !'@H!,$F0$  $"#$% %)"#( !(!`0!8!'9( @@!, $)Vh @ !@0!' D$Dc $@@!h @ ! ! @!(!@0!, $)3B0B@(!0!`8!'pp'9 @#p$ ' 􏙀8!$' '9 $@ !@(!, $)䏼 '  @ !@|x'<'!'௿ 􏄀,!'9l$* @(!!' <'x!'د !0!@8!'9L (! '(<',!'ȯ40,($  !`b!rB@YB @hD @ !ؐ @!@ !ؐ @! (!0!,@8! $* <4B8Q"@0!!"8@%@(!D @!@"@CB0B@` !'9  ` !!b4Bb&1L"& @& s40,($ '8<'<!'` (!!B$0B@$!@!!9D &1L@@0!B0B@ (!d( $ C4B"&R@& x'( !(!p( $ 'H` !x(! $, (<4B !8!HPXx'9(  @W@!h @ ! @0!(!DP8!dc$  @@!h @ !  ! @! (!@0!, $*P.($'x(!'9  @#x$  ! 􏙀 !$ä`8!'9 (! @ ! @(!, $*  '(  @ !H ,C`!'<',!'h|xx!!!' $(! !'@H!,$F0$  $"#$% %)"#( !`(!@0! 8!p'9( @@!, $)@B0B@ (!'p`0!@8!'9 @3p`(!@0! 8!' '9 @  @ !@(!,$*(@(!􏙀$ 8!'9 ' @ !@(!,$*  ' p   !@|x'<'!'௿ 􏄀,!'9l$+ @(!!' <'X!'د !0!@8!'9Ȥ (! '(<' !'<840,( h! !!!P ! @0!`(!DP8!dc$  @ !@!h@!  ! @! (!@0!, $*P&0  ! ` !$ @(! ` !(!0!'9 8! @ ,e '9l $+$ @ , $+4 @!$@!<840,('@<'h!'`\X!!! 0!' $@@! ' !h !(!,@0! $+\ @ !,(!$+`$   !`\X'h<'!'Я($ !!$  '#d!$$($ '0<'!'`\XTPLHx!!' (! $c!!@`! @ p @(!@ $ @0|!$% $.cg %(fd$$'@'D'9L @@`(!bDB!'9μ D !@@!0 @ !f !$ @@!,>$)' (!@0!8!'9 @b @ !  @ !@@!@ @0!',< @(!@@ !,&dx @0!@ ,$+d +,,! %! $p @(!@0 @  @!@!1@! '  @ !!`\XTPLH'h<'L!'h|xtp!!V!+@`!, ! $%@!X@!b+@02#*@X'@@(!$? 0!'!@ P!2XJ\+@E$X$[b$'\'X'9L X@$]Xb$<94SXX$Eb)(bF@ $F$Db$`k<$%b $Rb'$$Ib*$K,$+үXX(! X@!(!B0B@$ $)0,(#'X0!X'9 )B08X${b$'X $ @ !@@!< 4S\ !'9h @(!@! !'X$YL '`@$(X`bV!U$<4S, !X^ $)<4@!d\`!@e!E+@`p) ! 4Xd͘@ !8# 0!@!d$BLX@  !@0!(t $ @!  !@7 !@-@!0h  !dC$F'h$YL$%b'd d@ ! h(!!'9μ  !0 @ !"1 0!! @(!@!@ ! 9!(!'9μ  !@(!XC${b`!Y   ! @!! !@$'X(!0!\@ `\! !'9h @!X `!+@`!``!|xtp'<'!'ȯ40,($ !<4s!!!${C5$,P ! $}@.@!, ! ${@@!Q+@,&$ $}@!&,@${ Q+@@!` (!D'9҄ 0!@!&"B#@ !&${!`!40,($ '8<'`!'p|xtplhx!(!' ! $'@(!x$ !<4Vd`! , $)B'`BCG0!'9 @􏙒`$ @0!@BP($.DGb$(& !(!$ @@!BGB0!'d'9 @$d ' 0!' @X, (!@ZC <4BubU B ,@$4B B `;'@q(!&'8! ! ,@Y(!#L !CT B@0! !'9҄ @(!@!@E@0! %'9pP$ @! !&9P$C B$$b$C s  $ '  '@` d ` !d !3! '  '@d   !!|xtplh'<'!'D@<840,($ ! !!! !$R@ !, ! $Xh@$@R!!X@?8 B ,bb  !@O$# (!\ ! @0!@2!B@B0B@{Ѥ ! '@t@pb4Bkb8  !  !@&L&@&s @U@U!W!"@N@B0B@ '9  !:篢 ,b/"@@  @!0!@8!0$H (!"h@  !L  !㌎$ @(!U!  !"U!W!$CD@<840,($ !'H<'\!'8į!! ,'9l! $+@ `!x'  !(! $X$$1&14B!& T 0B@`!@Q(V !픏0 @!0!@8!&E   !` !h !@ @! @! !&E 0! @8!@!@<`N4S񨏤(! 'xC@!${b#(! $ ! @!&$P* X@@ !$ 0!' p!@X@0! 8! !`(!'9 @ @!(' (!'( (!`@ ` <ޠ (B@<4S  `J!h d@0!$' '9 @8@!LR @ !( $P  !!.@ (!,$+ $< 'x,` 0!$  @8!P @(!lE'x ' @<4S!$1' !b&1@& d !' `!ď'<'!'tplhd`\XTP x'(!!` !$!(! ! $ !(!0!8!'9( @! @fLh @ ! @0!`(!DP8!dc$  @@!h @ !  ! @! (!@0!, $*P1B0B@$(!0!8!'H'9 H @.H$ ` ! (!'(0!'9 8! @ ! @(!, $+  4@BB @$L '(  @ !L tplhd`\XTP'x<'!'௿ $,$0!,٬ $+菼 !D@bc<4D!' <'!'ȯ0,($ !! $,,ִD &+菼@ "c,,0$+$( $N<K4Bph@ ! $$c` &+菙 $@ @!  @@!܎$c @(!@@!̎$c A< 4PpDpDc @@!  !`@8!,$F,,$F,0,,$BN$,  $(ԏ!0,($ '8<'!'Я,($ !!! !  @ !@!@@` ! @!4@8! !`(! 0!@@8!, $,T$,($ !'0<'!'Я($ !!! !  @ !@ ! (!@ @@8!,e $,T$($ !'0<'!'௿ !(!@@ ! @!, $,|$`!' <'L!'ȯ40,($ !!! ! ,!!b$ @ !  (! @!@ ! (!bD @ ! (! @!@ !(! `,@!` !@(&1 @ @! !(! @0!@@ ! @ @! !(! @0!@! ` ! @ !!40,($ '8<'!'Я,($ !!!4!0x $ @!#@!@!D ,  ! `(! !(! t ! `(! !(!t !,E $,$,($ '0<'!'د$ !! !  @ !@ ! (!d@ @!,E $,T$$ `!'(<'!'௿ !t(!@@ ! @!, $,$`!' <'!'ȯ40,($ x!!'$$ !$'2@B`$cd  ` (! @ ! @!@ ! '@,@!@*@ ! &s@ @!(!@0! ` !@  !@ @!` !(! @0!@! @ !  !!40,($ '8<'!'ȯ40,($ !!!3!/x  @! "@!@ t ! (!'t  !@(!'$$%!C#$G `(BD%B!,e $,܏$40,($ '8<'T!'Я($ !!!@ !  @ !"1 @ ! @!0! ! @(!@0!,eH $,T$($ !'0<'`!'د$ |!! !h@$  !@0!X @(!! !$ @ '($ '(<'!'tplhd`\XTP x!!!'((!$ !. H@$$\$B@V$GPFD'(Dc$!Dc$$!8! @@!F D@Dc '( @@!'((!0!'9 8! @4 '(01 @@0B@2` @0! 'H @ &R ?*@$ !.$6$$H  `(! @ B0B@$ 0B@ $ !(!`0! 8! @!$,m$, !(! `0! v@!$`!($bHBcHbcH$h & @(!ͨ ` ! <$E4$,$E菙ͨ ` ! E$H7 ` !&\c\ b!C6D @ ! E, $- @ ! E,$-L @0!  ! @(!, $*,$+d  ` !&\c\ b!CD$!H  '(! tplhd`\XTP'x<'!'د$ <!@@!@ D @&&1@ !$ !$ '(<'!'p|xtpx!!!' $(! !'@H!,$F0$  $"#$% %)"#( !(!`0!8!'9( @@!, $)Oh @ !@0!' D4Dc $@@!h @ ! ! @!(!@0!, $-,(!`0!8!' '9 @ 8! @ !@(!,$-􏙀(!$ƿ'9 ' @ !@(!,$-  '  @ !@|xtp'<'8!'0ȯį x'(!!!@ !(!$X ! $1@!b&14Bb!$c gа !(!$BŔ0!(  @@!b'$C,b@$,$c\C!B\!@p4d((!@0! $ @@@!"0B@ 4@0!4e 8! @&L@&1 !@!D0Dc Nee̠d(@0! $@x' !(! $,q "@!!&R"@0B@P  ! @  !, $ $ @6&1L"@&R d,0!(!'9p  y  ` !< 4P '( @!<$4P!$1'(B!b@bB0B@d &1!&R !ȏď'<'!'9L <'!'9Ȥ <'|!'د !0!@8!'98 (! '(<'0!'98 <'!'௿D0Dc $,,0$($(@$N !`!' <'!'8į x!!!'($ (! 'H,$F0$  $ $x'x !(! $,<4B x!!!`a!4($R($$0BCJ@0B@DB!@@@ ! @! $ !`(!8!'9(  @@!, $)Ch @ ! @0!'(DP8!dc$  @@!h @ !  ! @! (!@0!, $*P&L@􏙀8!$t'('9 (! @  ! @(!, $*  '(  @ !H ď'<'d!'د <!h4C! ! @ !Ҩ $.@8!<4C4 !$K (!@ $ Q*@!<4C `!'(<'!'௿! ! (@$8CEFGHIJ8B  !' <'!'\XTPLH!!!\!p'@  !@ *" @<!@&1Bb@4R  !$C7<*"@4<h&1  ! &1'@!f !@E$+!(,@$-$* <4R#$/<4R `4R` @@@!&1b4Rs`@@!@@!$"<@,(! $.8(! $~|@!4R@!\XTPLH'`<'!'د Ѥ '@ '(,B<'!'د  '@$,C `!'(<'4!'د  '@$,C `!'(<'~!'840,($ ! !!! !$D@0!$$s+`<\4C% @$\  !@M!"&fF+@<@#q+@`!'  `!#DBd!"$cE#$B"F+@#"3 !#S#$x$BB&0<r`0!(!B  !32Q   ! !(!  @0!$B#!840,($ `!'@<'|!'د ! A<4C 0B@`!bP ! &!"!@ <4C `!'(<'{!'د$ !!(! 0B@a$P  !BB"!@b PP ! &!"!@<4C$ `!'(<@ !<'z!'د !<!$4I,b!,!h#$0!$c$. &@ <   0H!  !'(<'z!'Я($ !!!(!0! ! !@(!`0!  8!$ @! !($ '0<'y`!'Я($ !!!(!0! ! !@(!|`0!  8!$ @! !($ '0<'x!'Я($ !!!(!0! ! !@(!`0!  8!$ @! !($ '0<'x!'د !!0! (! !  (!$ @! ! '(<'w!'ȯ0,($ @!!!! !' $@:0(!$ 0b2(b @$ $b, b , $(& $x@@0 $N$@*@ @@&$'@$' $@$0,($ '8<'v0!'ȯ0(>>$@!H!6@(@ $Z$@,$G菂0$GHC@A ,B$.(|@,$G菂0$GH,}$.X@,$F菂0$FHC@AB ,$.| 0!8! $%c@,$B菂0$BH, 0!$.8!P@,$G菂0$GHC@A ,B$.د'@,$G菂0$GH,($/@,$G菂0$GHC@AB ,$/(0!@,$G菂0$GH,$/\0! $%(0'8<'s!'诿 ,x(!Bp$A! '&2, $/@ !$!$P@! 0!@$,' $/!` !$A $*@!0 $Np$$p DBY DY   "p$p(%\Y $p(!Y '@@!$b7 $pY (!3$$pY  p|`(!@ ! 'ȏ@P@ ! '̏&$%P 'я !' $d@$,' $/, $/! `!'<'pP!'Я($ x!!!!(! $0 @D ` !H$$( ($ '0<'o!$ @ $0$8 $<'oX!'@!C*@!B,@B (B@$B Q  !C@!$BC` D$CB$C*@C$B,@'( F (!  !Cs*@!xE, ! c0#!@(B@ B,@'(DBC$E&P&Q 0! 8! GB !@  (!0$8*$CB(Fb#*@f#B(B(Db#D*@d#B(B,D(@'(BD !B$E&P&Q 0!  8!FB( !0# (!$$  !'  $@!$b(b @(b@``!.$[ b!$Ob' !'  $@!$b(b @(b@$``! $Bb$(bC@$C$Ab$b8$Db, $0b1(b@$$b"(b@$$b, SbD$b, Mb9(b@$$b$ b.B, b1$b1, <BBCBC*@$bBSCs*@ $bBCBC*@DP !(! $B$BBBCC!B@$Cs*@DP ! $@0B C$Bb*@0P!  !&(! $FDB !$CîD'<'i!'<840,($ Dc@!(D &@&d( &&d(P @(!*,$6UEFGHIJKLM N O P RST6Q Bd(efghijklm n o p q burst(D &@  &&$cP @(!,,`&$c$6 $6$( &$DD@!%pd\,$b6,JDEFGHIc6,Bcd\  &$D  !ͨ @(!`d\(D &x@  &x&$d|@(!X$,,`&$d|$68$6H $cB@d@6$*@$$DD@l$c􏂀DD@t$d\ DD@|$d|$c@dC!D &$c@dC!B<840,($ '@<'e!'د !!D,!`$c$6@@0! DP(!$d\ D,`$d|$6P  0! D $'(Cc<'e !'௿$ :$:' <'d!'Я($ DDCd0dC#C!!+@!(&@ `(! @Bd$d&b#b! ! +$($ '0<'c!DFd$*@$h!DG#kdg!`!@P!k!B(@ G!K!$F@!%) D$  !$*$c@%J<4B!<'c!'LHD@<840$(!!!`M!B@ (C/$B$+(DD##dD!C!B$T$' `! @ $dC#C!D!B$T( ! $$b !('$0!8!'9( @ !$S'`! '(@<4DLHD@<840!'P<'a<!'د$ D!$d!0! (!DBd*@ DP#cdP!C !(A 0!$$d <4B@8!$ $ $$$d !$ '(<'`!'Я,($ D!$d!!(! 0!'9' @ !$C $$d <D4BDDddC#C!!+@0(A &X@(! $ $(,0$&$$cDa$Bx&8(! $|$d$ !dd&b#b! ! +$$d <4B,($ '0<'^L!'د D!$d(! 0!$ (!P#P!DBd*@ DBdb!b(A$d!b,$d0B@ <4B$ b(! '(<']H!'د D!d(! 0!d$  ! '9' '(<'\!'Я($ D!Dd(! 0!$ !P#P!DDBd*@bd"!B(ADd`! !Dd bdQ!$B($ '0<'[!'ȯ40,($ D!Dd!!(!0!H !DBd*@ DP##dP!(!(A $Dd <&4B`` !X$ $ "d!B$"d!B,"d!B($Dd !40,($ '8<'ZD!'840,($ D!$d!!(!0!P !$BD&d*@DP#cdP!C!$C(bA$c&*@d$$d <4B$d P(!D0!`8!  !P!840,($ '@<'X!<4B$ <'X!'د D!$d0! (!$ 0!P#P!DBd*@ DBdb!b(A $E$d! <4B$d e(! '(<'W!'د D!$d(! 0!$ (!P#P!DBd*@ DBdb!C(a $d! < 4B$d`$eE( ! '(<'V!'Я($ D!Dd!0! (!;$DCd*@41D#dP!D(!(@) '#*@$Q#Q!D!B(@$ !$bQ$caE!$(@$aDd <4B$Dd <4B#dP!C!E(Ddb!$q E(!($ '0<'U(!'د$ D!Dd!0! (!/DEd*@(DP#cdP!C !(@ %*@Q#Q!C!B(@ (!$bQ$c$(@(@ $$Dd <4B(D!C$($Dd !$ '(<'S!'Я($ !!"!D(!Dd 0!DBd*@ DP#cdP!C!b(A$Dd <84B$Dd e1!@($dbD $c&1*"@$cbD&1*"@DP#cdP!C!b!$b$E&1*#$B`$Dd <4B($ '0<'Q!$ <4B<'Q!'Я($ D!Dd(! 0!$ !P#P!DDBd*@bd"!B(ADd`! !Dd bd"!B0($ '0<'P!'840,($ D!Dd$!0! (! DBd"*@ D#cdQ!!b(A $Dd <"4B$Dd u0bd!B4@! bdb!Y4  ! '#q!@!840,($ '@<'OX!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A $d! <4B$d r4!$ '(<'N`!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A $d! <4B$d r$!$ '(<'Mh! $B@ !<'M@!P$c@C! !E <'M!'د$ D!$d00! (!$ (!P#P!DBd*@ DBdb!b(A $d! <4Bb,$dB% b,!$ '(<'L!'د$ D!$d0!0 (!$ 0!P#P!DBd*@ DBdb!b(A ('$d! <4Bb,$d$ b,!$ '(<'K!'د$ D!$d!0! (!DBd*@ DP#cdP!C !(A @0!$$d <4B$8&H  $ $$d$ !$ '(<'I!'د$ D!$d!0! (!DBd*@DP#cdP!C !(@$0B@ @8!$$d <4B$X$8 $ $$d$ !$ '(<'H!'د$ D!Dd!0! (!$ (!P#P!DBd*@ DBdb8!(ADd!$HdB0B@ ! < 4B" #%&h\` d!$ '(<'G!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb0!(A$d!$'dB0B@ ! < 4Bh\`dB CE F!$ '(<'FT!'د$ D!Dd!0! (!$  (!Q#Q!DBd"*@ DBdbX!b(A Dd! <4B   Ddbclepftgxh|i j!$ '(<'E !'د$ D!Dd!0! (!$ (!P#P!DBd*@ DBdb !(ADd!$0B@Dd <4Blptx|Dd"#%&' () *!$ '(<'C!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A $d! <4BB$d b!$ '(<'B!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A$d!b$%d0B@ ! <4Bb B!$ '(<'A!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb0!(A $d! < 4BBC$d !$ '(<'@!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A$d!b$%d0B@ ! <4BbcB C!$ '(<'?!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb0!(A $d! < 4BBC$d !$ '(<'>!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb!b(A$d!b$%dB0B@ ! <4BbcB C!$ '(<'=|!'د$ D!$d!0! (!$ (!P#P!DBd*@ DBdb0!(A $d! < 4BBC$d !$ '(<'D$$f$ 'P !d'@'  'T@((!$f$ 0!T'@ !(!'9 ' $f$$@ T !ݔ(!0! '  (! !ԯDDf$ 0!p0B@:D$$f$  !'H 'P@$0!$f$ (!'H !'9 (!$f$$@   !(!p 0! (! !D(!Df$ 0!p0B@9D$f$  !l'  'P@#0!f$ (! !'9z ' f$$@   !(!\ '  l !D(!Df$ 0!D$Df$ !tplhd`\X'x<'!'௿(8!'9ؼ '(' <'!\0!(!  !<'!'840,($ D!f$!0! (!`Ded*@ D@S#eE!C$bf$$QBd8B0B@ $f$ <{4BBXB0B@1@D#!+@+!$"S3p$0B8@f$  !< (!f$(! 0!eĎe&@D#b!+`(!'9z @ !@ @!D$Df$ <44BBt@ Bx@'9~ @ !D0!$e'9h &EBt@ Bx@'9h @ !D$Df$ ` !'9 $!840,($ '@<'|!'Я,($ D!$f$!!(!0! !DBe*@ D@P#ceC !$b $$f$ <44BdB8B0B@ $$f$ <%4B`$ď'9 @(!E @ $$f$ < 4BB $$f$ !,($ '0<'!'௿(8!'9T '(' <'!'9T $<'h!$'9T $<'D!'<840,($ D!f$!!(! 0!`Ded*@ D@S#eE!C$bf$$KBdB8B0B@ $f$ <4BBXB0B@+@D#!+@%!S$3f$  (! !T 0!f$(! 0!eĎe&@D#b!+`@ !'9{$ (!@ D$Df$ <]4BDX $e菼@ @(!D$Df$ <L4BBĬ @ !D$Df$ <?4BBt@ Bx@'9~ @ !&P ! (! 0! !œ  (!"Bt@ Bx@'9h @ !D$Df$ ` !'9 $ !<840,($ '@<'!T0!(!  !<'!'840,($ D!f$!0! (!`Ded*@ D@S#eE!C$bf$$JBdB8B0B@ $f$ <t4BBXB0B@*@D#!+@$!S$3f$  ! (!f$(! 0!eĎe&@D#b!+`(!'9{$ @ !@ @!D$Df$ <44BBt@ Bx@'9~ @ !D0!$e'9h &EĎBt@ Bx@'9h @ !D$Df$ ` !'9 $ !840,($ '@<'!000B@(!8*$Ex0B@,#$E9D0B@,$EB0B@4$EU80@4$EUB0B@0$E!'د D!i &*@DP!ciC!$CbA$cD&*@i <4B  !0! '(<'=P!`$ <4B<'= !<4ED!DBi *@ DBib !@$C(!!<'<!<4ED!DBi *@DBib!C``$dD(!!<'<0!'ȯ40'('0!8!$ @! '@!+`'('0!@8!`!40'8<';!'Я($ DDCi0iC!!+@!&@ `(! @ Di#i&(D!b!+`$($ '0<':!'د$ $04! ! !P<'4FX& $048 $<0!EDCiDPiC!!+@<@ (!&(4F$ !'(<'9!<4ED!DBi*@ DBib!b@$b(!!<'9D!'ȯ40,(,D !&(, DiPDd!0i!+ `&'@ $  @ Di#i&(D!b!+$40,('8<'8L!<4FD!DBi*@ DBib!b@b0!!<'7!'Я($ x!!!DBi*@ DD!#i(!A:,$b=D EFGHIJKLM N c=B  @@0!D$Gh$P $ $``<)4B !X$ $@(!"i!D@0! 8!"i(!!D &F( 8!"i!B$BP`!"i!Bb!($ '0<'5!'د D!i&*@DP!ciC!$CbA$c(&*@i<4BL  !0! '(<'4!$ <4B<'4!'Я($ x!!!DBi*@ DD!Ci(!A+,$b=D EFGHIJKLM N c=B   $" "``<4B !X$ $ Bi!C$DB #$"`!Bi!Bb!($ '0<'3$!'د D!i&*@DP!ciC!$CbA$c(&*@i<4BP  !0! '(<'2d!$ <4B<'24!<4ED!DBi*@ DBib !@$C(!!<'1!'ȯ40'('0!8!$ @! '@!+'('0!@8!`!40'8<'1,!<4ED!DBi*@DBib!C``$dD(!!<'0!'ȯ0,($ ,DD!!$&=`0! &i@5@!Dxi@Pi `0! (!0*@ !i$$cp*@$DDR!&=$0! &gi@@!DxdiRi0! (!2*@ !gi$$cr*@$( !0,($ '8<'/@!'د$ B@!8&14@@ ! B"*@&쏿$ $'(`<'.!'lhd`\Xx'H!!! !(!$  !' P$@ !`(!0!  8!@3@!L@/$B@!8$'  &@&1B*@'  @ !8D! (!P ' b$Bb$lhd`\X`!'p<'-$!'Я($ !B@!8`(! &1@&$B"*@!($ '0<',!<7'4Xy, !!!p!@Jx!%&$)#'( +,"* - *2 !f! L<B !g!H! ^ f Tl! !J! n!M!x!p!x#Bx#x&##&p#Bp#p&x#x#x&##&p#Bp#p&x#x#x&##&p#&p#. p&`'9 &,b @5p!,$c>C!B\!@" p!" p!"p!"!"!"!"!"x!"x!"x!"x!x#Bx#x&##&p#Bp#p&x#x#x&##&p#Bp#p&x#x#x&##&p#p#&'<')!'840,($ !(,$$UA !!!@+!P` ! @(!1e$.b`! &0!3(!,B$&13 !!P8!&1@$0$.@q!@E&& @ !'P+0!@P!q!@840,($ '@<'(@!'ȯ0,($ !!&%H ! ! !@(!h,&'H !@$A$* ` ! `! ` !@(!(@8! $O0,($ !'8<''h!'௿D8Cq4@C!A$b$D$q8! $Kԏ!' <'&!'௿DCi(<`$G4$GP4 $Kԏ!' <'&!DDEq@D!D!@$cr *C!0$BH<'&D!'TPLHD@<8x'$d!(! ` !'8!,$FA$0 $ $DDq2q q0qD\@P!$qD !(! $@&q0qD*@DD$qBq*@x!T ` !@8!,,`$A $A` ! '@a'h' $0@!$0 !`(!0!8!D$mCH' $@!$  !`(!0!&0  @`(!,$A 0!2q( '5!Di, ,ď&i,$B, $i, ''( @!P `(! !0! &0!2qP'i $Hď$TPLHD@<8'X<'"!'plh!!'  !'(!,,4%B8%BH%3A$0 jB8bBH3h ( ,* $0 (!,,4,%B8%&BH%3C$BP BB8(BH3J ( ,  ( 'plh'x<'!!'د$   !,B@$'x(!$d  !'P,,D$AGB$BAfc$BO@௤PDT q` !' @!$C `(!, $Bh 'h '? @!''G*@6 ! #$cO@e@,D !D @q!Dq!@$r؏Pd !@@(! q !,`$b$Aqq@8! `0!q(!D@C!$q'9h D !hD '$C'q*"@D䏤 di|U'P,$B(! $@L!@!,$  @ !@(!@&1@di| T@1@ ! D,q$BȐH(@(!JKLMNOPDf!$Br@b!B$DhqD)$q !ijklmnop@(!'9h Fq @ !B! $R8 ! &@&C$HĠCHďDDx$Cq$m(! $(!$Dx $i  !@(!, $Bԏ &P(! $H$  '(<'h! $H<'H!P $H<'(!DDq,$EB􏂀D@d!$Bqb!DBqD*@b#@,$EC, $C<'!'௿D8XDi|,0! $CL $Hď,$? $L ! ' <'!'ȯ0,($ P!(! '(!ͨ ' ''@(! 0! D$cm !$!! !DBi,D!3`&1 (!PH' 0!@0(!!"@&B&10RS+@&1!0,($ '8<'!'د D!Bi(@! @ ! (!  !@@!!@! `!'(<'$!D (!<'!D0 $Bi !@@!!`!<'!'840,(!D$H$H &ci@8C ! (!  ! 4@, !   ! ' D $DP@ (!  $,,,$BCX$Ct$C| ! $ &biB!C840,('@<'t!'hd`\XTPx'8!! !!(!$ !'(L$' @ !`(!0! 8! @@!@ @!' ,,`$A&A 8!' $ $@!D @ !(!, $C ' | , $C &A< @(,$PX,$C $SB ` ! !'0 @!$C(!, $Bnh0' (!0h (!- R # !`(!@/R*`$ '8!,,`$A$A@ ! (!, $C  !| h0 (!$C !䏤0 , $C, $A8$DG$HĠED%HeHĬ@q H, $C܏$PLHD@<8`!'X<' !DBq<'!DBq<'!DDCq@D! *$q`(!C(!!<'!'PLH,x!B>@'(! $'0(!x$  ! ''8D4lӈ$$Bi(D@40! 8! $쏼PLH!'X<'!D +!di(<'!'௿ !' <'p!'௷ DEi($H!(+pq r stuvwHfghijklmn o c   '   <'\!D!ci(<'<!'௷ !$Hrstuvwp q fghiHjklmn o c   '   <' 8!'TPLHD@<840<<4T! !`!8` ! &@;&,($C$ȏ8THIJqCcKLMȐ&bS ! "#$CDEFGjSB!%/&'*+,-.)Dq@! !D\$Bq! !`(! $&R@&1D$Bq!CK(XDEFGHIJK RSTL M N O PQUVCXYCCCCB(  D')$Bq! JDEFGHICD !$Br!"#$%&'(&t0bcdefghijk l m n o pq&sBCDEFGHIJK L M N O PQt&Rbc!BC q$c2B*@K !TPLHD@<840'X<'!D@e!$Bqb!bec!<'`!'H8! $@ 8$CSdBScIDBq@V!!D\`(!$q$ ! $@&10Bq&*@<s4B@P!DP!$cr@C!UPQRSTCDEFGHIJKL M N O B  !"#$%&'()*+,,`'0$A !&&A ' !$ $A<-4BD @ !', $C  !| , $C &$A< !'<'!DBq<'p!'د <4C$.!, !! !@! < !@4c @ !h @!P @ ! ! @! ! @! ! `!'(<'p!'௿<4B! @!B`!' <'!<4G$ !` !<쏅4G !<'!<4C$  !<$4C `!<'`!<4C$  !<$!4C `!<'!<4C$  !<$)4C `!<'!$!` <4B<'!$!0!쏅` ! <4B<'D!$ <4B<'!'Я($ <!4B!#! !D h@ ! @(!&DtD $&BtD "#$b`(! @!`!($ '0<'0!'د Tx$! ! (!< %$ #$8`0!b$  "0!$B " # !`(!b*`$ !'(<'8!(!$O􏂀DDt@ <4B<'!(!$ODDDt@ <4B<'!'<840,(,ִ$bHЌBcH!$&DH< D 4S&DH<@ !$@! Bt@ <0,$ $N@$DX hDt@ $Dt@p $<, !$O􏙯$D@$DX0 $N+t@`!(! (,0 !$OD$l$DX@$N,$D t@`!' $ !(,,0$l$DX$D@$N `!<840,(`!'@<'!0D !(! $<'!'Я($ $!!!@(!` ! @0!` !@0! !xC#(!@8! ` !C0#F*@ (!@0! @8!b!($  '0($ !'0<'|!'0̯ȯįx'!! !(!!$@ ! !$DP $tx  !!C$/b !(ͨ $㠏  ! !ͨ ! ' !0ͨ $ .b@!,$cUC!B\!@@(!0!a',ͨ' $Eh@@ !D$Dt (!'9  0!Ag@!$b',ͨ $EhD (!$t'9  0!AS@!,'$bElBcEl !C$/b(ͨ ! $㠏ͨ'  ! !0ͨ $  !4ͨ $iDDt\ (!,ͨ' $Eh@@ ! (!0!'9  @!x$@'X (!@(!'X,ͨ$bEtBcEt\ X'XDDt\$y  0!@@!!@(!x' ! $ !(!$ !@!@U@!', $E|@ !@/&D+@3$$ b$$'  !(!\ !@0! @!@ !3 !$]CC$!` $B@@@!P ! 'z !' $@!!@@!s$@a '"!b$]D$pbD#$p$ b $ b $ $ &DC$ b$ b &$ b$ b&' ` !##,C! !b &E@! +P#P` ! ' !' $@!!@` ! &E@!@!@$@$ ` !#d#C!D#!b(  !$D'XDt\$y  0!@ @!hE  !!$!̏ȏď'<'!'<840! ! !@!'x(! $@A<? !  (!@7@!  !! !, $ @@ !, ! $ @@ !, ! $ @@ !, ! (!@@ !#&@$F#$FX '@ ! '@!<4C<840`!'@<'!'xtplhd`! !!! ! !'X @!$C(!, $EhX 'Xh '@: @!eQ*@'` !`@(! @  #D ! (!@ hX '$C'FP ! @(!X @! @ $hX '@!$'(!$& @!Q*@'` !`@(! @  #D ! (!@hX '$C'䏤X <4Bxtplhd`'<'!'د !!, $ @@!@, ! $E@$ $$ $ '(<'$!'`\X$!,$PEh$!,$PE @$D(!$tx'9H' 8! !@'!`\X`!'h<'h!'د$ D!"t`@!D$u8D ! @(!@&$"t`*@!$ '(<'!DBt`<'!'h!,! $E &D,&Dtx&9H$Eh' 8!',@$E, $E܏`K, $F! &,&Dtx&9H$E' 8!',@$F, $F , $F@x @DBt`@!$D,$u8%(! $FBt`&*@&1@, $F`'<'!'ȯ0,($ !!,!$F ! !@!!@&3@  0!x@ ! (!& !, $F@$"b&$,\ !$"@ $@e&` !$,b$,&@C$,b !, $F@Q#, ! $)@ Q#c*@`0!`0!X@ !2 (!X@ !(!-`0!&  !@ !!C$ b(!$ b$"b!$!@!C$)b!@  !@ !P (!@ !@(!X`0!0,($  '8$   !@ !!C$ b(!$ b$"bb !` $ $!BC@ !$ bX@ !(! `0!@ !0Џ,($  '80,($ '8<'!' ܯدԯЯ̯ȯį!D $tD $tDbth@!,D$eF"tTC!$P  !@ !, $F@  !, $?@x'  !(! $ '0 !x(! $L%tTF(!8!'9T A!<4BDE$BtT!C!,ͨ'$bFBcF !  !,ͨ $菼(!$YH$0!' @R@!*@ !B8@K&e, $FCB !@!`$ b$ b'#``!&p,$F  !@B4@$$:b',\$G ! $@  !,\'$G ! $@(!Ȩ ` !,'$G$  !@D  (!'9  $P$ܦB, ! $G0@D   (!'9  $P$ŦB, ! $G@@D  (!'9  $$B, ! $GT@D  (!'9  $P$B B$@!P, ! '@F0 !'9   (!$|B(, ! $eF,Q B4@ , ! $?@j!$:D8b+  ', $Gd ` !' !4\$$ $@= '@!B8@A! ?`='  `(!,$ '4\'$ ! $@(!Ȩ ` !@!B8@! $b$'b, $Gl B8@`(!, $G!&&*(!$YH$0!' @!!*@*(  !Dbth$c$c`b*@8!܏؏ԏЏ̏ȏď'<'4!'hd`\X(ͨ</d4Bl!' $㠏'ͨ ! !'9 $@! @ ! !hd`\X'p<'h!'쯲诱䯰௼$.$ !!!!,ͨ'$Eh$!,ͨ'$E '`` !x(! $@$Y, $G@Q,, $BH '&PH$@` ` !@@IH %,ͨ$)"#&'(*$  !&$$ @  !@ ! @!!&+ͨ@(!  ! & !,ͨ $菼D' $tx'@!@0!@'8!'9H (!,@$H6!@!쏲菱䏰`!'<'ݸ!'@!$ !e@!x' !(! $@, $G@ !, $BH <'XD$@H,$BH Dt`@@!D!$$Su8D@$u8(!&'X@&@ @)D&$Bu8b! !  (!@ ! ` ! @!!ď&+ͨ (! ! &R !,ͨ $菼t`&@*@&s@@!'<'۔!'௿t!$' $(! '+' <'0!'د$ 4! @(8@$<4B?<' $@ '@*DBt`@!D$u? E(!@Bt`&1"*@DBt`"*@<4C !'9 $@ @!$< <  !@!`!$ '(<'ٸ!'ȯ40,(,!, $D@'@ !,&%4' '@!$@ !&%4'  '$P< b<$*@ #(B@d*@!<4C<4C40,(`!'8<'ذ!'`|xx'! !(!!p $' !x(! $L'X !x(! $ $ !!@B@D $t@$$ D $t@$@0!(!8!'9T A@!<4B(H$ 0!(!8!'9H S@!p'pU*@(!' $ 'g$,!BE0!$$BiU*@,,$Q'h$D$H !  !@,$H(,, !$L ! $Hd@,$Hp , $H@(  !<U4B,'7$H菢pU*@E*@' pT!B!BbpD!C$ b1(b@$#$ b, &b $&,' $H菼/$ p''X'$'9H p@!pU*@*@TH!p'B!B'X'"pC!H$ $c$  p& s,\' $Ih $@' !!,\$Ip $@ ' $ b!$$b$,\$Ix $@ $,\' $I| $@$b$$b' $  @!$ $C@@$$ $$FD@$$`t$$ b0!$=b`$ $=!$CG$D@@V$' !@$ $=FD@$$`B$$"b0!$C@ !$"Dh$C$@!@'$!$ b!` $ !$ChD$@!@DBv@@,$GI0$GH,' $Dl ' ' @ @ ! '@$$@$$!㣠 $,T!@ &$D@@!@ ! &%D@@(!' !'9  $ &$D(! 0!'9  !<@!4bFO.b@K\@GB@C@$: b(!('  $,'  $DBv@$: b@ ! !$:b' 0$FH(!, $D\Y ' n4b ,$ $Dďge!.b`_!.b@\! $:b ' ( $ԏDBv@,'  $D菼 '!@(!,$ ' DBv@(!,$D ' Ȩ ! ' @ !DBv@! $:b$'b $, $Gl!&p&c,c$B`p$bDBv@',$E $''X''9H p@!( '!|x'<'h!'d`\Xx'!h !(! $@''h$','4,'D$BD<$ H 2L"@/<  !@   !@@!, (!*$I @(@ 0@ 8@@@ , (! $I܏<4B'9 @ !@@!, (!$J( <4B!, (! $JX!`!d`\X'h<'x!'Я($ @!,!$J4( 0!(!,` $J (!, $K< &D>䏼&D>䏙  (!@@!,$EK,$EK, $K!` $, $K, $K؏$($ '0<'!'XTPLHD@|84! ! ! ' @x t(@4 &>䏼@ !'$'('0&> ', (,@!C*@R,'4&$G4 8'8, &DK,(4b!8d!b! @C*@? , $L &$G,(4C! D!@C*@, $L( &DK&>'('0 ', (,@!C*@. !` !$'9X @% !`,,&LH $LT&LH, $L  !| 4 $>䏼$XTPLHD@!'`<'!'د !0!ͨ$N  !  !(!䏿  '( !'(<'Ř!'ȯ40,($ DDPthGtX!@4C!<A@g*! H!!D$6D`@(!(!GP$ Z,$BL 6E$tT ! !th$tT@C!P@ !$ `(!th$tT@C!@D!$c(!T\th40,($ !'8<'X!'|xtplhd`!4$X $>䏼 'XD$Qt,'$L$@  8!'` 'X@c@!, $D@@(!,$D $Dth@>!!DtTB0!\@/&s,,B`$$Eh$L@& ! X (!@!@/(!tTXB!B\Y  !(!x $X (!@@!thb*@&R`,؏X$bLEF cLB\X`d 'X@!X<   ! (!4 '$C<4P '!|xtplhd`'<'!'د$ DDv(! 0!&9x !$C !&9x !&$C*&9xD,@td $L, $L̏0 $NDv$$  '(<'!DPt<'p!BPt<'P!DPp<'8!BPp<'!DDtl<'!DBtl<'!'௿!  !,B4$@$  @$!`!' <'d!!D,btp@$L,$M <'(!'௿, $M8!,@$MD <4C`!' <'!L ! $<'!'plhd`!!@'Xx$,ͨ$.$Eh@ !X Y !D &tx@'P &tx &tx&txC!C$/b'(ͨ $㠏 ! @(!@X ' ! @!@ ! !!.@ (!<-4Bͨ 'X@@(!ͨ '&9x '@!$ &9x '@!&s$*c`&9x !,$$M '!plhd`'x<'`!'|xtplhd`\X!! ! !,B@@><x' !(! $@ =D ! &txP@/ !&tx  !  !!C$/b($E㠏0$EHͨ ' ' ! @!!.@<4Cͨ'  (!D $tD $t '8! !(!'9  '<@!4b 4b,' $M!!L$Dth@E!!!!DBv@$D8DtT$M ! $@$, $M̏$$D8DtT$M ! $@$@$ !$D0!BtT S(!0!'9  8!th&&`*&R`@&s`$ ', &D'9 @ !<4cC- &D@!@@!,$RN, &D@0!@8!,$ $N &D@0!  !,$BN,@(! $NLL $%!|xtplhd`\X`!'<'!'د D$$t 0!A@!<#4Bx' !(! $ ! (! $@!"!` @4' $Kԏx !D  !! '(<'!'ȯ0,($ <!!4R!!&1DDBth"*@#(!dtT ! $@&`D $tD $tbtT(@(!)@E(!8!$'9  0!@!@!0,($ '8<'!'௿ !  !< !,4c@ $N <4cT@@ ! !`!' <'!'\X!D!$P'b$tD$b$t<#4B |  ''4  !  !| !\X'`<'!'د !D $tD(,&%tx $ȏ&%tx,4 !$i@! &%tx,, $E&%tx,, $Bď&%tx,, $Eh, $G !'(<'!'௿D؏D $t&tx4,@$i &tx,, $Bď&tx(, $ȏ&tx,, $E,D,$Eh $tx!' <'!'xtplh!,ͨ$.'``!a$Eh @ ! @"@<'DP $tx' !!C$/b !(ͨ $㠏ͨ (!  ! ! @(!@@(!ͨ  !  !@<  ! 4B` !4D,$i $tx!xtplh'<'t!'௿D؀t@$t @ D $txD$ctC!!' <'!'ȯ40,($ d! ! !( $ЏDBth$Q 3@Q!@@!D8tT$MS!  ! !,@$N Ȩ@ !(\@ $Y  tT`! !&1&s!&R40,($ !'8<'t!'쯶诵䯴௳ܯدԯЯP'(! <en4Bv0ͨ'h$ h 'h',ͨ! $EEh'(!x$ !'h $@!@ @ !,$ $NďD' $@@!*"@!B !@!h$ b$ b }h,'$F  !@t@!C$$bp$",b&R&D $"@ ! $ ' !x(!$2 @!$.B$"P&Rd@(!r0#  ! !, $F@@$Q",P !&$ $" $ ' !x(!$ @!#$"b&1`q0#X (!  !P (!  ! !, $F@ P$BPE  ! !(! $, $O!&1& *D !' $@!!*@g*"T  ! ȏ$ 0!@!@$ $ $A@!D ! $, !$ $ ! ! 'h@@!P0#(!$  !'h(!x $'h,,,`$L$F $gEh ! 'hk#$.bg$=&1"C@ !, $=' !x(!$2 @!r0#@(!X ! &1%'P8=,%(! @ !$BPE @ !@;$%b0 ! ' ! @!@ ! !!&. (!ͨ  ! !(ͨ &  !ͨ @(! !ͨ & @(!' 0! '@!@@!0 !$bNBcN' !C$[b !$ @!@$ bA!, ! $E|'@!! ! (!$L'0#0#(!(!0!  !' !(! $@$@!6`,,$LH $Oh ,,$O $O؏ @ | 4 $>䏼| !D  !D  !| D $tx b!$R@`@ ,,$O$O @0!D$ (!`,,&LH $P,&LH, $Pd, $P'@2$,,  !,@$,$P@ď @@!Ġ@,$P (!@ $P  (!, $P̏ ! 0!!`$D,,Cv$P@0! $P쏼, $Q , $QL$$ @0!@ D<@v $, | 4 $>䏣`1, $Q@(!$, $Qԏ@,,$O $Q, $R'9x @0!',$ $R4| !쏶菵䏴܏؏ԏ'<'!'د$   x!(!'( $@ '( ( @<d@!$@ ,,$O $R | 4 $D>䏼 P 'h 'h,ͨ $R 'h$ $ A@!@ ,,$LH $R @,,$LH $LDbth@4ޭx' !(! $L ' !x(! $ D8!tT$C!'9T `(!!! A'<h4Rx !(! $ &f !,,`$Eh $L  ! (! $(!0!'$YH$  @=@!*@:'(r!Bw !@!$ b$ b`  !  !(! @0! @" !0$N $ @!&&RP*$(!$YH$0!'  @!!P*@*( !!( !4ޭ 4ޭB\@!D,dtT$F ! $ @1 @- !0 $N  !'菅, $R   !  0!, $H  !菅,D`$S  $u8 (! 0!, $SX @x' !(! $  ! (! @4ޭDbth$*$c`$`@4ޭb"'菙D  !  'h , $G | 4 $D>䏼 ]$x$ ! (! (!,$bLF cLDB触쯢  ! D  ! '9¸ 'h @9@!,'$bGDE cGB  ! @  ! @,,$BH,,,$BS$Sl$S $S 'h'9\  @!`!$$@ ,,$O $S̏ | ' 4 $D>䏼 P ' ',ͨ $R  !(!x $@  !,(`$A $X  !$ 0!@! $'$ $ A@!@ ,,$LH $S @ ,,$LH $L D  ! $,x'$bGE DcGBlht@ !(!$@ p , ! &%H @ 'X&"H,D$BH $@ ! X  @ !  !$ 0!@! P$P (! 0ͨ<en'4Bv$  !   !,ͨ $Eh |! ! (! @u@ !P#R*@q, &%E|$ @ P#r*@`,`!(!` !(!@0!` ! P8#(!@0!` !@ *`! 0!  ' !(! $ @! !@&%E| @3` !0 &%N ` !'菅, $R  ` ! 'X`0!, $H  !0!,` $S (!`0!, $SX ` ! &%N 'V0#(! ` ! @!' !(! $ @@!oD  ! D ` !  ' , $DG | 4 $d>䏼 {$'9¸ '@! r, $DG | 4 $d>䎂 @ @', $T, @@ ,,,$Tx$T$T ' @ @', $TЏ @@ ,,,$U$U$$U< ' ''h'X'9\  @ @!| 4 $d>䏼 !4B$  '(<'L!'ȯ0,(D' &t&t` '  !(!x $ - (!D $@!$b$`#! ! @@0!$  (! !(!x $  (!D $@!<  0,('8<'!'@<840,(DDDFttDPdt\EtX&$tx! (!&%tx$/DP &t&t !P!BR(ͨ ! $㠏,ͨ ! $UX&%txDP &t&t !P!BR(ͨ ! $㠏,ͨ ! $K$(!Dx'  &u8$. !,ͨ $E !dt\' 8$ 8!@ !,ͨ $E $ !dt\' 8$ 8!8dt\8!'  $@!(B@' $ !,@ ! $ @!&u8X@(!0#D ! &sq*@&@U!@D,DQt`D&`@v$@0! >T@ @!GP$ t($B&xdtT@0! (!D $v $P@ @!GP$ |,$BU`&` !D&`$v$ 0!@!!<GP$ (4&`$B&ȯ $!@<840,('H<' !'lhd`\XTP(0$$!!C$q!(@$ !$!2B@B2@<$GH0$GH,0`&b$V$H ! (  !(€!B0B@%B0B@,$FW0$FHB0B@<$GH0$GH,b0` !$W (  !(!0B@!0B@,$FW0$FH0B@<$GH0$GH,b4` !$W!2B@!p$ '0@!2(@,$FW0$FH2@<$GH0$GH,`$W, ! 2B@!2@,$IW0$IH2@<$HH0$HHeg dfbc,` $$W< 0!8!  !d2"@%B0B@,$FW0$FH0B@<$GH0$GH,b`$Wd ! (  !(€!B0B@%B0B@,$FW0$FHB0B@<$GH0$GH,b` !$Wt (  !(!0B@&0B@,$FW0$FH0B@<$GH0$GHb,`B !$W (  !(!0B@&2"0B@,$FW0$FH0B@<$GH0$GHb,` !$W (  !(!2"@!c$bZ(b@$$b!bQ!2B@#B2@,$FW0$FH2@<$GH0$GH,b` !$W (  !(!B0B@!B0B@,$FW0$FHB0B@<$GH0$GH,b`$W  !qb(Qm  !^2B@4B2@,$FW0$FH2@<$GH0$GH,b`$Wȯ  !bq(Q  !( ! 0!,` $W؏(  !(!B0B@/!B0B@,$FW0$FHB0B@<$GH0$GH,b `$W௢  !q b (Q!  !( ! 0!,` $W؏(!lhd`\XTP'p<'!'HD@x'!(! ! $$$(!P ! 8  (!P $8HD@'P<'`!'௿ !D!$v ' <'!DBv!<'!DBwD!&.&.<<4B@D$!<'P!'쯲诱䯰௼! !!! !@G!x'(!$ @ !h  !@0!$.'9  $#h  !@(!' $ P$ @(!@@!D@0!'%v، $ $%vج $b !<4Qp$b !D $vߏ !h @!@0!$.'9  $# !쏲菱䏰'<'X!'쯲诱䯰௼x'!! !(! $Ď"$C!$$D'%v، $ $%vج#P"$ '@0! DP#$Pvآ (!@0"쏲菱䏰'<'8!'쯰诼!!! *!0(@  @!<C%1 `(!x$ ' h ` !@(!'' $ "&x'  !(! $ď$ D,$BWb!vԏg$Bv$Y ''&(!P $@0B@4BP$ ' @@!D' '%v، $ $%vج ` !!쏰'<'|!'쯲诱䯰௼!!'$     ' 'P' $쏲菱䏰'<'{!DBwF0B<'{!DBw!<'{!'௿ $!( !, @$  $(!$ďx' @!h  !CYFGHIDEJK L M N O XPQRSTUVWC_^YCYCCB#$ %&죣!"'()*+,567-./012348䓹哢棣9磹:裢;<鏣,=$죢> 'D''؏D%w $ $%w(C(#b Dԏ$Ew  ' <'x!'쯲诱䯰௼$!!C?!'D@I0!D'%w $ $%w6#x$ ! (!D  $$#h@ ! @(!' $ $P (!@DP$Pw$  (!@,@0"쏲菱䏰'<'w$!'௿D$P$w$C0! @0!!' <'v!'௿$$(D$$wb00B@20B@48b+@ <@'$<<'b%8P$w $!' <'u!DBx 0B<'u!'쯰诼x' ! !(! $ď''$ D$&Ew &(!P $@$LAX!$" $ @ !,$Y" $ @ !,$Yȏ"  @ !,$Y @ !,$Y  @!@ !&Fw4 $Kԏ @!@ (!  !  !< 4BD`Dv0! $!쏰'<'s!D(!Dv $W8<'s!'9  8!<'s|!'௿0!'9 x !' <'s4!'9  0!<'s!'9 (!<'r!D(!Dv $V<'r!'0̯ȯį! ! $@ !@! $ ,B @  !@!x'(!$  ! !h '@(! 0!X ! !R@VDP( $ď@ 6s@ !h @!@(!$(X 'L<C%  !, $:@@! @ !h @!@ !' 0!@  !<6sxC% R@`'<44Bpx$ !(!H J(!'珙P 揼$P (!@$$P '@@@!D0!'%'w $ $%#w!̏ȏď'<'o!'쯲诱䯰௼x'!(! ! $ď!@!&Y     ' 'P$ '@@ !'9 (!쏲菱䏰'<'n8!'94 8!<'n!'௿0!'9 !' <'m!'د$ D!0 !  !(!D !Dx@ $( &Dw&#wb00B4b0`! &#w@!b0h !4B b0&Dw@(!X $(  !Dw`$Fw0 !(0B4$@$wД20B@FW4 $ !'(<'l`!D $BwC20cC2d%C2$BwB20B!<'l!D(!Dv $V`<'k!'9  $<'k!'௿$'9 x !' <'kt!'9  $<'kT!'9 $<'k4!D(!Dv $U<'k !'94 $<'j!'௿$'9 !' <'j!D$BwC04cD4C0$BwB4!<'jX!D$BwC04cD8C0$BwB8!<'j !D$BwC04cD<C0$BwB<!<'i!D $BwC20cC2d%C2$BwB20B!<'id!'@ ! $@ !@! $ ,B @  !@!x'(!$ ` !$ !h '@(!X@0!  !'$x$ !(!HD J$ (!P'磢 䏼$P (!@$$P '@@@!D`0!'%'w $ $%#w!'<'g!'쯲诱䯰௼x'!(! ! $ď!@!&Y     ' 'P$$ '@@ !'9 $쏲菱䏰'<'f<!D(!Dv $UT<'f!'9  $<'e!'௿$'9 x !' <'e!'9  $<'e!'9 $<'el!D(!Dv $RD<'eD!'0̯ȯį! ! $@ !@! $ ,B @  !@!x'(!$  !$ !h ' 0!X@(!  !RD!@d!P4 $T̏t@ ' 61<LC%, $X0t@ '61  &s<MC%, $X@t@'61@ &s<@MC%4 $Flt@'61@ &s<MC%R@ <*b@'<54Bpx$ !(!H J$(!P'磢 䏼$P (!@$$P '@@@!D0!'%'w $ $%#w!̏ȏď'<'a!'쯲诱䯰௼x'!(! ! $ď!@!&Y     ' 'P$$ '@@ !'9 $쏲菱䏰'<'`h!'94 $<'`H!'௿$'9 !' <'`!D @'$Dw0$0`0BG%0$BwB0G$,B!<'_!@!D$Cw$Dw40'2$2Eb% 2b4b2E$!<'_!&$ D$Fw00D$ 04 0i5$@4@0@$40Z5$W40R4D$Dw0B0B@2B0B@A5>$@$D$Dw00B@20B@,5(B$D$Dw00B@20B@5D$Dw00B@20B@4!<']!'9, $ <'\!'9+ $ <'\!'9, $@<'\!'9+ $@<'\!'9, $<'\|!'9+ $<'\\!'9, $<'\<!'9+ $0@@0b+@<'[!'௿04DU$Cw$Pw00B@20B@4G4c$0$$$ D$w'9/  0!60*$jD$w'9/  0!:]$D$w'9/  0!70@ 4b 0bI6@4b0b?0d00B@b20B@20B@/b4G+$$$$ $ b6b8 b:b<$  b7 b8b6!' <'Y!'د D$$Iw$"!$$" $'904 @! `!'(<'X!'د D$Hw$!$ $$'904 @! `!'(<'X!'د D$Hw$!$ $$'9,8 @! `!'(<'W!'د D$Hw$!$ $$$'904 @! `!'(<'W!'د D$Hw$!$ $$'904 @! `!'(<'V!'د D$Hw$!$ $$'9,8 @! `!'(<'V(!'د D$Cw$b H!$'904 @H!  !'(<'U!'د D$Cw$b H!$'904 @H!  !'(<'UH!'د D$Cw$b H!$'9,8 @H!  !'(<'T!'د D$Cw$b H!'904 @H!  !'(<'Tp!'د D$Cw$b H!'9,8 @H!  !'(!!!<'S!D(!Dv $Q<'S!'9  $<'S!'௿$'9 x !' <'S8!'9  $<'S!'9 $<'R!D(!Dv $P<'R!'0ȯį! ! $@ !@! $ ,B @  !@!x'(!$  !$ !h ' 0!X@(! ` !QD !08 $,t@' 6R<LPC%1 @'<54Bpx$ !(!H J$`(!P'磢 䏼$P (!@$$P '@@@!D0!'%'w $ $%#w!ȏď'<'Pd!'쯲诱䯰௼x'!(! ! $ď!@!&Y     ' 'P$$ '@@ !'9 $쏲菱䏰'<'O!'94 $<'N!'௿$'9 !' <'N!DH!D$Kwc0&'()%Bw4cDc0EwРFGHI%BwАCDEFGwАB#'$%&"!!<'N!D $BwC20cC2d%C2$BwB20B!<'M!'\XTPLH$!BP,٬ ' DBP,4(<DBP$Y$0$BP8BP@< 4PBvЏ@!,@ !$W $@ <,,0$Z$Z( $NDvЏ(!$Wx $@ @!,,,$Z8$Z($bxDvЏ$W8`(! $@ @!,,0$Z8$Z($0 $NDvЏ$V'( $@ @!0,,0$BN$Zp$Z($|DvЏ$V``(! $@ @!,,,$Z8$Z($YDvЏ$U'0 $@ @!0,,,$BN$Zp$Z($YSDvЏ$UT`(! $@ @!,,,$Z8$Z($X(DvЏ$RD'8 $@ @!0,,,$BN$Zp$Z($X(*DvЏ`(!$Q $@ @!,,,$Z8$Z($XDvЏ$P'@ $@!@!0,,,$BN$Zp$Z($X, $bx!\XTPLH`!'`<'Ip!l  !<'IP!'Я,($ T!!(! 0!@ @!,,`$$$U ! @0!   !@0!0,,,$BN$Z$Z $U!,($ '0<'Hp!'Я($ 0 !@!@@ !  0!0,,,$BN$Z$Z $Uď!($ '0<'G!'840,($ !!!!! , !,`$$ $U菼  !0!0,,,$BN$Z$Z $U菼: !ޠ  !@2@!ݬ (! &C @!`&*<6ub%6p` ,,`` !$Z$U 0!ؐ @ !0!0,,,$BN$Z䯢$Z $U菼6p@ !840,($ !'@<'F!'hd`\XTPLH <4V$!!!b4!!2$ @ ! , $[ @ ! ,$[X,0@0!$Z $N yݬ4(! ! Dh  !P @(! eq`!x'((!$ `!Q* @Z,$BWb!`f$[|  ! $P8!0! ! '( @ @ !0 $D  @! @ ! &e @0!(! $ @(!$ '(  !'(P0!@8!84B 8 '(@(!,&gt'9D $[ @'( &1Q* '(! hd`\XTPLH'p<'C!'د$ <!,c4B!`.!,$BWb!-`@$[|f  !@  !  !&&4` $}!$(! $$ '9E '(<4B$ '(<'A!'د$ !$'9H! ! !@!,ͨ@$[ @  ! &, !(` $菼!$ `!'(<'A0!'`\XTPLH x'(!!(!$<!@ !! 4U P 0! !@(! 8! @@(! @ ! @0!,,0$[$Z $N 8P !4B0!8! 8 &tt@ !,@(!$['9D 8! @$x&d0 (! 4ݬ (! Dh @! @@ !Ҩ $. @$D(! $ b!b`n0B@$bnޠ4 ! @j@!ݬ4  (! D@!0 $D @h &1 @(!P &d L2*, $\$ @Bh @ !@!0 $ @ !1`8 $ @ !$, $X( @ ! $, $X @$b,8!$F[$0 $ $&12*@! '(! `\XTPLH'h<'=X!'hd`\XTP x'(!!(!$<!` !! 4U P 0! !`(! 8! @`(! @ ! @0!,,0$\,$Z $N i8P !4B0!8! 8 ` !@(!,&Gt'9D $\ @U&D0x(! $ 4ޠ ! @@!ݬ4 `(!C@!$ bh(b@$` 8b$b2($ &Q0 @ @@!h @ ! @(!&D4X $'   ! j, $Y @g, $:@ @" @@!h @ ! @ !'L 0! @B0L4B#0B0  ! ,s$\8$< &Q0 @", $:p @  &E8 i&s,!$Y8$, &Q0 @ t &E4 @RB04B, $W @G,$X @>,$X0 &Q0 @, $X@ @ 4 $Fl @ t 'H @$ "H", $X4 @, $XP @ , $Xd @ tH 'HH @"4B 4 $T̏ @ t 'H @$B0H", $Xp @ tH 'HH @"4B, $;( @tH 'HH `B0#E4B, $X @ tH 'HH `B0#, $X @P, $X @ tH 'HH `B0# , $X @tH 'HH `wB0# 4BrB0, $Xȏ @], $Y @tH 'HH `Y"#=4B, $Y @ tH 'HH @D"@4B, $X؏ @ tH 'HH `0"#, $X䏼 @tH 'HH `"#4B",$X @tH 'HH @"4B"&st*@B2D0C$D$e B2C8B4`AB8@@!>C4$b;!00B@60b@44C4$bD0$b0@ C8B6`B8@C6B0B0B@!C&0 | @ !@ !@!, $\䏼 !\ &46B(د$ !(! `0!"0B@ @ ! $,(!$Y ! `0!"B0B@ | @ !@ !@!, $\ !\ &%, !$:@'  `0!"B0B@ @ ! $`0!,دq$\00B@q&0`@   @ !`0! !8' $<    @ !, !$:p'  `0!0B@9 @ ! $`0!,د"$Y00B@"&0 @ ! &48 !$,(! `0!0B@  @ ! $(!`0!, !$X0B0B@-&0  @ !, !$X0(! `0!B0B@u $ @ !(!,د_$X40B@-  @ !, !$X@(! `0!B0B@E $ @ !(!,د/$XP0B@0  @ !4 !$Fl(! `0!B0B@ $ @ !,(!$Xd ! `0!0B@[  @ !4 !$T'  `0!0B@ @ ! $, !$Xp'  `0!$b(b@$$b!b0B@/&  @ !, !$Y'  `0!0B@ @ ! $, !$Y'  `0!B0B@ % @ !, !$X'  `0!#"b % @ !, !$X'  `0!B0B@ @ ! $`0!,د$X0B@I&  @ !, !$;('  `0!"b % @ !, !$X'  `0!0B@ @ ! $, !$X'  `0!B0B@K % @ !, !$X'  `0!#"b % @ !, !$X'  `0!B0B@ @ ! $,`0!$X !'  0P !4B' 0!8! 0@(!&t,' '9D $]@! ' !`\XTPLHD@'h<'%!' ܯدԯЯ̯ȯį!,$t<!$]` !0!'9B 4V!@!'@ !@(!0!'9E `8!@' ,0!$G],$  $ $  x !(! $n0B@$48!` ! (! @0!@%@@!,0!$G]\$0 $ $ ! 0!@8!0,,$cN$] $ZS0P` !4B (!0!8! 0 !@(!,8!'9D $]@@ݬ, (!@ ! @!h B!@0! !4` $} !  !@(!0!'9Y, `8!@@!!  !` ! (!$@0! $` ! (!P0! 8!,` !'9C` $] ' !܏؏ԏЏ̏ȏď`!'<'!|!' دԯЯ̯ȯį,$t<!! ! 0!&]'9B 4T@x!'@ !$@0!'9I `8!@' , 0!$G]$0 $ $Lx !(! $` !(!$@0! $@(@@!, 0!$G^ $0 $ $  ! 0!@8!0,,$cN$] $Zȏ0P` !4B(!0!8! 0 !@(! 8!'9D &]@!` !'9C` &] ' !؏ԏЏ̏ȏď`!'<' !'X$$!!(C,,$t$G^H$  $ $<4eO(!''9H  8!@@@!,&t$G^p$0 $ $(!3' !$!'9J  8!@)@(! !(!''9I  8!@@@!,&t$G^$0 $ $(! ' ! 8!'9Nx $@(!!'<' !'诿  $, !@!,$cUC!B\!@,$t$E^<4B !'9B 0! @!B,B@0!,$G^$  $ $kBn0B@$x'( !(! $ C'H,$BWb!`f$[|  ! ` !(!40! 8! @!@@!,0!$G_$0 $ $  ! @0!,,0$_T$Z$N @ ! &E ` !(!00!$D  8` !P4B(!0!8! 8 @(! !,$^D'&^! 8! @@@!,0!$G_`$  $ $  Uݬ4(! 'ȏ  ! @! $h ! @0! !4` $} $t @(!   !  !P (!  !,ͨ $[ $P` !(!0! 8! @%@@!,0!$G_$0 $ $  ! 0!@8!0,,$cN$] $ZB8P` !4B(!0!8! 8 @(! !,8!! $F^܏ @0ݬ4 (! Dh  !P @(! @ !(!0!'9Y, `8! @*菙  ! ` !(!$0! 8! ` !(!P0! 8!  '( ` !0!$'( 8! ` !'(P0!8! ,` !'9C` $E^܏  '( !!,$t !<&_ 0!'9B 4U @!'h@ !$0!'9H `8! @'H, 0!$H_%0 % $Jx !(! $ ` !(!$0! $ @&@@!, 0!$G`$0 $ $ !   0!@8!0,,$cN$] $Zȏ XP` !4B(!0!8! X  !@(! 8!'9D &_ȏ @!` !'9C` &_ȏ  'H 6!<`4H,$t$G`H$  $ $ ! !'9jT (! @@ !@ !'9f `(! @ ! !(!'9f !(!'9jT Y<`4H,X!$b`pDEFG HIJc`pBDCtExF|GHIJ*B' !0!$'9I `8! @@@!,&Ft$G`$0 $ $ @ !(!`8!'9Nx $ @@!X!'`! !(!'9lĐ$$C,,$t$G`$  $ $<4DU'h !0!$'9H `8! @@@!,&Ft$G`$0 $ $ !7@ !(!$'9J `8! @-@ !@ !(!0!'9I `8! @@@!,&Ft$Ga$0 $ $ !(!`8!@ !'9Nx $ @@@!B($BB( !!$,b,$t$GaP$  $ $<4c+' !0!(!'9I `8! @@@!,&Ft$Gax$0 $ $ (!`8!@ !'9Nx $ @@!Q!j`!$b,$t$Ga$  $ $<4BM'h !0!$'9I `8! @@@!,&Ft$Ga$0 $ $(!`8!@ !'9Nx $ @@@!B,$BB,!QP$ P$  P $ @ !'9l `(! !<4B '<'!DFx` <' !'௿,٬$$b 0! !D@bx`<4D!' <' !'Я,($ T!!(! 0!@ @!,,`$$$V0 ! @0!   !@0!0,,,$BN$Z$c $V0!,($ '0<' !'Я($ 0 !@!@@ !  0!0,,,$BN$Z$c $VT!($ '0<' !'840,($ !!!!! , !,`$$ $Vx  !0!0,,,$BN$Z$c $Vx? !ޠ  @@!<54Dp@2!ݬ  (! &1C @!`&0*<6ub%6p` ,,`` !$Z$Vx 0!ؐ @ !0!0,,,$BN$c$c $Vx6p@ !840,($ !'@<' ,!'௿,!0!! !,`$pc<@$cL       cc<        !' <' H!'`\XTPLH x'(!!!@ !(!$<! 4U P 0!` !@(! 8!@@! @$&@,0!$Gc`$0 $ $ ! 0!@8!0,,$cN$] $c fP` !@(!0! 8! @ !@(!,8!'9 $c @T&8x(! $` 4ݬ (! @G@!hD @@ !Ҩ $. @$D(! $ !$0B@8$8ޠ4 ! @ @!ݬ4 (! &1 D@!0 $D h@ 2* @(!P & 2*@! '(! `\XTPLH'h<'T!'d`\XTPLH !$8'9!! !@!  !8ͨ $䏼  !b$R'(  ! f  !,` $cx !(!$< 4V $P ! (!0! 8! @  @ ! ,1$c @ !< $܏  @! e @ ! (!@0! $  !$ @(! @ ! @ ! ,$c,0@0!$c $N)P (!0! 8!  !@(!,&gt'9 $d @ݬ4 (! @@!hD !  !P @(! t &e '( ! !d`\XTPLH'h<'D!'|xtplhd`\X x'(!4(!$<!@ !! 4V P 0! !@(! 8! @  @ ! ,3$d$: @ !< $܏  @! e @ ! (!@0! $ @ !$ @(! @ @ ! ,$dp,0@0!$c $N P !'(0! 8! @(!'(,&gt'9 $d @}&~x !(! $ &wh !x(! $d 4ݬ (! @h@!hD @@ !Ҩ $. @$D(! $ b !b "$0B@c`$b`ޠ4$8 bd@! @?!ݬ4 (! D@!8 $ @$ @%@!h @ ! @(!&d8X $/   !bd y4B8$ $˜ @h$  !@(!X $bd b4B8$ $D @Ѥ$H 'H @bd4BbdH@b`4B,$ $;p @Ѥ$L 'L @bd4BbdL@b`4Bb`b\"cX,$ $d @!$h !@! $bX$b\@ !$BW"!& &1 @.`bd4B bd,$ $d @!$ @@!h @ !  !@(!X $/   !bdc` 4B4cbdnc`,$ $d @&eh$t ,$$d ! @ &el$t & S*$cX,C!E$  (!@$$! @!h@3@ ! & D@(!X!@d !$ $   !Cdd$$c b %ddE$ Ѥ@'P$ P @ P@$BdbCd%cb&.@&*@! '(! |xtplhd`\X'<' !'쯾请䯶௵ܯدԯЯ̯ȯx<4B' !!4 !(!$ !@4B`0B@@ 614(! !0!  8!@$@@!,&Pt8!$Fd$0 $ $  !0!@8!0,,$cN$] $cvBd0B@ E @ !< !$'  0!Bd0B@! @ ! &E8 !$˜'  0!Dd'X,!@R0!$c$b $S'@`( !$$@ ! `!  @ ! (! !' 0! @ !0 $H0!د !'  'X,!CbC0c` @ !< $d !د'  0!&s.b@Bd0B@'B`0B@! @ !B`0B@<$Ed,$E $ 8 !$D'  0!Bd0B@'B`B0B@! @ !B`B0B@<$Ed,$E $ , !$;p'  0!Bd0B@&Bh픏,@  @ !&Fh, $cL  @ !0 $H&d !'  0!FX!$BW@(!$Cb&s.dF$c $  @ ! (!,0!$d ! ' 0P !4B' 0!8! 0@(!' ,&Gt'9 $b@@ݬ, (!@hD @ !(! $ B  ' 쏾菷䏶܏؏ԏЏ̏'<'!'H,!! !&&t&ed<'9~@ 4P !' $@8!@!'9| @! !' $@@8!'9 @!@ !'9  &ed!`!'<'!'௿  $,b!@!,$cVC!B\!@,,$bcc%&s*b&<@&10P&D& ȏ&D$P &$DDC<4B#b|$|^$B$ !C !!U$!P&P(!~0Bx !(!$@&s (!' PX $ (!*b@&0D$Dp ܏؏ԏЏ̏ȏď!'<'X!'0̯ȯįD!p(!0!< 4R$Q( ! @K@!DX& ! @ !'9 (!$BX!&0$'xB8B0B` !(!$@&R  (!' PBX `(! $*B@&10x !bC(! $$D!$BtCPpp$ @!̏ȏď'<'h!'Я,($ D!p(!0!< 4SD'9( @!$D P&E@$Q !&,P &E$"$CB$#p$ `!,($ '0<'p!'Я,($ D!p0!<!(! 4Pd'9( !@/@ !D0!E|$B| !$r$D$B|<4PbC DD,!b$p$ !,($ '0<'!' ܯدԯЯ̯ȯįD!Dp!0!(!< 4Q$P(! @s@!D$Dp B, !$ $@j@!D(!Dp 0!! @W@!!@!&Q0B,8B0B@C'x !(! $̏'P (!P!BX $ (! @+'0!8!'، $ $P' &e0L4B L(! $@&$'&*&10@&s0B,!,D$Dp  !܏؏ԏЏ̏ȏď'<'\!'TPLHx' $$ ! (!<$bEDc$$ ($(! @@$,DCX$p&Did 0!@$s(,$B%<4$il$ &FidDDD$b|$ttb|B&Did$$H &'@$,,$Bi<4&Fid$il $x$(! $H' !$ $cGa$ԏDx(!&0 ! $<,D$$ixDgH IJix%bG$$h dijx$BȄ  !@@!x(!&( ! $$!$$cDDa$B<#4$<D$@< $d@!TPLH`!'X<'p!(!D $]l<'H!'Hx'!! !(! $@ !t ` !@ 4 @! !x(!C$x(!$  ! ` !@ !h @!@(!&$X $   !@@!d  !@! @ !x(!$  !@ !@#! '؏44` !$K 0! ! @ !' @@!\'' (! $ @ ! @'!'<'!'௱ܯد@'!!$t bd@` ! @!4 (!tx $  ! @@!!$ !܏'<'4!(!D $[<' !'Я($  !! !(!$ȏx$r@@ !   ! !h @!@(!0!  $菼 r4c$4 !$Kb$ƀ ($ !'0<'!'د  $䌢! 0! C&$!##$ @&$" '(<'h!'د$ x!$Q !$! (! ! 0!P $[< !$@4c$ "$@@!Q$ `!'(<'! <'!'诱䯰௼$$B,B@ !8B0B@'!"x' !(! $ !'؏  @ ' &%' @'  !@!菱䏰`!'<'!'௿$! !b0! @@0! !@ @(! @0!$b $ !b& @0!!' <'!'د$ h!&P 8!! !(!!!  !@(!X $@# @ !@! !$ '(!<'!'د$ h!&P$ 8!! !(!!!  !@(!X $@# @ !@! !$ '( $$C%0!$$@C%B0B! $C$b%0B! $C$b%0B!<'T!'௿@!$ @@!!' <'!'௿8! !$B0B@ X(4$X@$F]0 !' <'!(!D $[`<'X!'Я,($  !! !&(!x$@@ !   ! !h @!@(!0!  $r@B c$ !b$e ,($ !'0<'8!'8$C7!x&@ !(! $!'x(!$  !< $$P(! b@ 0!@8!' $ $&d $P$ &@&"@"'<'!'Я($ x!&Q !$! (! !0BP$[`@ 0!"84B"8 <4c<@$ B$P  (!@@!q ($ `!'0<'!P(! $<'!$0!Pb$8c0c`! 8B0B<'\!'د h!&0 8!! !(!!  !@(!X $/ 7 @ ! !'( 8B0B@$!<'!(!D $YH<'`!'Я($ !B<0B$!!@!$ D &% &8@(!X $/$ g($ !'0<'!'ȯ0,($ ! !! !$(!x$pD@ !  ! '` !'9p 0! PC$db !EP 0,($ !'8<'!'د$ !x#$ 8!!$(!Pb$&D!  !@ !(!0'9p 0!(!P$ &D @$""$ '(<'!'د$ x!$QD !$! (! ! 0!'9p (! !0BP$YH@ 0!"`4B"` <$P (!@4c"d$4F0B@0$"&d " @@!$Q"$ `!'(<'!'௿P(! $@!<4C`!' <'X!'௿$0!PC$ 8B0B@! @!<4C`!' <'!'Я($ $P$ !b!d$$b$ d@!&'t,,$jP$j@@0!0$BN !($ '0`0B<'!$BDC $BDB !<'!$BDCd4cDCd$BDB!<'! !$ED`cd0BC%4d`$BDB`0B!<'0! !$ED`cd0B@C%4d`$BDB`0B!<'!,' ! $kf`$LDdff`j4B dcghie`  !c0B`$\!$X$BDCX$b`(!$!'<'!'د ! !,! @6 ! @ !h @!@(!$/X $$$BDDdE`CX4 4$DdE`C\@  ! !C$b  !ƒ !44$ƃ@$K @! ! '(<'!'د$ !3 !  !(! !x@ $  &$&BDDdCb4 4cCb(Dd`! @ !h @!&$@(!X $&CDbd`4B bd  ! ܏(4$@$F[ $ !'(<'!'د$ !3 !  !(! !x@ $  &$&BDDdCb4@0cCb(Dd`! @ !h @!&$@(!X $&CDbd`׏4B@bd  ! (4$@$F[ $ !'(<'4!'د$ !3 !  !(! !x@ $  &$&BDDdCb40cCb(Dd`! @ !h @!&$@(!X $&CDbd`4Bbd  ! (4$@$F[ $ !'(<'!'د$ !3 !  !(! !x@ $  &$<&BDDdCb40cCb(Dd`! @ !h @!&$<@(!X $&CDbd`4Bbd  ! <(4$<@$F[ $ !'(<'!'د$ !3 !  !(! !x@ $  &$\&BDDdCb40cCb(Dd`! @ !h @!&$\@(!X $&CDbd`74Bbd  ! \(4$\@$F[ $ !'(<'P!'د$ !3 !  !(! !x@ $  &$|&BDDdCb40cߤCb(Dd`! @ !h @!&$|@(!X $&CDbd`W4Bbd  ! |(4$|@$F[ $ !'(<'! $DDdb4Bd0c@b%b$BDBb0B!<'!(!D $X<'!'쯰诼$b!8B0B@O! $ ' $ @!$@ !x(! @!'$  !h  !@(!$/X 'P< $$P $  @(!@@@!@0!'$GD $ $!쏰`!'<'!B!<'!B!<'|!'PLHD@<8!BXx' '($BX(!$ ($,BX40< 4P$$,٬ $jB@x!,@ !$] $@ <,,0$j$j $NcD(!$]l $@ @!,,,$j$jM$i쏆D$[`(! $@ @!,,8$j$j:$D`(!$[` $@ @!,,8$j$j'$ D(!$YH $@ @!,,<$j$j$DD$X'0 $@!@ !,,8$j$j$&0 $N!PLHD@<8`!'X<'!Ԩ  !<4B<4B<4B<4B!<'`!'د$ !,`00B<6$k  ! 0!$ '(<'!'8x'$(!!  !$< $'PP $b$ (!  $@!(!`3$ '@!'x$ !`((! $ !P' 쏼$ (!$ !x (! !'0P (! $`!'<'X!0B0t$ <'$!CX$BXb @(!bD`!ce!<'!EX$BX+@8! F!b bb b b b!!<'!'௿x!bC$(! $$$cPe$Dp$B' ! `0b+@ @ <'!'د$ 0H&"H!&  @(!@&#H!!$ '(<'!CH$BHb @(!bD`!ce!<'0!'쯲诱䯰௼!!X&X"i!# ba"4@ !x' !(! $"", !"" "#" $6@!'9 @(!'0 !x(!$ @!$ $$@02Ē"$6"8<\"P@^"D(!X#"&$C#F! Z@@!$" ``!` , $k4`!1&X<4쏲菱䏰'<'!'د$ !CX&BXqb` !c b !'9 @ !&BXx&bC(! $8$$D$c@ e$B p!$ '(<'!'ȯ40,($ !(! 0!& !<'9 6P@(!, $kTQ@$B@" $8,ED$k6P ?"#x&2Cb11@ ! (!0!@8!&0 $ $B`"#pHB&cH &  (!@&cH0$cDb $Bb $!$ !40,($ '8<'!'د$ !D(!0!< 4Q&'9  !@!(!,@$k,B4$k@$e  '9  ` !@!D$  !$ '(<'~!'د$ !D(!0!< 4Q'9H @ 8!, $l$H8$F $ $!D$  !$ '(<'|!'Я($ !d(!0!< 4R&0'9  !@  8!,(! $lL$H8$F $ $!d$ @!($ '0<'{!'د$ !D<(!0! 4PCH$BHb 8!$h8$f $ $!D$ !$ '(<'{!'Я($ !d$B!<(!0! 4QDH$BH(!@0!!C*@$@8!$8$ $ $!d$  !($ '0<'y!'د$ !D(!0!< 4Q'9H &, !P@$lx`!  $D !D$  !$ '(<'x!'X !D(!<0! 4P, @,P$l'9H @ @!, $lBB4@ '9 ` ! @@!,0$mxqX$bX"!# bb4"x,@|'( !(! $"(|,"  !."8/"0"#2 4 @!#"'@#$$C#D!(! ! B $' @ ! (! B&,`@$mH'  $HLP$ (! @@!x'$ ! (! $@ ! (! 揼 #&'@,`$EmX '$N" #$b$b @`$B$ (! @Q@!x'H$(!  ! < $ 'HP $ @ !  (!# &'@,`$emX '`$$$;| @$P' '@ '珙P '` (! $ @@!T"(! $ (! $ 3x' !(! $$@$TV"$ Ζ"Яԧ"P(!"ܯا$#&$2d#f! $@!\ " @(!'9  !  , $mlx `x1$bX4,xb<c4,$m $D ! '<'r!'د$ !D0!(!< 4P$'9H @,% $m@ !B4@!'9 @@!, $m쏼!D$ !$ '(<'q!'Я,($ (! 0!pH&bH!4@  !'9 @ '9   !@@! @!@!&bH$  !,($ '0<'p!'Я,($ !(! 0!D<'9H 63@(!,@-$n,B4$nH$ @ &PPC @ !,63EH$nx '9t '9 @ !(!x 8!@ $,$n -P!!& !bC D EFCd<84B9#bB$ "%&$BX$DEPC$B$ `!,($ '0<'n!'د$ !D(!0!< 4Q'9H @@(!,$n,B4$nH@$  '9 ,@$o  '9 @ !@!D$  !$ '(<'mH!'Я,($ !(!0!< 4SD'9H @@(!,$oT,B4$o@$  D'9 @!&0x !(! ! $,$o @! !FBCDE " $ `!,($ '0<'k!'د$ !(!0!< 4R$'9 $@ @8! B!"#%&'  @!$ '(<'j!'د$ <'9t! 4R(! 0!'9  !$@ @8! B!"#%&'  @!$ '(<'j!'د$ !<0!(! 4R$GX$BX  !"#%&'  @!$ '(<'iX!'Я($ !d$B0!<!(! 4RFX$BX !@(!#!C*@ $ ! d$ @!($ '0<'hL!EC\!<'h!'௿ (!@!dh!dh !' d\<'g!<$bDEHFG cDB $ $<'gP!'D@<840,(x!!$(! &ĆD%PP,$X$҅@$HX҅@cH$oB R(!, $p(!, $p $0!,􏇼 &$p@@@!$(,$B%<4&&p@$pH $),T!$pT$@ b!$$, $px (!, $p$ 0!,'  $9@ @!, $pl!x  0! (!  C`@0! !$fbC$c@B`S! Cd !$EP$ebC$c$x&†D&ph !(!$T ՆD$,,$p$p쏇H ip܌JKl$…lmn $|H iąlJKp쏙x$Bx| !lmn  @@!x(!&0 ! $<bh24$P  !@!`!D@<840,('H00!!! !! ! !<'bh!'௿<$_(!4BpD` @!,,0$q$q@$N !' <'a!'Я($ <!4C#! !  !t@ ' @ !$Cd# Cd%<4C$d ! @ !!($ `!'0<'a!'௿$ 0!b$d!$d @$$Cd`!' <'`!'Я,($ !!$$(!<S4Bp @(!$( $hh @(! $`@!<C%,x&dd $81 "0h @ !0 $Dh@ @ !, $i@1 &pd0  !,($ '0<'^!,<`4B <'^!  !!<'^|!'د h!&0 8!! !(!!  !@(! $(  ! @ ! '(<']!'௿!| ! !`!,@! @!,`!' <']X!'௿<$_|(!4BpD` @!,,0$q$q@$N !' <'\!'Я($ <!4C#! !  !@ ' @ !$C# C%<4C$ ! @ !!($ `!'0<'[!'د$ $b! ' $@$$(!Cdɔ$ @ (!ɔ$FCdC !$$ !'(<'[!'ȯ40,($ !!(!<N4Cpx&q ! $@ ! 0!P $_|#$d@!$b$1'D  $@*@!&rBd &d@&d",@ !| l @ !@! ! ",l &d@!!$B40,($ `!'8<'Yx!'د$ !$dd @ ! !T@ !Q,|  @ !T  !Q,@ ! @!!`! @!!$ '(<'X!'௿ !' <'X\!'௿ݰ !$B,B@! @!`!' <'X!'௿<$^(!4BpD` @!,,0$q$q@$N !' <'Wt!'ȯ0,($ <!4G!.!+ ! h@ ! @ !&Fȏ,$c̯$q $Џ&B",#<4G$4b $qbfg @!`8!0,($ !'8<'V`!'ȯ404$ 8!4!' 0!b!'! @$$ȎbȬb40`!'8<'U!'Я($ x!$Q !$ (! !4'$C 8!4 0!@! !'! ($ '0<'U(!< 4BB!<'T!< 4BB!<'T!< 4BB!<'Th!< 4BB!<'T(!< 4BB!<'S!'TPLHD@<840٬$b^D#LHD@<840,('P$.$,E $ $/$,F$.$,B$5@$;$z`!!0B@$`!<'h!'ȯ0,($ !!!!p!,`F$ '@ !&ͨ '+@p!0,($ '8<'!'௿<G*@<D!hD#H0!0b@< 4Be%0!H!!8'bG$b$*@$c0Y !B0B@! !' <'!'ȯ40,($ !! !<'4CX` ! 0!u!!@@!!&RB'9@Q!  !@&10,&B*@<4C40,($ `!'8<'Ϭ!!d<'ϐ!$Bxp<'x!'h!!' $\ ! 'x@0!(! ''  (!@ ! (!'9h $'<'δ!'ȯ0,($ !$M$b@!!P'9@!  !&(!@&R0 !@4 @!b&1"*@-$x(! $0̏8ƈ$(EFGH(Bf&d%g'h(b)e*0$H $*@!,$EFGBe d f g b 0,($ !'8<'!'௿<4C!'9 <(!@ !@4c'9  ' `!' <'̘!'௿'9 !b!b#!<@ 4c!B!B,`!' <'!'`!!' $\&0  !(!'@0! &0$'(&1% &E  !(!'@0! 'x&E$ '  !@0! (! '' (!` !(!'9h $'<'ʠ!'Я($ !'9 !@!<24C` ! P!CP#!d, <p@4cD ! $@!(!8$0 !xB $P(!`! $ !  !!($ `!'0<'h!'\XTPLHD@<8`'9 !@!N@L& @ !,B!@C&%  !,BA@;&f௣  ` !,B!@3& ` !,BA@+&ȏ  !,BA@#& $ @ !,B!@&*  !,B@&௣( ` !,BA@ &믢, @ !,BA@ 8& $菼<l4Bt!0CT#x#!` !(!p, $0C̏#!bXp,4B$db $!B̏"!@$@ (!D̏X !$ $AB̏"!@@ `(!D̏X !$ $AB̏"!@Ǐxp@$xpD̏P ! $E` !P(! $ @0D̏$4!#X !$  $!B̏!)8\ !'ʼn( $@8  !$%C0T!$T#X !$%(! $A"̏!@ef@ $̏X !$f $!"̏!@*@v$̏X(! !$* $"̏!j@0B@$?*@;!$#X !$*(! $"̏!* &qȎPď!$ &0?$U! P# &0?! bȏt!t#0!"  ! (! $*!"'É(dfghʼn(c#!D*E%F&G'H(C)%̏ƈ&%(! $*% !8(! $fB0B@ !'9  $0B@ !'9  $0B@ !'9  $@!$#X( !$ $A"̏!@!$#X, !$ $A"̏!+0B@((!B(8(#`) E(!\XTPLHD@<8'`<'!'Я,($ p!@!!&1P'9@!  !&&e@&R0 @W<"*@B@!!D'9@ !@&0B&1"*@B"&e<74BQ!CQ#!bX$d4Bb $!B̏c,!@$D̏ `(! !, $b0B@!D̏p !@ @!D̏(! ! $ !<4B!,($ '0<'!'Я,($ !*!)<`%bb*@<0 !R #!'9@ D !@&0b*@#Bb*@<4CC!C#R0!8!$0 $ $"!$B",($ `!'0<'P!'Я,($ !!<4B"@h' (!R$@!#ЏC*@x !(! $0<4B,($ '0<'!'LH!'9̀ '@ !(!' @$!LH`!'P<' !'௿'9 !@ !A<4BD!cD#C0!8!$0 $ $!' <'T!'د$ !$(! 0!(! $ $@$( $ (!&D؏X$@ &Bؠ@@$ԏ$$  '(<'x!'plhd`!'9 !@@!8@ !&( $@&('@(! $A B(ƈ@ ! '(! 0!ԏ$  Q!cQ#b!&% '@8!`0!&0 $ $ !B@<, @ !<4Bplhd`'x<'!'H,8!$Ɛ!' $ '8$\ ! '(0 ' !' @0!&B|$  !(( &Џ&Џ @! @ ! !@(! @0!&B|$  ! &d&d @! @ ! !(! @0! ! (! !(!'9h $'<'!'D@<840,($ '`!!$\ ! !&P( !'@ &U\ !(!܏( @0!& !$ &P=  ! !(!@0! ' !`(! &Q$`(!'$^h! &Sʏ$\ ! &R.  ! !(!@0! 'P& ! $  ! !(! @0!& ! $  ! ! (! @0!& ! $ ` ! !`(! @0!& ! $ @ ! !@(! @0!& ! $ ' !@0! ' ! (! !(!! $D@<840,($ 'H<'`!'TP !$(&4 @(!'H 'LHD ' LH8' &\$Ɗ $d&.$< $ЏTP!'X<'!'x|xtpt! !@8@!&$\'h $ @@ !$'@D @(!hb@$bh,h $:@ h$Eh @ !@ (!<4B8&df '&%= '@!<4P!|xtp'<'@!'PLHt' !@!&('B@$  !PLH'X<'!'X!'9 !@:@ !D!cD#C!*@ 8!"@)<8!@0!&0 $ $! ! &*@<8!@0!&0 $ $!<4B'<'!'TPx!H'(! $0 @ $h'H ''!@(!!TP'X<'!'9̀ $<'!'9 $<'!'9L $<'!'9̀ $<'x!'9 $<'X!'9L $<'8!'9̀ $<'!'9 $<'!'9L $<'!'TPLH %ЏX(!$A &xp&xp@"Џ800!00#$1$ &G̏@ @!8 $$+!"ЏxD00!00#1 (!$0!8$P $ԏ '@'$4B ' '!TPLH'X&$&@$ @@e0&`0!!<',!'840,($ !! @!<\"4Sۓ!$Rp !$B$&1`(!0!@! !*#`$ * @ $  !$E$ !$$G$$C&G!C$C0&,` !$ 0'!840,($ `!'@$, @0!C$$$, @ ! C$$$, @C$ +!0!C$CC$CC$C$!0!C$@ C$@C$@$!0!b bb$!%<#(`@ <, @$b%!$, @$b%!$, @$b%!<4B(<&(`@#<, @$'b'!$, @$'b'!$, @ $'b'!<4B@!H! %e%G%<4I !@!0!H!' ''e' 'G'<4I ! 0!8!<4G!<'!'Я,($ x!!!(! @ ! *@!"8`@ !$h'@@0!" 80!@ !"$l @8!8@0!@ ! $p@!,($ '0<'!'د x!!(! $  2<34B`.&$b,E $:b$b"# "#,D"C!$B$b,B"C!$B@ !"C!$Bخ"x(! $ <4B! '( 0! '' '!<'!,@ !C!B<'p!,@ !C!B<'<!'د$ !b@!`!@(! &@ !@&1!$ '(<'!'د$ !b@!`!@(! &@ !@&1!$ '(<' !'0̯ȯį8DЯ&| !&|!8 $<@@! DX &|@0!8 $t"8<'ĉp $d@0@! DX 'ʼnp@0!8 $   !<4B<j4S8 (!$@0!8 $ (! Z  !@S@!D ,C؏@,B@A`?@&*@&*<& @ ! & @@!(  '@@!&&& ! (!@ DX &|@0!8 $L<4S !   !   !``!8l'ʼnp $|@`! DX 'ʼnp@0!8 $L<4S`!̏ȏď'<',!'د <!4C?! !x(! :$0 &$ $! &% X $!@8  $p&$ $A&$* $&$ $A&$동 $A!", `!'(<'!'௿ ! !@(!X $!' <'!'د$ 8<!$d &p@! !  !@! DX &p@0!8 $<)4B @ !@ @(!'9 @! DX &p@0!8 $̏<4P   !!$ '(<'!'ȯ0,($ 8!<!$d &Dp<@!@+63 DX &Ep@0!8 $%6"E @  !@@ !'9 (! @!  !@ !   !`!0,($ '8<'!'௵ܯدԯЯ̯ȯ8*$$B!`$*B,<&Q  ! '$@ @!8`(!$  0!8$B($8B$VB@$V&Bȯ($VB,B@&B,8$B0$BB@&B믢0 84$B b+&p`'$ < ! $d@*@! !D$]X  (!@0!8 $46  (!@$4+@d+`,$ ` !@@!(  '8@@!8  $X"8 (! $  ` !<_4B4$c C+@ 8 $Џ<4P  ` !J!4 $B, &p@@! DX &p@0!8 $<*4Bɨ@ !(! $'  (!@ DX @0!88$p $L<4P   !!܏؏ԏЏ̏'<'d!(!'9 $<'D!'9 0!<' !'ȯ0,($ ! !@!!@!!@(!  !@!B&R !(!@$$"Q* @ @!8(! $``!Q*@`!0,($ '8<'$!'د ! ! !(\@$  \ !  (! !'(<'!'<840,($ !! !!@U!  !8(! $Eh !@ @! @! !0!(@8! $ @ ! @!@$@!`(!  !@ !'l$ @!&s@!@ ! @!r *@<$`<4T  !!<840,($ `!'@<'!'@h !@ @! @! !0!(@8! $ @ !''9 @!@@!`  @'` @<4P('0! ' @@ !  !!' 0!b$!<'L!'௿0!8 $p@!<4C`!' <'!84 $p<'!'Я,(8`!$p ' !\ ',('0<'p!'Я,($ ! !''9! !@8!D0Bt@ !'@' @8!<4Bb$b%.B0Bt@ !'@'<4Bb$ @8!<4Bb$b%2"t@ !'@'0B @8!$C$C%,($ !'0<'!'Я,($ h! !! !@ @! @! !0!(@8! $ @ !`0!8!@(! @!@!  !!,($ '0<'!'Я($ @1!!@1!B0B@-0@+@<=$o'd  %@g@!$ .@$<[4B<W4B !'K0!͈ '@9< !':0!(B0@01@0@B@?<0B@;<0@8< <24C0!d' 0@(@!$.@$$<4B͈ '@<4B !'$'9 !'$'90 @!@!4C($ `!'0<'!'诳䯲௱ܯد! !0B@ 0B0@<0@<%0@ 0 <<4Bb$ "<0D<`4Bd 'Џ@X@!͈@ 'Џ@$BB@$'9 (''@ $ !@'D !p' $!@$B @  'Џ@&,B@ 'Џ@$$  !'9 '$B(C @ !`Я`!菳䏲܏'<'d!'<840,(<4B$!!` !'   !'@!@!2P '  !@@! ` !@@!   !  !!<840,(`!'@<'<!'௿!݄  %<݄4B $ "݄ 0' <'!'Я,($ 0B!!!@d'  %@3@!' @(!@)<B0B@2"<d4B $" '@@!' @(!@2"@!d' 0@ @!@(! '@<4C!,($ `!'0<'p!'`x'`!(! ! $0$$h$c,b@2<8$c@C!B\!@t! (!| 0! !&(8'$b(Bc(&($<  ! 0!|'  0! !&+l (!  ! 4B@&hl'i $'<'!'௿$$0!b ,e,b@ < $ʄb< @0!4F!' <'!'௿ D !' <'@!'௿ˬ !' !0B@$`!<'!'د$ !<-4D$C<C*@0B8 '9 D !@&0B<*#B<b*@<4D$ " !B8b!b4Bb$ !'(!0B@$`!<'!'Я,($ $!0!.B<*@'D8'9 !@$!4@!&RB0'9Q!  !@&1HS$4B*@!,($ `!'0<'!'Я,($ ! $!b4@!P0'9!  !&(!@&R @ !b4&1"*@$,($ '0((!!P@$`!((!!$P((!!P$<'P!'Я($ !!!$T (!'9  @ !@S&1&1 !&1*"@&$($ '0<'!'ȯ40,($ !! !<'4CX` ! 0!u!!@4@!!&RB0'9Q!  !@&1L&4B*@<4C40,($ `!'8<'!'௿'9 @ !b!!<@ 4c!B0!BL`!' <'!'Я,($ ! ! <'9 @ A@!<(4C"!0C !H$b@ <'9 $H@@!4C00!b!eHH` !,($  '0,($ `!'0<'}!'ȯ40,($ !! !<'4CX` ! 0!u!!@4@!!&RB0'9Q!  !@&1H&4B*@<4C40,($ `!'8<'|!'د$ !'9 @ !@!<4D (!P! B0b!CH$DH$b'9 @(!P!c0 !C!BHB$ !'(<'{!'840,($ !'9 @ !@[@!)4@!!&RP0'9!  !&% !@&1 @@<4B*@  !@<?4CS!á0)!cH`B<b*@HB8b!``¡0!EH '@'\ (!0  !@@! < 4CxB0 !! !(! $!840,($ `!'@<'y!'ȯ40,($ '9 @ !O@!@M&  !,B!@F<&%  !,B!@><Q!c0$C!PHH.'9$ @*Hp`%<B<b*@<B8'9C!  !@<P4B4Bb0Q!Hb!dH<>4BQ!c0xC!` !(!pLqH $d0(!D !XL4BH$! $b0B!@$%@ (!d0X !$% $!b0B!@Eb0&&PB!$GP $ $!40,($ '8<'w !'Я,($ x!4@!!&1P0'9!  !&&e@&R @_<4"*@dH'9$ @R<B4@!!D0'9 !@&B4&1"*@B4"&e<74BQ!C0X#!b$d4Bb $!B0cL"!@$D0$$ !LH`(! $bB0B@!D0 !@ @!D0 (! ! $!<4B!,($ '0<'t!'௿'9 @ !@!A<4BC!8!c0C0!$ $ $!' <'t,!'ȯ40,($ !!0!/<`+b4b*@$<P0P!b!'9  !&@2` $#HbPb4*@DB4*@<4C0D!C0!8!$ $ $B!$BB40,($ `!'8<'r!'ȯ0,($ !<-4B4@&!!&Rb0'9Q!  !@$HH !b`(! @ f08&0!H$ $4B*@&1!0,($ '8<'q!'D@<840,($ P!'9 @ !@@! ! '@!@E¡0 !!'9  D !@!<64Bá0!s!(!'9   !@*&*@@(!< 4B'9 @  !0c(!E!CTP@@!X  !@@!0(!'9 ` !@!D@<840,($ 'H<'o!'ȯ0,($ !'9 @ !@!< !' ,4C q!@#!d0'9  !@!@(!@!d0'9 ` !e0@ !X (!@!@(!d0'9 @ !@!0,($ `!'8<'n!'ȯ0,($ !4@"!!&Rp0'9!  !&@(! (!8@$Lf00! $4B*@&10,($ !'8<'m!'Я,($ !!!$x !(!$! &1!&!!!&T (!'9   !&1@(!@$!&R! &s*"*c@&`,($ '0<'l!'P! '(!'@@! !`!'@8!0!!$($!$c!@$@E!@<'l!'Я,($ !b4@!!&RP0'9!  !&1 !@ (!'9  A$b4B*@!,($ '0<'k4!'Я,($ !4@!!&RP0'9!  !&,@&1 @!4B*@`!,($ '0<'jp!'@<$ 24&d$$ &0@3@!"4x000!1 (!&d$Į<$ &'8@ d!'84088' $B 8$,$B( !(! @ !$Ɛ, $@@!8 @ !  (!$Ə $@@!88$8   !@@!8-$x|  !@@!8"$'(  !@@!8$  !@@!8 $8\  !@! !8$t80$p $N!840'@<'<!  $`<'<`!  $<'<@!  $<'< !'Я,($ ! !h0@" ! @ !@ @! @! !&e  0! @8!@ !$ @! !)@(! @ @! @!0!@8! ! &e @ !@!8 $$ ! $@ !@(!\   !,($ !'0<':`!'د$ ! !h@2@ ! @ !$(\@! $@ !$\< 8!@$< !$h! h !@@ !8 ! $ˌ`!  !@(! $ !'(<'98!'Я,($ ! !!@J! ` !@ ` !h @!@0! !8 $4 @!@(!( @ !h @ !@ @! @! !0!0@8! $ @ !$ @!B !h  !@ @! @!@8! 0!0 ! $  @! !$ @!@0! !8 $D @!@ !( @(!h @ !` ! @(!  ! @ !,($ !'0<'6\!'<84088' $B <$,$B( !@ !$ , $ȏ@@!8Q$h8 @ ! @(!$Ɣ $@@!8=$8 @ !  (!$Ɠ, $@@!8)$8 @ !  (!$Ƒt $@@!8$􏙽8 @ ! '($Ɛ $@! !8$,80$p $N!<840'@<'4P!'د$ ! !@Ah @ !@ !$(\@! $@@ ! EP*8\ !$ $@(\ !$@ $ @ (\ !$@0 $ @ E8  !h @ ! !@(! $ !'(<'2!'د ! ! !(@$? $ތ  0!h@$<!   ! ! @(! !'(<'24!'د$ ! !@qh  ! ! @!@(!ތ (\ !$: $@$ތ K$ԏ(\ !$; $@$ތ(\ !$; $@$ތ(\ !$;( $ @ (\ !$;8 $@ތ$(\ !$;L $ @$ތ(\ !$;X $ ތ @$$$$ @ ! @(!$ !'(<'0!'د ! !h !@ !0 $H`!  !@(!  !'(<'/x!'د ! !@h  ! ! @(!$:bh  !@ !, $-@@! !'(<'.!'Я($ ! ! !Ѥ !@ '( ! $ !@$ !(!`!  !(@$< !$ ($ !'0<'-!'د ! ! !h !@ !  !h !@ !, !$ $`!  !`!  !@(!  !'(<',!'௿8$$b!$b  <C%!' <',t!'X x!$(!! '( $'Hx(! ! h!! @! $l @! @ !th !  !@0!8 $ x| $$B "! @ !&h &1( @(!  ! @*`$b$bWh( ! @ @!  @!  !0!@8! ' |ݬ| (!  @! .@8̯@ !$ƥ'( $ @#@! $ @! h @ ! ` !h @! 0!@8!8 ! $  @!  !h @!  !@0!@ '( @!  ! @(@ @ !'(P0! 8! @@!ݬ4 (! @B @,h@h ` ! @ @!  @!  !0!@8! ' h@ `(!@0! 'h '( & ޠ| * @W 8@ !$ƥ'( $ @@! xh @!  !@0!@ '( @m@!ݬ0 $ @B ppD  t @ !8 $T  @! @ !, $ $ (!@0! $ 0$ݬ @! @@!E  0! $A  (@ @ !'(P0! 8! @!4`qЎ" @ $h @!  !'H$@0! 8! @@!s@H@ @ !'HP0! 8! @!'( ! x'Hh  @! @ !'(4&& 8! @@! ` ! @!  !(د$=L'( &&䏼 @@! t @!  !(د$'( &&䏼 @@! @ !l4$ @$-@$  @! @ !8&&$l '( @{@!(@  @ !'(P0! 8! @k@!'( hޠ8 *(!ݬ@|&Y$l $ 8̯@ !$ƥ'( $ @D@! xh @!  !@0!@ '( @0@!(@ @ !'(P0! 8! @!  @ !  @!  @ ! 4@!`q   !p @(! @" @ 'H $h @! @0! !(P(!$=L   $h @! 8P !@0!$T (! @@! @ !(!P0! 8! @@!ݬT $ @@!B @h$  @ ! T(!ݬ @! @@!B @  ! h@   ! $h @!  !$  !  ! h@  ! $h @!  !840!$h @8! $  !44@0! $Kԏ   ! sBlh@  !  ! @! @   ! @($P 0$PHh !  !  ! @! @   ! @($P 0$PHh !  0!44$p 8!  '(  'H | h x t   !   !@! '<'!'\XTPLH x'(!!@ !(!!$ !  0! 8!P@ ! @(! @,@! @(!@ !P0! 8! @!ݬ@(!4 @@!B @$hb d  !P@(!t`(!d  '(! \XTPLH'`<'0!'د$  x!$`' ! (!' !x(! $@'@ !x(! $@8! !8$@$Ʀp  !'! ! @T@!񨏤 `(!8!' ($`$ '  @(!@!@ !(\$@9$l @ !$@( !\@$T`! ' '88!@$܏'9o @@@!@  @! !@(!0! @8!&su*@  !$  '(<'!'plhd`x'!$@ !! (! !  (!@Q@!(\ !$l $@ !(\$T $@$ !8 !$'X'9o 8!@5@!X@1@  @!` ! (!0! @8!@!8\$-P $@ !`(! '9p(\$` $@ @! !`(!'9s @!@!plhd`'x<'!'lhd`\XTPLHx' $@!t@ ! (! !@h! !@ ! @(!@]@!h  !@ @! @!@8! !00! $E @.@!(\@ !$El $@@ !@  @!'@@(!0! @8!(\$E` $@ @ !'9s '@w@!<4Sp8\$x $ @n(!x'` !$@ D' !x(! $`' !x(! $@@8! !8$@ $Ʀp !'D'@ !D !@;@!񨏤D@(! &R8! !($`$  !  (!@! !(\$$E`  !(!\@$ '9s8 ! $-P !@ (!'9p @@!S*@D !`̏@ !@!b*@񨏤@ (!@ @! @!@8! !00! $E @e@!(\ !$T $@% !  !$ @! !$ @! !$ @!@ !8 0!$ 8!#(\$El $@7  !$ @! !$ @! !0!8@8! $ԏ@@!h @ !@ @! @!t (!0! @8! ! & ! !l*@   !`!lhd`\XTPLH'p<'!'d`\XTPLHD@x' $!!@ ! (!h0  !@ @! @! !0!@8! & @@!<4Vp8 $<̯@ !$d@(! $@n@!8 @ !@(!P0! 8!@`@!,\hB @V@TB@P@ ! @ @! @! !& 0! @8!@!@ !@$  !$ @! ! @(!h@D @ @! @! ! (!0! @8! ` ! '   !!d`\XTPLHD@'h<' L!'d`\XTPLHD@ x$!(!'( ( $ 8 @ !$8\ $4 @  $ @(!0 '(  ! $P@! @443` ` !p @(! @b0B@hd @ !8 $x @` !(!'9_\hd @ !8 $ @ ` !(!'9^ @!hd @ !8 $ @hd @ !8 $X @ $b[ $h @! @0! !8 $\ @ ! @!  @ !@(!8$8! $Ư @  !` !@(!  0! @!  ! @ ! @ !@(!P0! 8! @ !$b,B@$ p @(! @b(Q`m`!픯 $@! !  !@0!8 $L @\@!h8 @ !@ !&Ő 0!'&x   ! @! t  ! @ t  !<4cu C@3P0< `4Bubc 0  @! @ ! &Ő @@!0  ! @0!$   (! @ @!  ! <4Bu@0!88$B'$8!&x'Đ,  @ ! @! t  ! @ t  !<4cu C$b$b& !( ! $ @0d$Hh d@(! @<4Bu( $ @<4Bu;4EpMh '  !(!x$ @!   (!@ !$0! 8! @@(!  (!@ !P0! 8! @@(!` bB @<c ! ! t  ! @ t  !<4cu C(0d  !0 @! 0!'Đ,8&ǐ $<'9௢  @ !t @! @t  !<4cu Ct  ! b < b    !  ! $ ܏؏ԏЏ̏ȏď'<'!'د ! !@ch  !@ ! @!,B@N&H$  !@ ! EE< ! $̏@ ! Ex88 ! $@ ! E+8 ! $@ , ! $y0@ Ep !< ! $Џ쏃 @$bdE !E !  !Eh  !'(<'!'د$ ! !h@V @ !@ ! @!,B@&H$  !@ ! E4< ! $̏@ ! E<{8 ! $@ ! EDn8 ! $@, ! $y0@ ! ETY< ! $Џ@T ELL !  !@ ! @!,B@C&H$  !@@ ! E3< ! $̏@@ ! E&8 ! $@@ ! E8 ! $@@ ! E  , ! $y0@@ ! E $ !'(<'!'ȯ0,($ h!! ! !@!h< 6p @@!@> !Ҩ $. !$.Ҩ @! 0@!@/@! @ ! &% b@ !&8 $d@! 6p @!0,($ '8<'h!'ȯ0,(! $!P!$ @' $%$'9 '$@0@!8  $`@ ! $@!@!$ @' $%'9 '$@@!8  $`@ ! 8!@!!h$ @0!880$$p $N!0,('8<'!'௿X  (!@ !'9h ' <'Ř!'PLHD@X (! !@@!D$ @!($$ $@!x' (!$ @ !8 !$0 @! !88د$Ɛ,$  @(!@^@! $$h @! !@0!8 $\@@!<F4Pp84Pp8 @ !@(! `0!@6@! @ !$T $ @(@! @ !@(!P0! 8!@@!,` bB @<c 0 @ ! ` ! ' !  !@0!880$$p $N!PLHD@'X<'!'௿ ! @'9h ' <'!'ȯ40,(88$$B  !@ !$ ,@! $䏼@!(! @ ! !$ƣ $<80$d$p>$N@! @!@ ! '  !$Ɵ $8800$($p$ƨ$N@! @! 800 !$$p$ƨd $N8$( @! @!!880$P$p $N  !40,('8<'T!'PLHD@x'  !(! $Џ8 $@ !(,$ (! &f@6@! @ ! $@$  (!@!@' !  @ !8,&f$<  (!@@! @ ! (! $8 0!@! ' !PLHD@'X<'!'Я($ ! !@!$z%(! @ !&@ . ` !${( %(!`($ !'0<'!'ȯ0,($ !! !@%!!` !$x %(!&@*`&1H4$Bx"!C $BXb!e !$x%(!  ` !@!! !$Bx"! $BXb!e &R@*CT` !`&1H0,($ !'8<'t!'ȯ0,($ !! !@%!!` !$x (!&R@*C`&H3$Bx!C $B4b!e !$x%(!  ` !@! !$Bx"! $B4b!e &R@*CT` !`&1H0,($ !'8<'!'\XTPLH x'(!!@ !(!!$ !  0!@ !P 8! @(! @*@!(@& @ !@(!P0! 8! @@!,ݬ@(!4 @! B h@ d  !@(!  `0!  '(! \XTPLH'`<'|!'@x!!!!!'(! $@!`Eݬ @(!D@!8 $\@!b$Bb $cXC!E$ @&.@&R8$ $쏼@b!$Bb $c4C!E$ @&.@&Rޠ B*@$cb8'Xx$@ ! (!  $@0!'8` $' 0!,$@'9 $\$@@!!! !$x (!&R@ .C$Bx!CB`&H!'<'!'Я($ !!x'X !(! $'p@ !x(! $@'  !x(! $4'8x$b̐HGčDEF <EN4BV 02$( !(!,X $ $ ̯@ !0! (! $@9@5 @ ! (!@ 0!@& @ ! (!P0! 8!ݬ (!@ !B @h @ !@(!  $@  !p@?`!x' !(! $@@ !0!8$@'9 $l@,@!@)`!!$-$:bEd$c`b@ (! @ !@ !(!t @!  !`!($ '0!<'P!'lhd`\Xݬ ! (!@!h@p!D '@ !$(\ $T(!$@x@_ ! Dh @ !0!<$@'9 $@! !<\$@F$ h@@`!D @ @! @!0!@8!0 ! $ $@ ! @!h @ !D @(!@ &@(! @0!  !`!lhd`\X'p<'!'X x!!!'((! $ `!ݬ  (! @@! $h @! $8P !@0!$8 '( @@!(@ @ !'(P0! 8! @w@!ݬ4 (! @p@!hD @ !$(\ $T @a(!x'H$@  ! Dh @ !0!<$@'9 $ @J@!<\ !$ $ @AhD @ @!  @! 0!@8!0 ! $ $@ ! @! h @ ! D @(! @ @(!@0! &   !  '( &ޠ  * @K`!'<'!'840,($ !!b!@#!!hp  ` !P!@(! &R@ &1b"*@!e P!``!b@Z!@0  @!0!@8! &E $ ! h @ !@ @! @!0! (!@8! '@  @!e@8!0! ' &E  @0! @ !840,($ '@<'X!'0̯ȯį $!BV!.B@$$B'(;BO!7x$ ! (! 8 $  @!  !h @! @0! !8 $  @!  !h @! P !@0!(! 'Ǟ8 @ @!(@ @ !(!P0! 8! @@!ݬ4 (! @@! $h @! @(!  ! @ !h @! @ !$(\ $T @Hݬ4 (! Dh @! @ @!  @! 0!@8!0 ! $ $@ ! @! h @ ! D @(! @ &@(! @0!   ! h  ! @ !$(\ $` @.  !   !h @! P !@0!'Ǟ8 (! @V@!(@R @ !(!P8!B$؀h  ! @ !$8\ $쏼 @7  !  !(\ $Y쏼   !h @!  !@0!(! $ @@!(@ @ !(!P8!$ڴ @!  !   ! '( x'H! !(!$$^  ! ݬ (! E0!'9 @! @4C( C#D !$b$hlB( b#d!y  'h(! ! 0! D(!b  ' ! 0! D @ ! $ '$ @!  @0!0 $  ! @!  ` !h @!  !h @! $ !P0!@8! (! @U@!H@ @ !(!P0! 8! @C@!ݬT (!@!B @:8D $\ @0!D '9܏8D $쏼 @ 0!D'9\ 8D $ @D'9   h ! D @(!   !  ` !  & ޠ * @ 'H  !x'p(! $`! үݬ (! E@!  $B4F'9 @@ ! $ '$@! 'p  @0!0 $  ! @!  | @ ! @!8 $ @'9  @(!B8 $\ @ !'''9T ' @(!'9܏8 $쏼 @ !'$QT' ! ' !'' ! '$ bS@(!'9\  h @ ! @(!   !h @!  !h @!  !0!@8! (! @@!p@ @ !(!P0! 8! @!  !   !  &ޠ * @('p `!̏ȏď`!'<'!'௿ $$C0! @0!!' <'x!'ȯ0,(8$Bh! < 4P@ !$ , $88880 !$􏙯$$(@G$N`!  (!@ ! $$ƥ@ 8(880 !$l$$(@-$N`! @ !' $$Ƥ  880 !$$$&@$N($l`! !8880$4$$(@$N !0,(`!'8<'!  $<'p!'Я($ 8  !(!@ !$ &&@! 40 !$$^$N8&$@! @!!840$$^$N& !($ '0<'!'Я($ ! ! ! !t !@ '`!  !'(! ($ !'0$E!<4Cp`!<'!'XTPLH x'($!!@ ! (!   !h @!  !@0!8P$8 @(! @@! @(!@ !P0! 8! @!ݬ@(!4 P Ѥ`(!D  '(! XTPLH'`<'h!'H x'(!(! ! $ 'H !x(! $ 'h$x` ! (! $! ! @ !8 $d  0!@ ! @!   !h @! @0!8P ! (! $G8 @ @ ! (!P0! 8! @ݬ4 (! @z@!hD @ !$<\ $Eȏ @j $h @! @(!  ! ` ! @!  @ !h @! <P !@0!$癘 `(! @; @ !`(!P0! 8! @-ݬt (! @&@!hD @ !$<\ $Џ @ $h @!  !@0!8 $t h$ @ !$8\ $-P @ $h @!  ! @(! @ !@!(\ $Y쏼   !   !h @! $ ̯ !@0!(! $ @ ! @ !(!P0! 8! @ݬT (! @@!'( $  $h @! @0!8P !'( $G8 @ @ !'(P0! 8! @yݬ4 (! @r@!hD @ !$<\ $Eȏ @Z $h @! @(!  ! ` ! @!  @ !h @! <P !@0!$癘 `(! @3 @ !`(!P0! 8! @%ݬt (! @@!hD @ !$<\ $Џ @@ ! ! &ޠT * @V '(   !  'h   !   ! @ @ ! '<' !'P x'(!@ !(! $ 'H !x(! $ 'h !x(! $ (!$x'   !h @! $ !P@0!@(! 8! @@! @ !@(!P0! 8! @@!ޠ4 @!<UU4cUVCÏ b#*@!ݬ4 (! @g@! ! $  $h @!  !8P@0!$, (! @@! @ !(!P0! 8! @@!ݬT (! @4@!  !  $h @!  !8P@0!$緀 (! @p@! @ !(!P0! 8! @b@!ݬt (! @<X4PpshD @ !8 $`EhD @ !8 $ @@'Dh (ͨ ! $ Dh  !ͨ @(! &*@R&@@ ! ' ` ,B@` !P '  '(  'H  'h! '<'!'Я($ ,!$, !R0#@!@ !@* ,B@!BP` !@@(!  !X` !@(!`! &"($ '0<'!'TPLHD@x' !!(! !! $h @ !` ! (!4@0! 8!@!h@G@ ! ` !8@0!$,  (!@! !0 !@! @ !8 $@ !h @!` !8@0!$緀  (!@!@ ! P` ! (!0!@8! @!@ ! ! !TPLHD@'X<'D!'XTPLHD@x' !!!@ !(!$ !$ $`40'@d 0!'p !-$  @ ! (!`0!8! ! @(!@@! P !@(!0!@8! @@! ' @!XTPLHD@`!'`.. 0!8!$@*$b0B,B@$c 8!<'!'PLHD@x' $!!` ! (!8  !h @! @!@ ! @(!0!8 !$8 `(!@@! @ !`(!P0! 8!@@!,@BP  ' !PLHD@'X<'8!'\XTPLH x'($!!@ ! (!   !h @! @0! !(P$=H @(! @Y@!  !h @!  !@0!(P$=X @(! @A@! @(!@ !P0! 8! @!ݬ@3(!4 @! B h@b  d @(! 4ݬ $ @!B (\@$ b d h d\ @(!  '( ! \XTPLH'`<'!'XTPLH x'($!!@ ! (!   !h @!  !@0!,P$ @(! @$@! @(!@ !P0! 8! @!ݬ@(!4 C h`c D d @(!  '(! XTPLH'`<'l!'plhd`\XTP x'(!!!(!$ ` ! ((  8!&?P@ !`(!   &ď @ !  ! @! @0!(! $  @! @ !0 $D @ ! @! (!@0! $  (!@0! $A ` !$ @(! @$ @ !`(!P0! 8! @4ݬ (! @ @ !B @  '( @ЯH ! &?@ !<P'($ܯ   &ď @ !  ! @! (!@0! $ @(!$ '( @K @ !'(P0! 8! @=4@9Q 2" t@.'H$ @(Hs+@#픎 !h@`!! $h @!  ! @(!  $  @(! R '( plhd`\XTP'x<'|!'\XTPLH x'(!!` !$! (!   !h @! $ !P@0!@8! `(! @@! @ !`(!P0! 8! h@@!4BC D  @(!  '(! \XTPLH'`<'{`!'XTPLHD@x' !!(!@ !! $ @!< 24Bp ` !h @! !@0!8! @(!@@! @ !@(!P0! 8!@ @!,@BB  ' !XTPLHD@'`<'y!'د 8! $@!8 ! $@ !( $Џ@  !8 $ @ !h  !"@!8 $$@ !8$Q(8 $@ !4 $Q8 $@ !8$Q ! '(<'x!'@<8x'!(! ! $ 0!@ !$ (! 8!@@!  (!@ !P0! 8!@!X@(!$ @P  '!@<8'H<'w!'\XTPLHD@x' !!! !(!$!p ! @ !0! (! $@  @ !8 ! @ ! (!@(!@0! $ `@! @ ! `(!@(!0! $ (!@0! $A@!$ ! (!@ ! $ @ ! (!P0! 8!@,ݬ (!@ @ !B @ @! ' !\XTPLHD@'`<'u !'hd`\XTPLH x'(!!` !(!! $  !  !h @! 8P !@0!$締 `(! @N@! @ !`(!P0! 8! @@@!ޠ4 ! @!B*@7`(!X4 &s @.@!B h@u*$  ! @! @0! !(!8!'98  h@@!$ '94 @ ! @@! ! ! u* '(   !   !@! hd`\XTPLH'p<'r!'쯶诵䯴௳ܯدԯЯ!!<G4Bpx'  !(! $$b!$<4Rp @ !( $?@b  !04B 0dh @! !(!4@0! 8!@@! dh @! ! @!0!(!( !$į  dh @! ! @! !0!0(!$D  @ !(!P0! 8!@\@!ݬ, (!@!B @Qhd $h @!d0!(4@8! $D픏  $ @! !@0!8 $ @! $ @! !@0!8 $@0!&d(!'9 d @!$bb@< @@!d `'  @!  !  !@U@!$b,b@G$b'@C  ! $\@!`8p8 $X@8 $l@ (!8 $x@ $ h 8 $@8 $@%'9h  !@@!0!@(! !$'9 @<4Bu   !80$H"@-8 $x@$(! '98 $@(!$'9 '9 $(!'9 @0!@! s@p@!x(! $$!ȏ'9  '@@!$b$$'94 (!$ȏ@iď82D $X@  !  $\J@!8D $l@A8D $@98D $@>'9h  !@3@!x'`(!V $ 'p(!x$  ''(!x$  ' !(!x$ $  !(!x $ !`(!0!$$U'p! +!' !`(!0!8!! +!<4Bu  !(B@ '`h  !'`P @(!'` !$& (!@!@m ! $ !C$ 'p $ ' $ 'p (!(!@J' @ 0!@ !4 $Kԏ @!@ !`(!, 0!' ` !h @! !@0!(8! $ @! !h @! !@(!88$Ʒ'9 $緌@\@!'p !&$ (!@!@N ! $$C^ !  '`.'` .(! '`@* ` !h @! !@0!(8! $ @! !h @! !@(!88$Ʒ'9 $緔@@! !!B  ` !P <4Pp@8D $x@ohDU '@@ @! @!0!@8!( ! $ @ !(! @!$` ! @! @! !h @!@ ! @!0!(د !$=H (!@$@!  !@  !h @! ! @!0!(د !(! $=X@!M` !8D$ '@@GhDt @ @! @!0!@8!( ! $ (!@ ! @! @! !h @! ! @!@ !,(! 0!$ ` !@! %Ds'9 D @!@$@! ` !h @! !د(!@0! 8!@!@ 9 <4Pp @ !'@P0! 8!@!$b !D'94 $!  !쏶菵䏴܏؏ԏ'<'a!'hd`\XTPLH x!!!'((! $$ b!*b@$$b b$<$=$M  !h @!  !@0!8 $ @@!<4Up  !h @! 8P !@0!$締 '( @@! @ !'(P0! 8! @q@!4@mC`fb @b$b *b@$`W*b(Qhd  @! @ !, $W  @! @ ! (!  !0!88$%$̏hd  @! @ !8 $؏  @! @ ! (!  !0!88$$紀'98  @R '(   !! hd`\XTPLH'p<']D!'\XTPLHD@x' !!!@ !(!$!p ! @ !@(!4`0! 8!@   ! @ !@(!8! `0!@  T  !M @ !8!'  `0!@; @ !' P0! 8!@-,)ݬ (!@!B @ t@ $h @! !`0!(@8! $$ @! ' !\XTPLHD@'`<'Z!'lhd`\XTPLHxx!!' (!$ !$@!!!b!*b@$$b$ b$$<$=$M$$x`0!'9* '@@T@!@ @M(!8@'9 $lD@!$@픏88 (!8 @ ! @!0!&D&崀&l'98 @ܯ@ @ !' 4&F 8!@  @!@ !8 $؏8 !$'  &F@  @!@ ! (! !' &F &紀@$b  @!h @! !@0!8$  @!h @! !@0!8$  !&l'  &F@Z$Џ8b  @!@ !8$  @!@ !8$  !&F&' ' @- @ !' P0! 8!@,ݬ (! @!h @! !@0!8 $$@ xh @! !@0!8 $@@!<04Qp @ ! (!@ !&崀'9 @0!@@!h @ !@ @! !@0!88!$'9. @@!<4Qp ' @  @ !  ! !lhd`\XTPLH'p<'S!'TPLHD@<840 $!b @ !8 $0 @  @ ! $ @@!$b'9  '菼 @ $b'94 (!  ! $,@!$ b $b'94 $ `$880$4$p $N(@(!$x'((! $ $P!ޠ !* i@!ݬ @(! Dh @ !Ҩ $_ @ !8@$` @'&RT*@H!ݬ @(!  @! h @!  !@0!<P$ܯ '( @  @ !'(P0! 8! @4t@'BD @v+@`!@!&R '(T* @$!'((! d<x'(@ !(! $ PW!  $  @!  !h @! @0! !8 $l  @! ` !h @!  @! @ ! (! 0!<د !$ @(! @@! @ !@(!P0! 8! @! @ !  ` ! !``!<4Pp  @ !8 $0 @@! @ ! $ @@!@8Sd $D @$b$b8`(!$8 ! '9p$bs`(!8$8 !'9 i@!b !'9  ' @ @!$b !'94 (! 8d $ @0!`(! $8d $ @ 0!`(!$'910 #@!8d $ @0!`(!$8d $l @'Hx(! $$ !! !''9* $ @@! @,$X'9 `(! @!$$d8,  @! @ ! (! 0!&8&X$'98  @- @ !, $W  @! dh @!  ! @(! $8&$ 0!&X'9.  @J  !h @!  !@0!8 $ @@!<24Rp @ !, $W  !@0!8'9 $ @@!h  ! 􏙝 @!  !@0!88!$'9.  @<4Rp'H @!    ! 78d $菼 @ !'$'9* @!$ !! e @^8$Ƹ'9 `(! T@!$Q  @H  !h @!  !@0!8 $ @@!<04Qph @ ! '94 @ ! @"@!8$Ƹ'9p `(! @@!h @ !  @!  !@0!88!$'9.  @!@ !  !   ! 8d $x @$b !`(! '9$b$bx'h(!$  ! dh @ @!  @! 0!@8!( ! $ @ !(! @! $ ! @!  @!  !h @! @ ! @! ( !0!$=H (! @<@!  ! @  !h @!  ! @! ( !0!$=X (! @@! @ !(!P0! 8! @ @!t@BB b  ! `!   !8d $ @t$b$be$x'(!$  ! dh @ @!  @! 0!@8!( ! $ (!@ ! @!  @!  !h @!  ! @! ,@ ! 0!$ (! @@! @ !(!P0! 8! @ @!@BB b  ! `!  !b !`(!'9 n8d $4 @$b$bB$x'$ ! (! d't !  ! @ !(!(<P$?$Gܯ    $ @!  !@0!8 $  @! @ !( $ď  0!@(! $  @! $ @!  !@0!8 $ '$ (!'9 d @0! Ch @ @!  @! @8! 0!0 ! $   @ !0 $D  $ @!  @ ! (!@0! $! @(!$A@0! @! @!$ ! @(! @@! @ !   ! . @ !(!P0! 8! @ @!`b t@ 'd @& <<B4Qp  !  ;  !h @!  @!  @ !  !<د0!$G (! @@! @ !(!P0! 8! @ @!@BB b '  ! $   ?bB(!x'$  !  Я !  !@!h< ! P !@0!(! &G@!$ ( , @ !(!P0! 8! @@!ݬ (!C `c tD '   !   &G@ !(P(!$?   $ @!  !@0!8 $  @! @ !( $ď  0!@(! $  @! $ @!  !@0!8 $ '  (!@0!'9 d @! Ch @ @!  @! @8! 0!0 ! $  ( @ !0 $D ($ @!  @ ! (!@0! $! @(!$A@0! @! @!$ ! @(! @@! @ !   ! . @ !(!P0! 8! @ @!`b t@'d @ C+@,$B,dd,   !  !  !   ( b<C%b$b $b !'94 $ Bm ! !  `! TPLHD@<840'X<'7l!'Hx!' (! $'@ !x(! $@!! 308$l 't !@@(!`!  @ ! @(!@! <8 $t@<C%1  !h @! !h @! !0!8@8! $@@! @ !( (!@<4Sp  !  !h @! !h @!h @!h @!@0! 8!8` !$  @!@ ! $ @ ! (!@<  @ !( (!@ih  !@(!$@X  ! 0 @!8 !$'  0!@@! 0 @!8 !0!$ ' @@! @ !' P0! 8!@u@!, 0 @@<1X (!@_@!D ' 5 !8X$@$  !  !  !h @! !h @! !0!8@8! $@@!<*4Sp(4Sp @ !' $0! 8!@@! @ !'  0!@ @! @ !' P0! 8!@@! '  @ !' 40! 8!@@! 0 @!8 !$'  0!@@! 0 @!8 !$'  0!@@!  !0 @!8 !$,'  0!@@!  !0 @!8 !$<'  0!@@!  @!h @! !@0!8 $l( !$<'  0!@i@!  !0 @!8 !0!$笜 ' @R@! @ !' P0! 8!@D@!,` `!0 @<1 Xp (!@,@!*D '  $ ! BD0 @ @! !(! @0!B<C%B    ! '   !`!'<',\!'x|xtplhx'h$!(!  ! ! $ @! !@0!8 $ @! $ @! !@0!8 $@!@(!<e4Qp&D'9 d @0!D$bX<V4Qpb  !@(!p @! ! @!.h ' Dh @!8! !8$$ƺ  !(!x $H (!(  !$B 8$B$ $B ,@! H @0!880$$p $N  ! ` !  !|xtplh'<')@!'د $ 0!$b ! !  !p@(! $, H@@!$ @0!880$$p $N! '(<'(d!'|xtplhd`\X$@<4BpHLP! V0O  !p @(!@D(`$ 6Lhb7 @ !'@ ' @'9 ' @ L <4Bp @@ !$ '!@ PL <|4Bp<C%1L8 @0!&$88!$R8& @! @@!L @0!$&$& 8!'9. @8@!8 ` !P @!0!&$,88''l@! $eH`@!@'  &7,@ !T8 $X` ! @!P @! ! @!@ !(!x$ @! @ !@(!40! 8!@w  ! @!8 !$GH@(! 0!@`  ! @!8 !$gl@(! 0!@I  ! @!, !$\$@(! 0!@2 @ !@(!P0! 8!@$, ݬ (!@@!B @ $h @! !0!(@8! $TT @ !  !  !  !  !PD (! $@FD'D $ D@0!0 $ @ !h @! ! @!@0!8!8 !$d'9. D @!  !@(!ݬd HD @!L P  ` !  !H|xtplhd`\X'<' !'`\XTPLH x'(!!! !(! $  <4Bp@<4Bp<4Sp P@ ! 0!(! 8! @@! ! @ !(!P0! 8! @@!X4 (! @@!B @8$ $p @$t (!8$ $| @ $t@(! & r,$ $\$ @M(0$<  ! @ !]@8 $ @9$8 ! $ @1$8 ! $ @)$, ! $, @!$8 ! $ @$8 ! $X @$, ! $F @ $8 ! $ @$B8$ $l @ $h @!  ! @(! @FB&ޠ4 * @a '( `!`\XTPLH'h<'!'ȯ40,($ x'(< !(!! $' !x(! $!p! !| @ !@@!<e4Bp@0! !$Yk0 '@2@!@ `(!@8! '@!@#! @ !0!8 $@@! @ !h @! !@0!(!$ @! @ !  !@ !(!P0! 8!4@! @0@!B p@, | @ !h@X@! @ !`0!$Yk0 '@@@! `(!@8! '@!! ޠ B*@(!ݬ@&R  ! 4 @ ! @!4 @ ! @!4 @ !@!@<<y4Qpl @?@! @ !B !@ (!(! 0!@/@!` @!'$@V !    !' $ ! d  !  ! @(! !   !' $ ! d  ! @(!  !d  ! !  @! !@(!”0! $@! @ ! (! $ƶT $@! ! !@! 0888$cN$H$l$<  $|@!@ !! 0888$cN$Ȁ$l$Ȭ @8!!($ '0<'@!  $<' !'د ! !h@, ! @ !$(\@! $ !$쏅< !\@$ď E``!  !쏃 @ !$b\E$b\E  <4Bp '(<'!'د$ ! !h@1 @ !@ !$8\@! $ď@ ! EX8 ! $̏@ ! EK8 ! $ԏ쏃 @$bE= !E: !  !@ !$4\@! $菼@@ !8)$ď4 ! $@@ !8$̏8 ! $䏼@@ !8$ԏ8 ! $p@@ !8$܏($? $ '(<'!'Я($ ! !h@& ` !@!@!$,b, ! $ @!@&  !@" !$,b$ h ` !@ ! @ !@!$ b, ! $,@!@&h @ !` ! @(!($ '0<'ɠ!'د ! !h@ ! @ !, $E ! (+<4Bp '(<'!'௿(! !@!<4Pu!' <'Ȥ! (!<'Ȅ!'<840,( !! ! 0!@ !8 &%~|  @! &%~|@ ! @0!  @! ` !@0!0 $ @! ! ! @!8  @ !$$ƻ 8! @!   !   ! <4Bp<840,('@<'!'840,($  !$Pp!! !!!@! @ !8 $菼@! !80!$$  @< @ !8 $͔@! !80!$  $@@!<-4Sp+4Sp(! @ !@$ P @ !@ ! @! !8!8x0!$ @! ! 8!8x0! $  @ !`# !8&%(0! $@@!8@ ! $͔@ 8 ! $菼@ x !&%(0! 8!@!  !`!840,($ '@<'!'د ! !8$ $(@!@ !8@$͔ 쏃 @$bpE $bpE  ! @!!<4Pp! '(<'$!'x|xtplhd`!!!@@!<v4Bp@n @ !p @(!@aB0B@[8D $\@( $?8D $@8  !$(`0! $@!!@!<@ ! $ď@ DE 8 ! $Ϙ@ DE J@!8 ! $͔@ !8 $ 8 ! $菼@5<8 !$`0! $@,@!8@ ! $͔@ DE 8 ! $<@ DE(8 ! $8@< DE04Pp  !@ !8D $Џ@%8 $D $@3@!,@ ! $@D$8 ! $T@<D(!4Pp8D $d@$8D $(@8 U$\8D $<@ G 8D $T@ G:8D $ʀ@F8D $l@8 M$t8D $Џ@('x` !(!  $A ! 0!8$ $А@6@!h @ !` !P @(!D `(! !8D $ʰ@  '9 @ !8D $ʘ@/8 $Ш $@@!8@ ! $ď@ DE8 ! $̏D쏃 @$bE E  !8D $̏@X8 $ $@J@!8@ ! $؏@ 8 ! $܏@8D*$䏅4 ! $C@8 ! $@8 ! $@ 8 ! $@8D$8D$@ @! ! !<4Pp|!8D $4@ 8D $|@D$ >8D $˨@!8D $˼@8D $@8D $4@ 8D $D@dD(!8D $䏼@ 8 $`'9, @ !%@!8D $@8 $  $D@@!8$|<$f  !@! T !|xtplhd`'<'!'௿  x'(!(!@ ! $ 'H(!x$ 'h  !(!x $$ ௠b菙x$H' (! 픏8 @ !8 $d 0!@ !  h @! P !@0!@(! 'Ǟ8 @Q@! @ !@(!P0! 8! @C@!ݬ4 (! @2@!hD< @ !&řȏ\ $ @b Dh @! @(!  !  ! 菼  菙h @! <P !@0!$癘 (! @@! @ !(!P0! 8! @@!ݬt (! @@!hD @ !$<\ $Џ @ h$B BhD @ !$8\ $-P @ Dh @!  ! @(! @ !䏅(\ $Y쏼  'H  䏙h @! $ ̯ !@0!'H $ @@! ! @ !'HP0! 8! @@!vݬT `(! @e@!'( $  Dh @! P !@0!'( 'Ǟ8 @R@! @ !'(P0! 8! @D@!ݬ4 (! @3@!hD @ !&řȏ\ $ @Z Dh @! @(!  !  ! 菼  菙h @! <P !@0!$癘 (! @@! @ !(!P0! 8! @@!ݬt (! @@!hD @ !$<\ $Џ @ 菼 &sޠT b* @X@ ! '  ! & @@!$b$b&@<4BpR@ @ !p @(! @B0B@8D $D @{(! '9L $ s8D $D @  $'9L $ 8D $\ @( $?8D $ @ D $P $ ! @ ! @ !<$ďD  @ @ !8$Ϙ @!D @  @ !8'$͔D @  @ !8$<$D @ < @ !8$8]4Up @ ! @!  ! 8!8x`0!$  @! 8! !8x`0! $  !`0!8$ $( @@!<64Up8@ ! $͔ @ !8 &%菼 @ @ ! &%菼 @@!<4Up  ! !@8x !$(`0! 8! @!!8D $Џ @,ѤD  'Џ @<Џ@  @ !8 $T @ !,$4Bp  ! 0!8x@8! $D8D $ @ tD 'ԏ @@ !$8D $T @ G 8D $< @ GЏ8D $ʀ @8 L$<8D $l @7 D $P @  @ !8$ď D @  @ !8$ @ !8$ь  !8xT$t8D $ʰ @8 $͔8@ !$B8'9 8D $ʘ @; D $P @  @ !8$ď D @  @ !8$ @ !8$ь  !8x$Ш`0! @8!8D $4 @ 8D $| @ѤD '؏ @@ !$b<4Due!8D $˔ @0  $H8D $䏼 @ 8 $`'9 @ ! D@!8D $ @tD '܏ @@!@<4Cu.`!8D $ @&8 $  $ D@!< $f䏼 @ !8D $| @<!<4Bu ! @!  Q B@` @!<4Qp !'9Ȭ & @! '(  'H  'h  䏙 菼 @ @ !  ! ' <'D!'Я,($  ! &@:@ !c$b6&b!@@!<.4Bp0&  !p @(!@80B@$,  !(@ $e '9, @!@ 1 !@ !,($ !'0<'!'840,($b!,b@$$b$b,  $œ@!  ! @0!@ !8&R $ј` !@(!P @!@!@ ! *B@ !8 $bѠEcѠB $@!!$8`0!' $ј !' &@*`b@^@!0.  !p @(!@!0B@8 $@  !@!$ b$b<4Ru@< C%1 ;8 $bѠEcѠB& $ $@!$8`'  0!$ј  !@ !(! &1@*#`b@@!<4Bp   !p @(! ` ! $œ840,('@<'T!'@<840,($b!,b@$$b$b,  $쏼@!  ! @0!@ !8&R $ј` !@(!P @!@!@ ! *B @ !8 $bѠEBcѠ $ $T쏼@!!$8`0!' $ј !' &@* `b@Z@!0&  !p @(!@80B@$  !0@ $He '9 @!@ 1 ` !a(!8 $bѠEBcѠ&$ $ $U쏼@!!$8`'  0!$ј  !@ !(! &1@*# `b@@!<84Bp0&  !p @(!@80B@$  !0@ $He '9, @! 1 ` !(! ` !$ @<840,('H<'0!'ȯ40,(88$$Q(  !@ !$ , $t@@!8$Ѩ8 @ ! @(!$ƺ $@ @!8$Џ8 0!$p0 $NY8 @ ! ' $ƹ $@ @!888$$p$8 @ ! ' $ƹ $@ @!888$$p$8 @ ! ' $Ƹ $@ @!888$$p$( @! !880$$p $N!40,('8<'!'د ! !h@+ ! @ !$(\@! $Џ !$ \( 8!@$ Eȼ !! 쏃 @ !$bȨE $bȨE  !'(<'!'د ! !@h  ! ! @(!$:bh  !@ !, $-@@! !'(<'!'د ! !@Wh  !@ !$4\@! $@,\ !$ $@8\ !$4 $ @ 8\ !$@ $@ Eȼ% !0\ !$rL $@8\ !$L $ @ 8\ !$X $ @ EȬ !  !Eȴ  !'(<'L!'Я($ ! ! !Ѥ !@ '( ! $ !@$ !(!`!  !(@$< !$ ($ !'0<'p!'د ! ! !h !@ !  !h !@ !, !$ $`!  !`!  !@(!  !'(<'!'hx' !$@ !! (!'@(!x$@  !h  ! !@8!8$@ $d $@ !0!@(! $@'@! @ !@(!P0! 8!@@!,  !p @(!@ b '  !'<'!'Xx!!' (!! $'@@ !x(! $@$!b !h  !@ !@8!8 $l4`@ !8$K$t($K$@ $@ @ !' 4@0! 8!@z@! @ !' P0! 8!@l@!ݬ, (!@!B @c@! $h @!@0! !(@8! $'  @!`<$ @ !h @! ! @!0!' ( !$į  @ !h @! @!@ ! $ !0!8د$D˯(bD & @ ! @!@ !h @! ! @!0! !(' $Я  @ !h @! @! !0!8د$<@! @ !h @! @!0! !(' $ܯ  & @ ! @!@ !h @! ! @!0!' ( !$̯  @ !h @! ! @!0! !<' $q  & @ ! @!@ !h @! ! @!( !0!$ ' @(@! !@ !' P0! 8!@ @!, B @_ޠ, "* (!ݬ@&1<C%@ @ !  !  ! ' !'<'x!'ȯ40,($ !!! ! $@! ! !@0!8 $ @! !@(!'9 0!8@! 40-  !p @(!@"$($@(!b0!'9 @!$0!$@(!$ ($b'9 @!1 @ !`!40,($ '8<'!'D@<8x'(!$! @ !  !h @! !@(!$@0! 8!@ @! @ !@(!P0! 8!@! @ !!D@<8'H<'!'Я($ !- $ $ @! !@0!8 $Ո ( @ !@b@!'9, @Z@!P$$0 $ $ @! !@0!8 $հ ( @ !@'9,  $  $@ !'9D '@ '9,  ! ! !($ '0<'4!'D@<840,($ !!@!T  !p @(! @0B@h @ !8 $x @3'(x !(! $ $'Hx(! !  !! `! $ @! @ !h !  !@0!8 $  $$B "! @ !&Rh &1( @(!  ! @b*C `$b_$b $ 8̯@ !$ƥ'( $ @@! h @!  !@0!@ '( @@!ݬ0 $ @B D   @ !8 $T  @! @ !, $ $ (!@0! $ 0$ݬ @! @@!E  0! $A  (@ @ !(!P0! 8! @!4@QЎ" @ $h @!  !'H$@0! 8! @@!R`H@ @ !'HP0! 8! @!'( !  'H h @ @!  @!  !0!(@8! $ {  @! @ !'(4& 8! @@!  ! @!  !(د$=L'( &䏼 @@!  @!  !(د$'( &䏼 @@! @ ! 4$ @$-@$  @! @ !8&$l '( @}@!(@  @ !'(P0! 8! @m@! '( ޠ8 B*@(!ݬ@{&RY$  $ 8̯@ !$ƥ'( $ @D@! h @!  !@0!@ '( @0@!(@ @ !'(P0! 8! @!  @ !  @!  @ ! 4@!@Q   !p @(! @" @ 'H $h @! @0! !(P(!$=L   $h @! 8P !@0!$T (! @@! @ !(!P0! 8! @@!ݬT $ @@!B @h$  @ ! T(!ݬ @! @@!B @  ! h@   ! $h @!  !$  !  ! h@  ! $h @!  !840!$h @8! $  !44@0! $Kԏ   ! RB h@  !  ! @! @   ! @($P 0$PHh !  !  ! @! @   ! @($P 0$PHh !  0!44$p 8! '( `!  'H      !   ! 4&$4$-@44$-@ h @ !8 $d @,b@!$b0BL@! $&b B! @ !&h &R( @(!  ! @* $bh'h ' @ ! ' ` !(!x$"$ @!  !(!x $ @ !(!x $`  0!@ !8` $,  $ $4@ ! $-@  @! 8@ !$ƥ`(! $ @T @ !`(!@ @0! @Fh@  @ !`(!P0! 8! t@%PЎ @ h @!  ! @! 8 !0!$l (! @R @ !'P0! 8!  ` !  '   ! 3`3! !&b!"&* @&$(  $ h @ !  !@8!4$  $Kԏ$ b0!h  @ ! "$`<!C%bh @ !8 $ @8쎄E$Xh @ !8 $ @ $b78쎄.$؏h @ !8 $ @ $b ,쎄$ $h @ !8 $X @$b <쎄$d @!<C%B$!D@<840,($ 'H<'r@!'hx' !(!$!@ ! !'@(!x$@  ! !h ! !@8!8$@ $  0!̯@ !@(! $@a@!$b$$<b$$=b$M  0!@ !8 $ @! !h @! !@0!@ ' @!  !- @ !' P0! 8!@@! @ݬ, (!@@ !B @<h  ! @(!<4Pp ' !'<'o!'|xtplhd`!!'90!`8! !@Y@! ` !@R' x@ !(! $ @ ` !h @! @!8 !@(!0! $l ` !h @! !@(!$@0! 8!@@! @ @ !' P0! 8!@!' `! @!h ! '@` !@0!84! $ (!$x  ! ` !h @! !(!4@0! 8!@ ` !h @! @!8 !0!$l (!@!$ $ @ !8$, $ @ !8 $0 @ !8$4 @! ` !h @!@0!(!8 !$紀  @!` !h @! @!@ !8 $, !0!$\$ (! @@<@@<4B @ !(!P0! 8!'@@! !|xtplhd`'<'j|!'XTPLH p!'90!  8!@!<4Bp d!b!  ! @[!x'((!$ @ !   !h @!  !8P@0!$l @(! @5@!(@1 @ !@(!P0! 8! @ @!,@ݬ4 (! @@!B @hd d @(! p ,% '( !XTPLH`!'`<'ht!'x|xtplhd`! !@ !' | '@ @!| @ ! !(!x$ @! !(!x $ @<4Pp8 !$t $  0!̯@ !(! $@ @!880$8$l $NW  $ @! !@0!8 $ @! !h @! !(!@ @0!@!  !- @ !(!P0! 8!@@! @ݬ, (!@@ !B @<h @ ! @(!<4Pp ' !@` ` !@ @ !880$ր$l$N 0!G!98 $@$8 $@$8 $@ $$(!0!@8!'94(!0!@8!'9!T   ` ! @ !!|xtplhd`'<'c!'د$  !D $ @! !@0!8 $Ո @!@ !( (!@!  ! !C$@ !b(!$b$'9#\ @! !$ '(<'b!'h|xtp x!(!'( $ ' !x(! $ '(!x$ ! '(!x$L !$ hl!!b!$b$b  $ h @ !  !@8!4$  $Kԏ $b$b$ n$0h @ !8 $, h@  & @ !, $ $ @ !8 $< h@ & @ !, $ $ @20& @ !8 $h @h @ !8 $X @&R8 $菼 @ tX 'X$X 1Y$ U$0h @ !8 $, @<$dh @ !8 $< @8$ $b%$B#h @ !8 $X @h @ !8 $h @, $ $ 1$b'Hx$@ ! (! , $ h @ ! @0! !8` $Џ  @ ! &E $  @! ,@ !$x'(  0! @@! @ ! &E $  @! ,@ ! 0!$y '( @k@!(@  @ !'(P0! 8! 4 (0 @ 4"ݬ0B@(! @! B@@ !  1  ! $`@!$ 1 -0h @ !8 $, h !@`! @ !8 $< @, $ $ 1$bv$ @$0h @ !8 $, h@ @ !< $d @h @ !8 $< h@ @ !8 $ȏ @'1 0h @ !8 $, h !@`! @ !8 $< @, $ $ 1br ! 00 @,1 'H $ @! h @ ! @0! !8 $  l @ !8 $  h @ !, $yX $@@ !x(! @!  $ h @ ! @ !@0!8` $Џ  ,@ !$i'( @0! @ @! h @! , !$x\'( @0! @@! l @! ( !$'( @0! @@!$$us픏< @ ! &d  @! ,@ !$x'( @0! @@!픏8 @ ! &%ȏ  @! @0!@ !,'($y   @ ! &d  @! @0!@ !,'($xد   @ ! &%ȏ  @! ,@ !@0!$x '( @a@!(@ @ !'(P0! 8! @!4 C0 @ݬ (! @! <64Sp4"&ݬ0B@(! @! B@@ !  h @8!'؏4$  $Kԏ 1$b$b$b$`$b$b '( '$8' $ƧЏ  P@ !''( 8! @@! ! @ !'(P0! 8! @@!ݬ4 (! @@!,D $x @'x(!$  ! $h &  !@8!4$ $Kԏ $,$ $x @'x(!$  ! $h &  !@8!4$ $Kԏ $v,$ $x @ t$\ '\$ \b,$ $y @ t$` '`$ȏ `Oď4$ $T̏ @h$ @(!  $ @9$5Џ($ $ď @-h$ @ !@!8ܤ $ @@!4@8!$&K ' h  ! &K@8!' $   ! $&ޠ4 * @?h' !' 8! 'h$8! @!"!  088$BN$$ְ  0! <4Sp$b$b$b쏙(!  0! @a'x$` ! (! 4 $ h @ ! @8!&Kԏ ! $  $ h @ ! @8!&Kԏ' $  $ h @ ! &K@8!'8 $ D  (! @0!.D @8! (! @@!8$XL @@!8$B@@(!  ! @ @!8$쏅80 0!$ְ $N <4Sp$  $$b"$쏙(! 0!   ! @ @0!880$$ְ $N <4Sp$ $b0 ,08 $菼 (!@0!D 'd \dF '؏ dd@(!E D<$  1 '( h l  !  !  !  !  !`! |xtp'<'J<!'`\XTPLH x'(!!(!@ !!$ ! $ ( $P0!@ !@(! `8! @.@! @(!@ !P0! 8! @!ݬ@ (!4 @!@`(!<4QpD h@   !@(!X 0!  '( ! `\XTPLH'h<'H!'X cCI< X (!D ?@!h @ !8 $ď @2<h @ !'(($$RA@! $ď @z@!Ҩ'( $. @@!$P8'@'($8 0!@! $ @g@!Ҩ ! $. @$B@'X<X4Cp8$@8! !$2    @ ! @@! (! @ ! @:@!  @ !  @!  @ ! @!$$R@!  !@!  ! 8 @ !`8!BE   @!`!'<'E!'lhd`\XTPLH $! $$ $  @ !$8\0 $4 @$  $ @(!0 ' 8B+$^x'( (! $! ' @ !$0\! $` @$g픏(b  @!$ @!$ $ &%@d ! @0!  @!  !h @!  !(P@0!$L '( @(@! @ !'(P0! 8! @@!ݬ4 (! @@!B @< 4Pp(d $M8 @r`   !  '( (!$bF$x'H(!$0  'x(!x$0 ! '(!x $0  $ @0!(`$@d ' ('  $   ! @ 8x'H$0` ! (!  (!' ! @8!` !8$0 $Ʊ @ !(!x $  4 @ !`0!8 $  @! @ !(  (! @DЏ0  !h @! P !@0!@(! &D @-@ @ !@(!P0! 8! ݬ (! @@!B @ &D @ ( $0 @$  !  @ ! 'x` !  (! @! !(\$@$`x(! $0  ` !$0x@(! ` !P  (!  !(!x $0 @x@ '  ! @!   (!\0! ' @$44$b0 @)@!  (! @!  !@0!4 $Kԏ "@ @0!&x  (! @@!  ! 8&*@  F!'$!$$b<< $ $ @!  !@0!8 $Ո  @! @ !( (! @! ތ $Ȁ  @(!@! <C%P ! ! $b$b.$! D@!8 $̏ @ ($ $ @$ !ޠ "* (!ݬ@&1$BT$<$b ! C(@!$ b(!ޠ "* (!ݬ@&1$B$b$<b(! !0!'9( 8! @ @!@(!0! !'9X 8! @!``(!$$b$$b,b@$$bSbT$ bO B$cˀ@{x' !(! $  ( $88,@ !$t$  (! @&@! @ !  (!$C4 0! @@!X (!@!B @ <dt '( (`C<4Pp  !B (!$B#B$@<(4Bp!$  $ @ !&hP! &1 @(! ! &R(  !(!x@$( !`(!0! !'9( 8! @(!$@D<4EpX (!  @! $ @!  !@0!8 $  @! @ !( (! @ !@!h0  ! @!@ &  @! 0!&e @8!  !  @! @ ! @! @ ! $P  0!8!&e @ !  $ !  h @ @!  @! @8!0! (!  !  @ !   ! <C%  $ @!  !@0!8 $ $'x(! @!  @ !8 $  @! @ !( @(! @<@! ` !h @! @ ! @! 0!8د !$ ' @@!@ @ !'P0! 8! @!ݬ (! @B @<4Pp@ @ !  '   !@D'9X 8! @!`` ! (!$0$$,@Q$0B@$#(b2$`;<  $ @ !'9D ', @,@v,  $ @!  !@0!8 $ @(!N$b$`Z<%bV`$<%"<4BuM" $G @ !8 $h  , ,( @ ! @(,  $ @!  !@0!8 $ @(!$ 0!'9 ,#" <b%#, Rb'9  !$ @ `  !$ʠ  ! $ˀ` ! $ $ 0 `@(! $b 8!$'9(  ! @(!!lhd`\XTPLH'p<'0`!'ȯ0,(!x(!$ $$0!8 $8880$@$ְ@$N 8 @ !$ , $@!8(80 !$Zď$p3$N@! @ ! (! $Ŝ $@!8880 !$t$p@$N8`!$$B @ !' $L $@!!880$0$p$N !0,('8<'.!'PLHD@<8x'!!` !(!!$ ! @ !`(!4 0! 8!@A@!@= `(!@ !P0! 8!@!ݬ@/(!$ @!B @&h$ $h @! !0!(4@8! $h$  ! @(!@! '@!PLHD@<8'X<',!'D@<8x'(!$! @ !  !h @! !@(!$@0! 8!@@!@ @ !@(!P0! 8!@!$(!ݬ@@ ! B @<4Pp '!D@<8'H<'+x!'<840,( !!! !  !h @! P !P(!@0!@8!  @! !٘``(! !<840,('@<'*!'د$ !! !(! 0!P@8!$ @ ! '(<'*@!'\XTPLH x'(!!` !(!! $   !h @!  !@8!P@0! `(! @'@!(@# @ !`(!P0! 8! @@!,ݬ@(!4 C `D `!, '(! \XTPLH'`<'(!'840,($ !!!P ! !h @! @! (! @ !TP@ !(!0!8!840,($  '@<''!'௿ !(!@ !P0! 8!' <''!'TPLHD@x' !! !(!! $  !h @! @!@ ! @(!0! !`8! (!@@! @  @ !(!P0! 8!@! ' !TPLHD@'X<'&0!'PLHD@ '  $Ӏ@ !(!x$ @!!8ִ $Џ@Z@!h@ ! $p  !@8 @ !8 $䏼 !@(!( @!@# !8\ $䏼h  !$ ̯@0! !@(! $@ @@(!P !0! 8! ȼ  !  !   ! ' `!PLHD@'X<'$!'د$ <!4B\!Y ! h !@0 !`! @ @! @!0!@8!0 ! $ $@ ! @!h @ !@ !@8! (4f$ $ @ !@@ ! @ !h @! !@0!84 $,  !!$ '(<'"\!  $<'"<!'د$ <!4B?!< ! h@4 ! @ @! @!0!@8!0 ! $ $@ ! @!h @ !@ !@8! (4fҌ $  !!$ '(<' !  $<' !'Я($ !<$4Bp!@2!   $ @!@!@ !$hb  !h @!@ !0!84@8! $@ ` ` ! @ !@0!84 $\!($ '0<'!'Я,($ ''9a! !@@!  !@(!0@$H'9dL @@!'9_$ @! !,($ '0<'!'د ! !@- !, $b<@ !4T$菅8 ! $&@ !8H$D< ! $@4 !;$E0h  !2 !  !@0 !4 $菼@ !,!$b<8 ! $D@ !8$&4 ! $E0@ !< $h  ! !@(!  !'(<'!'Я,($ !,\!$d$  !@+!"@'  (! @ !@ ! @!@ !h @!` !@0!,4 $cL  !8\ !$4 $@  !8\$\ $@"@@  @!0!@8!0 ! $ @ !$ @!@ !$ @! !@!8 $@  !8 $@ !h  !` !@0!84 $A8 $t@;  !h @! !@0!8 $D @!@ !( (!@@!  !@ h  !` ! @(!  !@ ! &!,\ !$d $@ @ !  (!@ !`(!'9m @! !` !  (!!,($ '0<'!'د ! ! !,@"$ $  !< 0!@$d E !! 쏃 @ !$b܌E$b܌E  !'(<'!'LHD@<840,(!,\!$d$  !@H!"@D  (! @ !@ !h @!@ @! @!0!@8!0 ! $ $@ ! @!h @ ! !@8! (4fҌ $  !T@ !8\ !$4 $@  !8\$\ $@ "@픏0  (! @ !@ @! @!0! !@8! &E @ !$ @!@! !8'$Pa$ ! @@! @'0! $D@@! @4 $h@h  ! !@8! (4fЌ $( $0@ !8' ! $8@y@!  @rh  @ @! @!0!@8!&E   !@ !$ @! h @!@!'$YBCDEFGHIJK L M N O PQ&R     Y'(\'$ $h( @ ` !&Ќf ` !&Ќf4 !&% @8!  !  !  !    @!8\ !$ $@ @ !  (!@! !@(!'9s,\ !$d $@ @ !  (!@! !@(!'9m  ! !  (!!LHD@<840,('P<'!'<840,($  !!`!q #,@:bh$# !@!&$R`     '"#$%&'()*+ , - . / 01'9"#$v%`t@ $,p @(!@;$0 @)픎2, $h @! !@0!8 $t@!@&G,(!'9`XF$ R@!  !$, ,2,8D(\$D#!d $h@ $ F!d @(!D $h @!F !@(!&s 8!sF<840,($ '@<' `!'Xx!(!'  $!!! $BxB!#0B@b0dB0F0b ' $BԠb! (!f$ՌG8!$Yc& $ՌG8!$Yc'  E@!'@B !% '9a @8@! '@h@0 @(!P  !,\ $[ ' $BԠb!f$Ռ$Pc$!G8! & !8!' (!  @!&s*b@&Rx @'9c ' @! ' !'<' !'P!0B@p$p@!U ($x)#c!t% @"0B@ | @ !% '9l$ x@@! @h  h @!x@(!8!'9n  !xh &Ռ@(!Xd ! $d%0B@B0B@ 䎤h 'h@u@!h0B@Btl 'l@g@!l@ a0B@t ' @W@! | @ ! || @ ! @!| @ !'(x(! $| <`@<4Pp!t ~#$xC!D|p'9]P 0!@j<| @c<h| 'H@0!84 $t(!$x  ! h @!$  !̯@0! (! $@)@!H@% @ ! (!P0! 8!@@!ݬT (!C `hD ` ! @(!`!  !< ` !@<4Cp t$wԠW!F #&Ռ$Vc8!'1x'(`(!! !@!$T$$I"0B@ '( $݄`(!! @!"T$""t0B@ '( $`(!! @!"tT$"t" d0B@ '( $`(!! @!" dT$" d" 0B@ '( $d`(!! @!" ܏T$" ` (@'9c '(@@!h| t #$xd!e '9dL @0!@!'( `!|   ` !! x R%'<'!'Я,($ `S!r@L @ !p @(!@AC(C# $Bx!B0B@2 | @ !Dh @!Dh @!8!@(! 0!'9n  !h  !@(!$d X$Ռ  !  !s,($ '0<'8!'د !$ x(!$Ռ$ !$d &&1x !'(<'!'Я,($  !$$Ex$$cF$a$x 20 (&dxC#D!C$d$C @n, $d@f, $d@^(&rxb#r!e @ (b#r!b4Bb8 $쏼@8 $@8 $4@ 8 $\@ (&dxC#D!C|4cC|4 $T̏@(C#R!DElF\C4444cCԬDElF\1{,($ !'0<'0!'h|xtp$!b (!  $X!@(!$b$ | @ ! @!| @ ! @!| @ ! @!| @ !` !(!0!'9j @!@ ! !@38$|d D@!, $dh !@`!  !, $dh@   ! @(!&1ޠd "*ݬ@ (!8 ! $ED@   !@<4Pp !| @ !@!b0B@$h  !@ !(!0!'9]P 8!@@!d  $d(!ݬ @! ! @! !h  ! @(!{ !8 $ED@<  !@5픏, | @ ! !h @!@(!&$d0!'9n 8!  !@h  ! !&%d'9dL @0!@!  !6  !@/픏, | @ ! !h @!8!@(!0!'9n &$dh  ! !&%d'9dL @0! ! @! ! @!@%'9 $'9 ` !'9 ` !` !'9 (!@@!'9~p  !@!  !  !A !bj$ | @ !` !@(!$'9j @!@  !@  !880$۬$ $N<r4Bp,$Rl$@! $bL@b, !@! $b@b, !@! $bp@b, !@! $b@b, !@! $b̏@b, !@! $b菼@b'9_$  !@-@!+bb$ | @ !` !@(!$'9j @!@  !@8$쏙'9 !' (!x $tv'H@Q( #'xC !0b@!0B@ $BԠb!f<@8! 9@8!( ` !p @(!#'x@d!de  @ $BԠb!C,@h @(!@0!'h #h $Bx! $`X' (! @!<4Bp@ &,@(! @0!!@! x$Bx@D !(! $ @'@$Sa(' &{`! @0!@ @!P@&{@0!`!  !@! '  ! Q !bT | @ !` !@(!$'9j @!@  !@ 8$80$ $N<+4B'9 $'9 ` !'9 ` !` !'9  (!@@!'9~p  !@! ! !@(!|xtp!'<' !'HD@<8 8' Bp'($ ,4Bx!( B 0@ !$ , $(@ @!,80$j$ $N8 @ ! @(!$Ҭ $@ @!888$L$d$8 @ !  (!$ш $@ @!888$L$L$8 @ !  (!$ $@ @!888$L$4$ 8 @ ! `(!$X $@ @!88<$L$$D  &$@ @! &$@!!  !@0!88$܈$܏0 $N!HD@<8'P<' !'௿ <$4Bp @!880$$p@$N !' <'!'د  <$ 4Bp#! @!880$0$p@$N$ݬb(! C @ !<4Eu4Bub !   ! '(<'!'<84088' $B询 ,$,$B{@( !@ !$ , $d@@!8Q$$8 @ !  (!$$ $@@!8=$d8 @ ! @(!$ $@@!8)$ޠ8 @ ! '($ $@@!8$̏  $∏@ @!  $ @! !8$80$p $N!<840'@<'!'Я($ ! !h@ ` !@ !$(\@! $M8@ E - ! !*(!  !@ !@! t$RE $@ tE ! $@(` !$M8Q t ! (! $@` ! (!E ($ !'0<'H!'Я($ ! !@! $%(! @ !&@ . ` !$ %(!`($ !'0<'!'د ! !h@ !  !  ! ! @(! !'(<'!'د ! !h@ !  !  ! ! @(! !'(<'d!'ȯ40,(x'!$ !! (!  !h@  @ ! !@0!84 $`  ! !@(!P  ! !, $:@$:&C&@ ! (!40,(!'8<'4!'LHD@<8x'!! !(!! $ @ ! (!40! 8!@?@!@;  (!@ !P0! 8!@!ݬ@-(!$ @!B @%h`$ $h @!` !0!(4@8! $h $  ! @(! '@!LHD@<8'P<'t!'\XTPLH x'(!!` !(!! $   !h @!  !@0!P@8! `(! @)@!(@% @ !`(!P0! 8! @@!,ݬ@(!4 @! B h@ d  ! @(!  '(! \XTPLH'`<'!'TPLHD@x' !! !(!! $  !h @! @!@ ! @(!0! !`8! (!@@! @  @ !(!P0! 8!@! ' !TPLHD@'X<'!'د$ !('90!$L !@!@ ! h@ ! @ !@0!('9 $M@!!$ '(<'!'د$ !('90!$N| !@!@ ! h@ ! @ !@0!('9 $Nl@!!$ '(<' !'ȯ40,($ ! !| @ ! @!| @ ! $ @! @! !h @! !@0!( $@d@ !@!(`0!$T\! $M@@! ` !@1` ! !'9< `(!@@! ` !@` !'9 @(!@@! @ !@h( @0! $c!'9 @ !q@!(@0!! $Nl@i@! @ !@ ` !'9 @(!@Z@! @ !@S | @ !@ !@0!0!@! $D@'( ! $@ !'9< `(!@(@! ` !@!` !'9 @(!@@! @ !@h( @0! $c!'9 @ !@!  !  ! ` ! @ !!40,($ '8<'!'ȯ0,($ ! !| @ ! @!| @ ! $ @! @! !h @! !@0!( $@d@ !@!(`0!$Q\ ! $M@!@"` ! @0!` !(@$Nl ! @!@@ ! @ @ ! ($Bb!e ! @!  ! ` ! @ !!0,($ '8<'ٴ!'د$ ! $ !@ !$8\ $4@!#$b7$2@uP8 $.L !@(!8 $< !@(!8 $L !@ (!8 $` !@ (!'9 <C%RbI$b2@=P8 $.L@8 $<@8 $L@ 8 $`@ !'9 (! 8 $x@  (!<C%R  ! $L !,B@ !  ! $L@!!$ '(<'!'Я($ 8 !@ !$ , $8@!8880 !$h$h$N@! @ ! (! $h $@!!880$$h$N !($ '0<'!'`\XTPLH x'(!!@ !(!!$x !  0!@ !P 8! @(! @;@!(@7` @ !@(!@ `0! @(@! @ !@(!P0! 8! @@!,ݬ@(!4 @! B h@ d  !@(!  0!  '(! `\XTPLH'h<'$!'TPLHD@x' !! !(!!$ ! $ 0!̯@ !$  (!@7@! @3 @ ! (!@ @0! @% @ ! (!P0! 8!@!,(!ݬ@@ ! @ !B h@   !@(!  `0! ' !TPLHD@'X<'t!' <!4B!^![ ! 'X'p' x !(!@O$  !(!x$@ ' !(!x $4 !(!8 0!$b LHIJ Kc <EN4BV'9$@X $(,0 4p !x(!@$@  !0!8$@$l'9 @@!h@ @ !  !@0!848! $h`! '<'Ќ!'௿ x' $!!@ ! (!'@` !x(! $@' !x(! $@' !x(! $@<EN4BV @@ !@(!`0! $@&@!8 !$$@ 8! @ !@(!@  0!@@! @ !@(!P0! 8!@@!@ !ݬ, (!@@ !B @| @ ! @ !@(!4`0! 8!@@! @!  @!@ ! (!`0! !0@(!$D   @!h @! ! @(! !`0!8@(!$l  @ !@(!P0! 8!@j@!,`hd @  ' <^4Bpch @(!P  ! @ !  @!h @! ! @(!8 !0!$l @(!@ @! @ @ !@(!P0! 8!,(!X @!@B @<4Pp'  ! ' <'P!' d ` \ X T P L H D @ $ hb !$bN> hB@> 8t $| @(쎄!$H8 $⸏ @<(&d $, &d@!( $+菼 &d@!( $,  @!,쎄 $ $'(쎄yx$` !(!$  $ `(! '  @k @g'x$d ! (! `(! !ͨ' '( ` !(!x $ $ ' `(! ! `(! !ͨ '  !(ͨ $,4 $ !x (! $`   !   ! @0! !| (!  ! (! ` !(!x $ ` !$$ 8! '(! $ @<$d쎄,$ $    !    ! a   !Z< $H @W(!x'  ! $ ' $@x@ ! (!  !! 8ͨ$bBc$\ d `  !8ͨ &eL x@ !(! $@ !,8B `$z$l'9@0!$@   !ͨ@@(! @  !ͨ&eL &*@쎄'  <C% 9 į Џ h $\ @ ! hB@쯢 $ $8rD $∏ @nD @ ',@ !'9D $G0x !(! $ ' ` !x(! $@ ' h !x(! $4  !(!8`0!$bdLHIJ Kcd<EN4BV$@ h l p t x'9 | @(!x'  ! $  @ !(!$`0! 8! @V @R @ !(!P0! 8! Cݬ (!;8D $̏ @B$x'((!$  $ '( '  @R @NhD &C .YHIJK L M N O GFQ (CXSTUVW 8Y_ )C *Y +C ,Y -CDExB 0  ( 8$ )' (! *'( + , - . 0 ' ؏ $`   !  '( @0! !| '(  ! ' $0!”$ '   ! (!$F\  ! x@$d' ! (!  !ͨ '( '((!x $ $'  !'(   !ͨ '(  !(ͨ $,4 $' x (! $`   !   ! (!@0!|  !  ! ' (8$, $| @g@!8Θ' $ @ !  !  '  !(!x $  (8P@ !$$ (! @ @ @ !(!P0! 8!   ! !(! $ !8D $⤏ @! $B(b!eD & @ !(@$'9D .@B<C%B $c` $ ! d ` \ X T P L H D @!' h<'!'د !<U4Bp$bE,b@$b$b<I4Bp,B@B8 @<@! $ @0!0 $ @- @ !$8 $~|@ &$@0!x (!@!<C%   ! $D!<4Bp! '(<',!'ȯ40,(8!x$Q$(!$  $8 @ !$ , $X@!8880 !$戏$$N 4@! @(!@ ! $$ @! 0!8880 !$Џ$$N@! @ !' $$ @! 0!880$$$N! !40,('8<'p!'Я($ ! ! !8 0!Ѥ@ $4!  !@(! !'  !8@$D8 !$4 ($ !'0<'!'TPLHD@x' !! !$!(! ! $ 0!̯@ ! (! $@2@! @. @ ! (!P0! 8!ޠ@ @!, R*`bݬ@&E, @@ !B h@   ! @(! ' !TPLHD@'X<'!'HD@<8x'$!! ! (! @ ! (!40! 8!@1@!@-  (!@ !P0! 8!@!ݬ@(!$ @!B @h`$ $h @!` !0!(4@8! $ '@!HD@<8'P<'!'D@<8x'(!$! @ !  !h @! !@(!$@0! 8!@@! @(!@ !P0! 8!@!ݬ@ (!$ @B @<4Pp '!D@<8'H<'X!'TPLHD@x' !! !(!! $  !h @! @!@ ! @(!0! !`8! (!@@! @  @ !(!P0! 8!@! ' !TPLHD@'X<'!'ȯ40,($ ! !|8 @ !&`@(!`0!''9, @!@@!  !@D @  !@+D @$$BSs<&`'9  (!@m@!  !@fhD  !@0!4'9x $Y  !@D @ SC<'9D  !=@!  !@6D @/S)<'9D  !@ @!&`'9  (!@@!  !@hD  !@0!4'9x $Y@@!<4BuB   !!40,($ '8<'!'hd`\XTP ! ! | @ ! 0!'H8@(!$`'9,H @! @!@q@ ! @j'( | @ ! (!$x` ! @!  @ !h @! @0! !4P$Y `(! @)(@% @ !`(!P0! 8! @,ݬ@(!4 @! B h@ d  ! @(!  '( h  !  @(!   !  @ !! hd`\XTP'p<'\!'(Я̯ȯį!$I!q 08 $@` !(!,$8 $@` !(!!$8 $@` !(!$8 $(@` !(! $8 $4@ ` !(!$'9 <C%1$RvG8D $@` !@(! $8D $@ ` !@(!$'9 "8D $@` !@(!$8D $(@` !@(!$8D $4@` !@(!$8D $@@' x(! $'@ !x(! $'X(!x$  !Dh @ @! @!@8! 0!L ! $d@ !$ @!$ !X @(! ! $ !@(!X $X@ !$-$/bEd$cb@X'p$ ! (! !,ͨ $菼'8'$H !' '$C2$ b.<̏4c#$/,`$W !'@@CH!@"H#%)0%0C!@BP#%J0$c0  !(!X $Џ8  @!@ ! (!&&8! !'    @!@ ! (!8 !&&$( ' @ @ @ !' P0! 8!  ! ' B<C%B ` ! $@!Џ̏ȏď`!'<'p!'Я($ 8 !@ !$ , $@!8880 !$l$$N @! @ ! (! $$ @!!8880$$$$N !($ '0<'P!  $,<'0!  $<'!  $t<'!'@<84088' $R@8$ $S8(, !(! @ !$  $@@!88$$p`@0!8 @ !  (!$\ $@@!88$Џ8 @ !  (!$ $@@!8 @ ! '($ $@@!8$$Џ  $,@@!  $ď@@!8$X8`0!$p  $t@! !8$X88$p$0 $N!@<840'H<'!'XTPLH x'(!!! !(! $ <@J4Bp`<F4Bp  !  $0!P@ !@8!  (! @(@!(@ @ ! (!P0! 8! @@!ݬ4 (!@!B @ hd ` ! @(!  '( !XTPLH'`<'!'Я,($ ݬ ! (!@!h@!D @ !$(\ $T@s`! | @ !Dh @!@ !0!<'90 $@!h@ ! @ !$<\ $̏@ !A ! Dh @ @! @!0!@8!0 ! $ $@ ! @!h @ !D @(!@ &@(! @0! ! `!,($ '0<'!'d`\XTPLH x!!!'((! $ `!ݬ  (! @@! $h @! $8P !@0!$8 '( @@!(@ @ !'(P0! 8! @@!ݬ4 (! @@!hD @ !$(\ $T @u | @ ! Dh @! @ !0!<'90 $ @@!h  ! @ !$<\ $̏ @C !  ! Dh @ @!  @! 0!@8!0 ! $ $@ ! @! h @ ! D @(! @ &@(! @0!  !  '( &ޠ  * @7`!d`\XTPLH'h<'!'h|xtp $!b!.b@$$b'(b!x$ ! (! $8 !  @!  !h @!  !@0!8 $  h hh @! P !@0!(! 'Ǟ8 @1@!(@- @ !(!P0! 8! @@!ݬ4 (! @@! h @! @(!  ! @ !h @! @ !$(\ $` @.  !   !h @! P !@0!'Ǟ8 (! @@!(@ @ !(!P8!$Џh  ! @ !$(\ $T @v | @ !  !h @! @ !0!<'90 $ @@!h  ! @ !$<\ $̏ @C !  ! h @ @!  @! 0!@8!0 ! $ $@ ! @! h @ !  @(! @ &(! @0!  ! Fh  ! @ !$8\ $쏼 @7  !  !(\ $Y쏼   !h @!  !@0!(! $ @@!(@ @ !(!P8!$L @!  ! h  '( @!! ! | @ ! @!ݬ (! D@!8 $Џ @$ (!8$ $ @ ($$H 0,$ $\$ @8$$5t($ $N @8$$8$ $% @8$$8$ $, @"<C%"픏8 $ @!  !@0!8 $ $&ED @! @h  ! @ !&ED'90 0! @i@!h  ! $]@(!8$ & @Xh  ! @ !&'90 0! @I@!2 @ ! @A !h ! $sS!E  ! @$ &* @$ *S!C,b @$8쏄 $cPC!B\!@$BE@ !$BE @ !$BE @ !$B@ !E "<C%"  ! 'ޠ * @  ! !!ݬ8 (! D&D @! @s&D 'H $ @! @0! !8 $  @! | @ ! Dh @! @(!  ! h  ! @!` !x(! $ +< 14Cp 0!د@ !8! `(! @@!H@ @ !`(!P0! 8! @ @! ` ! <4Cp ` ! !B`!<C%B&ޠ * @w !|xtp`!'<'!'lhd`\XTPLH$pb: !pU!3' x$(!  ! | @ !@!pD  $ @! !h @!@0! !8 $@ !h @@ !8'%8$Y0 `0!@@!h ` !@ !$8\ $쏼@  !` !(\ $Y쏼 ` !h @! !̯@0!(! $@@! @ @ !(!P0! 8!@@!! !| @ !@!pD  $h @ !@ !@0!84 $h  @_@! | @ !$h @!@ !8'%8'90 0!@! ! !;@(!@! @6 | @ !$@!8\ $T$h @ !( B'90b!e 0!h  ! @(! ! &ޠ  *ݬ@(!@ ! ! ` !@  ' <C%!@ !lhd`\XTPLH!'p<'T!'ȯ0,(8 !@! !8 ,$B$$  $@!(!  !$`$ @! ! ' $L`$ 0,('8<'!'XTPLH x'(!!@ !(!! $  0!@ !P 8! @(! @#@! @ !@(!P0! 8! 4(!ݬ @! @@!B h@ d ` ! @(!  '(! XTPLH'`<'$!'XTPLHD@x' !!$` !! (! ! !h @! !@0!4 $Kԏ@@! @ !0!8! `(!@ @! @ !`(!P0! 8!@! ' @!XTPLHD@'`<'!'诿  x$'! (! '((!x$  ! ! !  @ !  @!  @ !  @!  @ ! `@!@<=4Rp @  ! @/ !h $ @ @!  @! @8!0!0 ! $E  @!  !h @! 8P !@0!' $g8 @@!  !h @! @0!8P !' $G @@! @ !'P0! 8! @@!ޠ ! B*@ݬ (! @@!8D $e @h @ !`0!0&9P $D @@!4` ! $h @` !( $< @ ` !( $@ @8 ! $T  @ !( (! @m@!h  ! @ !&9P8`0! $t @_@! ` ! @X$  ! ` !h @!  !0!84@8! $턏  @ !( (! @7@!h  ! @ @!  @! 0!@8!0 ! $  !$ @!  !$ @! 0!84@8! $   ! ! $ @0!84 $D8 $E8 @Lh  @ @!  @!  !0!0@8! $e @ !(! @! @ !( $ @  ! $ (4@8! $e ! $ 'f(4$e@8!   ! &*h @ @!  @! 0!@8!0 ! $  !@!8 $T  @ !( (! @@! ! $ @ !8 $t @ ! $ @ !$8\ $x @  ! $  !@0!84i$ $  !@0!(`' $@d  !(!x$ !  $(P@ !0!$L  (! @(@! @ ! (!P0! 8! @@!ݬ (! @<4PphD @ !( $M8 @$  ! E@  ! $  !@0!84 $ $  !@0!84$D  @ !( (! @ h  ! @ !`0!('9P $4Bp @ !8P$ƚ4 (! &G󸏼 @&@!  (!@ !P0! 8! @!ݬ@(!4 D&E󸏙 @! @ 8$ $ @$b '( !XTPLH'`<'_4!'tplhd`x' !! !(! $<`l4Bpb@<f4Bp^ (@ !$T (! $@M@!x'@ !(! $  !$ 8 $ȏ @ ! (!@ 0!@/@! @ ! (!P0! 8!@!@!, 0  !p @(!@  @`(! @$1 ' @!tplhd`'x<']!'Hx' !$@ !! (!'@ !x(! $` !(!x $`0! !8` $܏ @ !(̯$`$ @(!@2@! @ !@(!@  0!@&@! @  @ !@(!P0! 8!@!ݬ, (!@@ !B h@  ` !P @(! ' !'<'[!'쯲诱䯰௼x' !! !(!! $'@` !x(! $`' !x(! $@` !(!x $`` ! 0!8` $܏ !@8!8$@ $Ʀp 0!@ !̯$ (!@2@! @ !(!@ `0!@$@! (!@ !P0! 8!@!ݬ@(!, @@!B h@ d  !P @(! ' !쏲菱䏰'<'X!'xtplh x'(!$  !! (! 'H@ !x(! $  !$ 8\ $x @ !($ $Dx8$ $ƞ8   0!P@ !@(! '( @:@! @ !@(!P0! 8! @,@!ݬT (! @%@!  !p @(! @ @ '( @ h ` !` @(!  @ ! ! xtplh'<'V!'د$  x' !!@ !(!! $'@ !x(! $@'(!x $@'(!x $@ !$@88! $Ʀp @ !0!@(! $@@! @ !@(!P0! 8!@{@!,w`p ` !p @(!@cb @_'x(!$@  !dh  !8$@$ 8!'' ! @(!@!@A@ !  ! @!0!@ !\(! @hd  !P @(!(\@ !$` $ !$@x@(!  !P @(!@ !(!x $@ '  !$  '(<'S@!'Px' $!! ! (!'@` !x(! $0'p !x(! $  8@ !$-P(! $@I@! @ !(!P0! 8!@;@!,@7P0  !p @(!@% h@! ` !@8!8$0 $` !(!T 0!@ @!p@ !` `(!R '  !'<'Q!'Px' $!! ! (!'@` !x(! $0'p !x(! $  8@ !$Ʀx(! $@I@! @ !(!P0! 8!@;@!,@7P0  !p @(!@% h@! ` !@8!8$0 $` !(!` 0!@ @!p@ !` `(!R '  !'<'N!'TPLHD@x' $!! ! (! @ !0! (! $@@@! @ ! (!P0! 8!@2@!,@.P'  !p @(!@ h@ @ @! @! ! (!0! @8!R ' `!TPLHD@'X<'M!'\XTPLH x'($!! ! (!  ! P@ ! (!@0!`8! @! @` !P (!0! 8! @ @ ! @0!088$BN$$p `8!CX4 (! @ @!D @  @ (@!h @!8$Q8ؐ  ! 8$B8088$BN$@$p@0! `8!  '(! \XTPLH'`<'J!'hx$!!' (! !'@` !x(! $'@@ !x(! $@ 880$d$ $N<4Bp$` ! $#$+0!5,$Y $0 ,$Y $Ȅ$ &P(! &P(! @ ! @!(! @ ! @!@ !`0!8د$<'   @!@ !`0!,د$:pSV$ E4 @ ! @!`0!@ !,' $X  @!E< @ ! @!`0!@ !,' $X  "!ED @ ! @!4@ !`0!$T ' "!# @ ! &E2 @!(@ !`0!$ ' @! 8$ @ !' P0! 8!@ @!8$ 80 0!$$Nݬ, (!B @8@!$L880$$$N  '  !TPLHD@'X<'>!' ܯدԯЯ̯ȯįx!!$(!!'  !'@@ !x(! $'@` !x(! $@ !$88! $Ʒ  @@ 880$$ $N<4Bp $" 0!`! &@!A$Q, ! $)@ @! @ ! @(!@! (!  !@@(! ` !@ h  !` !\ @(!  !`!` @ < 4Bp@' '@<840,($ '@<'U!'ȯ0,($ h!! !@0 @! @!@8! !0! &E `(!0!P@ ! @! @!@0!&E   !@ !h @! ! @(!  !  !`!0,($ '8<'Tx!'95 <'TX!'ȯ0,($ !!@!! (!b!D &s@&R Q!B*@!0,($ '8<'S!'840,($ !!!@  @!d0P$ h !@ !Ĉ `(!@e@!B@aC$.@0b-  @!d0!@8! &E @  @!$&E $0! @8!@(! '  @!$&E 0! @8!P(! 0!@ @ !x '@ !840,($ '@<'Q(!'쯾请䯶௵ܯدԯЯ̯ȯ !!<y4Dph @ !Ҩ $. @$Q @!B@<D  (! @&$!<U4Dp$ bQ !$ bN$xb'H'( !(! $ (!0! 8! @<84Bp  !!$} b' $ 픏0 @0! &e  @!  !h @!  !,c@@0!(!$   @! @T@B@  @! @8!0! &e @ !P0! @!   !&e  @0!  @! (!0! @ !  ! @!   ! @ @ !(!P8! $/ @!  !  '( @!(! $ hl!@!$bu'px` !(! $ (!0! $ @K!' $  @0!0 $  @!  !p @(! @<@4Bb$  !h @!  !`(!4@0! @8!  ! @!   @ !'pP8! $0h t@ 'p !$@ @ !p @(! @D0B@$b<%B E0! $@ ! @B<C%B$$$$ $ ' $  @0!0 $ @! $,b@i8$c, C!B\!@'H$C$CF( 0'F0!''9.P  ` !h @! ďh @! د !0!@8! 'H. ` !h @! ďh @! P !(!0! @8! ` !h @!  !(!$@0! 8! @!  ` !  @(!٘ 'H #b@@,  @! 0!@8! &%菼 (!@ !ݬ @! h @ ! @ !8 $,@ @$ (! 0!  @0!0 $ @ !$ݬ @! $@ !ݬ ď @ !h @ ! @! (!4$G 0!  @ !ޠ @! $&%菙0!@ !  $@ !'95  ( @ !  ` !h @! ďh @! 0!د@8!'H !  ` ! @!   @ ! H@ @ !'HP'h $1 @!$b\Z'x` !(! $ 0!(! $ @/@! @0!@ !0 $  @!  !h @!  !`(!$@0! 8!  ! @!  @ !   @ !`(!P0! 8! ݬ (!  ` !  'H !`!@ !쏾菷䏶܏؏ԏЏ̏!'<'B!'H @!! ! 픏0 @!  !0!@8! ' @4Wp<4Wp@ @ ! R#' (! &P`(! $ @!  !(B@ @h  ! @(!P '((${ b'),@ ! $[ @@! @,@ ! $} @!@x'h(!$ ` !  ! h @! P@0!@8! ! `(! @% !P`(!0! 8! @Xt (! @@!D @  @ @! ` ! l< 3 &$  !h @! @ @!  @! 0! !@8! ' @L@!@(! @ !  ! @(!   ! h  !  ! @(!   ! D !'<'>P!'D@<840,( !!! !  !@0!0! $  !@! ! `Y B!B@-  @ !  @!  @ !  9@!@7 $B!Y  ! B!Y  !  $  @! @! 8 X V0#00!@ ! `8!  ` !   !   ! <4BpD@<840,('H<';!'840,($ @!$ ! @ !'@$( @! @@0!0 $ @!<@4Pp8` @ ! @!` ! @!(!`@0!8!  !@! ` ! @ !@ !840,($ '@<':H!'p|xtplh !L@!LhuT @ @! @! !0!0@8! $ @@!<4^p'@@S,$.`3@ ! @!@@ ! B!${b  !@!2#hbh ! @ !@(!\ `0!@\#$.b&1 !ʮ@$h P@!@H!! @ !(!0  $ @8@!h @ ! !@0!84@8! $@'%P @ !@0!4 $}@@!B@! b!e  !@&B*@  !P`D0^`I! @0! !0 $E @D@!@ ! 'D@I@!̏D !@!*@@@(!񨏤D &R@ @! @! !0!0@8! $e @ !(!P@0!'9M @!S*(!'9I 8!@(!< 4PpP@ !0!'9M @! ! ! !D ~' xb(!$8B ,VH0B!T!X\b` @G픏0  !@0! & @@! @ ! 'H@&@!̏H !@!*@@(!񨏤H &R@ @! @! !0!&  @8!@!@ !T@0!'9O !@!S*'9I (!@@!T@ !'9O 0!@!! !@G(!픏0  !@0! & @@!@ ! 'H@@!̏H !@!*@@(!񨏤H &R@ @! @! !0!&  @8!@!@ !T@f0!'9O !@!S*'9I 8!@R@!@~픏0  !@0! &E @@` `h @! !̯@0!'  $@c@!@  @!0!@8! &E @XPX (! $ X&E  @0!@\<74Pp \h @! !@0!@ ' @#@! @ !' P0! 8!@@!ݬ, (!@B @ T !'9O 0!@!! '   !  !H \ X ` !@!r  !LBBL!|xtplh'<'.!<@<@@ < @<@<4Ep@ B@D (!B(!bd!<'.!'HD@x'  !(! $ $0,$@ !$H (! 8!@@! @ !  (!$Q 0!@!  !!HD@'P<'-!'840,($ @!!!!  @!` !0!0@8!@$ $.@0b,  @!0!` !@8! &E @  @!&$&E 0! @8!@(! '  @! !@8!&E 0! P(! 0!@ ! @ !x '@!840,($ `!'@<'*!'`\XTPLHx' !!! !(!$ !0! !@(!$'9^ @@ !$@ !@[!`! '@$ @! @@0!0 $  @!@ !h @!` !h @!0!@8! ! (!@@! @  @ !(!P0! 8!@! '  ` ! @ !@ ! !`\XTPLH'h<'(!'hd`\XTP x'(!!! !(!$H !  !@(!`0!'9^ 8! !@ !$@kH 'H$ @!  H@0!0 $  @! @ !h @! ` !h @! 0!@8!P ! (! @(@  @ !(!P0! 8! @4Cb @d @! '(  ` !  @ ! H !hd`\XTP'p<'&T!'Я($ ! !$ @ !0! (! $@  @ ! (!P0! 8!($ '0<'%!'Я,($ !$  !@!<@ 14Pp @0!` ! (!@#@! D @0!0 $ <4pp@@ " 4@0!&Dx  (!@!` ! $!  !!,($ '0<'$P!'840 Ә @!@! !88$B8$B '$<$BD('  , !@)@!  !4@"@!  !@@!  !@@! '( !@ @!  !@@! @!840`!'@<'"!'௿T (@ ' ' !<'"|!'௿8 !(! @ !$5 ' <'"(!'د$ 8 !(!@ ! $5 $@!880$,$p@$N !$ '(<'!!'Я($ 8 !@ !$ , $8ď@!8880 !$-$p$N@! @ ! (! $5 $@!880$.$p@$N !($ '0<' !'`\XTPLH x'(@ !$! (! ! ! 48P$9$@ !@(! @! @@!P !@(!0! 8! @y@!ݬ4 (! @7@!B @4<0 @ ! @! h  ! 8P@0!$8 ! @(! @P@!P !@(!0! 8! @G@!ݬ4 (! @@!B @<94Pph @ !$(\ $ @ @ @!h @ !  !@0!84$/  ! @@!h @ !  !@0!84$/ @!<4P '(   !  ` !! `\XTPLH'h<'|!'௿8 !(! @ !$:8 ' <'(!'ȯ0,(8 !@! !8 ,$B.$  !$B$($, @! ! @(!$<`$ @! ! '($$:@$N840,( '@840,('@<' !'tp!( $'p '@,@ ! <'!'8,'0$6$$2$ 8!0' $ $ƥ8!'@!<'!'د !P@!"@(!   !!C($/ͨ$b ! ͨ (! ! ! '(! <'(!'௿x !$U (!!' !!!<'! $!!!!!!<'!,@78$c>0C!B\!@0$BH8$B>p8$B>8$B>8$B>8$B>؏8$B>쏂8$B?8$B?@8$B?X8$B?l8$B?8$B?̏8$B?8$B@48$B@P!!<'p! ! $!!$d!$<'!x(! $ $$$$<'!'௿x(!& ! $t!' !$$$$$$$$$$!!!!!<4B<4B!!$L$O<'!4$B`<'p!<$B!!!$!$P! $<4B<4B<'߸!'د 00!!8$C$@\0$罜! $@!$8$@`$罈@$PQ @@!$8$@h$罌@0! @!@ `!'($<'ެ!'ȯ0,($ !b!$Bb`*!(!D 0!(! 0!0@ $&RF$*B@`$C$C%  $Bb! 0!(!  !  !@!(B@! !Y  (!@0! (!$B0B$'b$ $D c !0$cc,($ '8<'ܔ!'௿ܯ$(, '$' !$<'@!'د !@!$ `(b!@$i $@(C!`E$$@(!`$(b!@ i $$@(C!`G%X#0!  !0!$ '(<'0!'ȯ40,( !!'9 '$C !"<b$B0B,B @< '+!@&"$B$c` " '!B4C <4C 40,(`!'8<'4!'plh !!'9 '$C<0$B$c`$- !b'$-$!BCP(!  !!<4B plh'x!<'P!'௿$(,(!'$ $!' ! !!!!!!!!!!0@!@(!$$b!(!$$b!'<'!'ȯ0,($ ,!!!@!<t4B 0@7$( ! $#b-<"P#$E+@ &<@b b<`@!"``!0$<;4B $< ! #$$C$ $<0B <@ ! $"@@B #LP4c"$# b" qHQ!0,($ '8 `fc@ @!b@cb<'X!'D@<840,($ !L0B!X\@<4B $$$V+@!<4B  & "P+@P0B@"B@h<$+@*!B0B@ @Z (! ''9  0!S<@! ''9 0!"@ ! @(!'9 @0!<@"@!"EC!$B "$ @ !''9 0!$B@' %'9 0!"6 !$ V##$BB<B6CL$ b2&$Y &%'<4B M  '$GL&& 4 " $  &$$&cb$u>!$T &s&b$P$~ &s(! ! 0!&bP$u!0B@& &$"0$B $@@ ! 0B@ ! $ D@<840,($ 'H<' !'د 8h'<  '(<'!'D@<840,($ !!!!X\`@! @BC<b$<W4T  !(! &F 0!$(! '@H@!P<@b<<@<4T <@bbbb &" +@! &d &   0!&" BB B b@@!bR@@!<@bPB@! !D@<840,($ 'H'C$F%!<'8!'د$  !QB&0<B10B@@P@ ! $B 0Q  0"1 $ !'(<'@!'Я($ !! !!#  BFB$  f@!($ '0<'X!'د$ h' !@ @0!$ !0!b`(! <4F$ !'(<'! $<'˼!'840,($ !!@x!@ @Q0 ` "!@b"Q" !'@0! '9  1"CQ<@#b<b <@<1"DC@'  (!'9  0!@0 @  $@ 840,($ !'@<'p!'௿P D!8 $@p!' <'!'XTPLH L!'(! ! @X '9` '( @V@!$H$L@ !`(! '( @"(C d@!# ``!b D`!c@!B@!2L ! @(! B@%9$@ $'@(! !0! & @&   !$8$@ XTPLH'`<'!'840 8, $@ 8 $@ԏ Q ('(" 8("'$A$" 0!"$B   0  & 8 $AD 4 $ 1840'@<'!'௿8 $Ad8 $A8 $A8 $B8' 8 $B<'@!'d`\XTP!8\!!$G ! $@` !(! $8\ !$G $@  !` !(!$ '9 8\$B $@ ! 8\$F $@!L` !(! ' @ '9` ' @@!L` !(! ' @i!!8\' $* $@' 6(M61(\$ $@' 6(B61 8\$B $@' 868\$B $@' 6-618\$B $@' 6"618\$B $@' 68\$B $@' 6 618\$B $@68J$BL` !(! ' @@ !(! 0! 'H=@ !(!0! 'HH0B@8$E*($EB0B@8$FBЏ8$FB0B@8$GB؏8$GB0B@8$BC 8$BC8 $C 8$@ $d`\XTP`!'h<'!'د  !D8 @HH$CL@$ $Ɛ080!$CP0$ &'@@! !'!$$c`@8!!C!cC!@!P `!'(<'!'௿8 '9` $CT@ !L@(! ' ' <'!'௿8 '9` $CT$@@ ! ' ' !!!<'0!'Я,($ !@(!8D8!$C\J @0!  (!8$C .B(@ $d  ,($ !'0<'`!'X d!!!!'(' $d 0B'( ! (!`0! @8! !'!!!!!!!!!<'p!'௿$bbXD 0!' <'!'௿DD 0!' <'!'௿4 F$C$ F!' <'`!'௿ !' <'$!'௿B@8$B@  B!' !!!!!!!!!!<'@!'LHD@<8x'(!!(!! !$  !' 08 $H菼``(!$@ !0!  8!@u@!|B@Z bQd@!$rQd$cQdC!P&R  !(!@0!\ '  @B@&1 $cQdC!B@8+$Ȉb @!$r $c C!P&R  !(!@0!\ ' @B@&1$c C!B@8$I '  (!@`!('  $܏@`!8'  $I`!LHD@<8'P<'!'TPLHD@h@! ' $O0 !(!x $'(!x $ ' ` !!!, $O$*9'8 !@(! $@C$ 80b@(b @$ $b 0!%Db$b0!D1(& $x%00!@ $N#ࣰ8  !8@!E0#$%(!8$B0B,B_@*@ @(!$$& 4$@,' $䌏@`(! '@'( $܏@ '8 $I !@z8 $Jr$$$TPLHD@`!'X<'!'د (8'$(!@!  !(! '8 (!` $JTb ! $ `!'(<'!'௿0@! $`!' <'!'plhd`8įX$C$$  'X@E$X $ @>@!'$ !!$ "X!C$<b&!B$B0B,B @!C$>b&XP!Q$ "$$ $'V+@ '`(!&*@$ ' X plhd`$'x<'!'௿| B<A$P,$ $$O !' <'!'xٌ(!D' 8!@$ix`!'<',!'xٌ(!D' 8!@$jx`!'$+<'!'`$!!Y!(@$ !;$L! !@ !x$'ٌ(! 8!@8 (!$P`jb$@h$@ 8 (!$P $x ! C4D  !P @(!  !i$ B!($bHBcH"#L'x(!' 8!@7$` !jb$@+h$@$ ' @!!&Ѐ+ͨ !' &<$E4$B,$E菙ͨ  !'x$B$H   !&\c\"!C D  !&\c\"!CD$B!!`!'<'T!'840,($ $!!Pm!(@$ !=$a!x' !(! $' !X`(! $$P(! $@ (!8 $Q8\$Q< $@ 8$Q@ $PD  (! ` !$x' !(! $E$X' !$ (!P $@h$P` !  (! ` ![@!$`"!($bHBcHbcx'(! $) @$` ! @ ! @!!&+ͨ@(! ` ! &<$E4$",$E菙ͨ ` !P' $'$8\@(!@$Q<$"! ` !b!(+HE#$\c\CD!840,($ `!'@<'!'Я($ !!!!$$ d $ (! !,ͨ&1@ $   !!." @@!($ '0<'!'诿 (ٌ'!!'0!' !(@ ! '(@*@B4$BT̯8$BQd8$BQl8$B88$B8gN!0$BH808`$D$Jx$J|'0 (( '0(&$'0 @!(0!'0x $-('0! &$ԏ(x'0$ ! (!$$(b@ !bF$c8` $~|(8!!0$SH '0!($Q,` ! $"(  !"!($P,` ! $"(x'0@ !(! $\܏((!ٌ@0! 8!(0B@@@($B<$Bď0$BH8$J(!0! `8!('08$J &H(&H8 $J( ʘ (@8$BK4@(! $Kԗ (B0B@ 0c$ b, $؏( B0B@, $d( 0B@8 $K0( 0B@8 $K@( B0B@8 $KT( 0B@8 $K\( 0B@0c$b&H8$EKh8 $Kx(00 $N( $P! '0(@0!&%H8 $K"! '0(@0!&%H8 $K (0B@T ! '؏(@! '0(@0!&%H8 $K܏(8&%H $L(0B@%` !@$b &&HD8$FL 8$FL4($G<$Gď80$LH $H(B0B@ 80$Lp $H(0B@@'4$F 80$L $H(0B@.08&%H $L(' !(! '䏼(@ !p '0(@(!, $󨏼( !(!A&%H4$Ev`( $ԏ(0B@(08&%H $L䏼(' !l(! '䏼(@ (!, $󨏼( !l(!A&%H4$Ev`( $ԏ(0B@L08&eH $M(''䏙d !@(!' '菼(@,ȏ``%!ʏ8`0!@8!b+$M,@ ! ,`0! $"(!<` !$,@' (,'0 $󨏼(ίA&eH($E<( $ԏ(0B@@($F<$Fď80$M8 $H( '<'$!'(Я̯ȯį4x!! !@$P@(! 'xL''' 8!@9!`hB0B@.@$h0B@&$" h8B0B@Q' 'x@@' 'AP' ''Џ̏ȏď'<'!'௵ܯدԯЯ̯ȯx'$!!! !(!$0 !''''$@ !`(!0!  8!@L+@ ! 0!'9 $U: &1&y  (!'ٌ'  8!pB0B@@ $&1  (!  !'9$ $@!@ !$&y@ 0! '9 $$Cȯ܏؏ԏЏ̏$'<'!'诿 x'!!! !(!$ ( !'$x !(!$< 쏼'询'쏙$''௰ԯ@ !`(!0!  8!@^(!ٌ'  8!@T8$Qt@p0B!@ E8$Q =@'p '菙 0@ 8 $R@菥 @ $bἏ (!@菥  $'<'!'h|xx'H$!!! !(!$$p !'p'($P't`(!0! 8!h@ !\( ' 0!@%$tp  "p0!'  $@@!<4B4bp <$BH8@(! $R0|x$'<'!'h|xx'H$!!! !(!$$p !'p'($P't(!0!@8!h` !\( 0!' <@$tp  "@@!<4B4bp <$BH8@(! $RX|x$'<'4!'|xtplhd`x'@$!!! !(!$X !'X' $H@0!8!` !(!T @ P@(!X @@!<4B4bX <$BH8@(! $R|xtplhd`$'<'!'|xtplhd`x'@$!!! !(!$X !'X' $H@0!8!` !(!T @!P<@(!X +`<4B4bX <$BH8@(! $R|xtplhd`$'<'!'d`\XTPLHx'($!!!@ !(!$@x !' '@$(!0`0! 8! !< H@(!@ @@!<4B4b@ <$BH8@(! $Rd`\XTPLH$'h<'H!'d`\XTPLHx'($!!!@ !(!$@x !' '@$(!0`0! 8! !< @(!@ @@!<4B4b@ <$BH8@(! $S<d`\XTPLH$'h<'!'tplhX'  !$$<88(,$BB$S$S$ $箸0& $B|0X $N!' C!C0G8%F$S&&1 C!*@8@(! $Stplh$'x<'!'@x'(!$<!  !'x'''''( !(!$$  ''x'P` !(!$H0 <'h !xdX(! $'|L$Tp` !(!'  @8!@$rB8B0B@Џ' '@ `0!8 l$N0$U 8!'L'`T'(!'   8!@$r8B0B@'ȏl(! '@ 'P8 l$N0$U 8!l(!'L'xl'(!'   8!@'r8B0B@'(! '@ 0!( l$8$V 8!(!'L'(!'  8!@K'r0`CB00c쯤`$z$0B@$@$0B@$@$$$$$'b@$c $$(@(!@ 0 l$p$X0! 8!'L'(!'  `8!@,!r8B0B@"'d''@(! 0! '@$p 8l0BD8$M$W,0! 8!''<'!'0ȯįL'(!'  8!@!r0B@ (!rB0B@xz r0B@Ἇ (!r0B@ '(! '@(!r0B@ l'(! '<@(!rB0B@ Џ' '@r0B@% d''' (!0! ' (!<@0!p$0B C 0!z $r0B@ (!W'ȏď'<'!'௿ $SP $ $S@ $|8 &S $S&S؏ @!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@͐ ! @'@ !(!0! '@_$`$T !0! `8!A @!@8 $|G$'  ' @@!@<!<4Bb8$E|ď($E쏄8 $|)@  (!@ @8$}@$Џ  @ $@8$}  !LHD@<840,('P<'>!'(ԯЯ@!B0B@C!d$ 'ȏ@<! '@5!P '` P ',,8DbP\0!4$<b$4Bb$c `@$ C$ @$$C$$ԏ`!'<'=\!'쯲诱䯰௼ x$! '(!$lԯ !'(''į'ȏ '̯'Я'ԯ菂8x'pBp'(!' $  ` ! ''9H@ !$ @@! !  (! @7@! ! !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@d@ ! '؏ @$L !  (! @8@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@͐@ '$ C#'$'а  0!$BM 8!@!  d', '܏ @ 8 $}D $ ' @ @8 $}d @$ ' @Z@!@$  !$ C @8 $} | (! @<@!@ $܏ @0@!@ $܏ @$@!@܏ @!@$<܏ @!` @$܏ @!@ !`P!$P#$cC!E<4Bb8$F}؏0$FH8 $x  !쏲菱䏰'<'7T!' ܯدԯЯ ' @@!$@8$F}4$Fh@'h8$G}ȏ8'$~'H 4$8&0P!E $~44$b ,B@,@%, $tx$88&0P!E $~@8$b ,B@0@%ď, $tx$<8$Bb!e $~L0 $ND8 $~X | @(!8 $~@!܏؏ԏ'<'4!'(ԯЯ̯ȯ!'! !|@!@! ,$$D!B"$b@,B@ !$@BB!ԏЏ̏`!'<'3!'HD@<840x'!!! !(!$  !'  !x(! $ ` $` !(!0! @8!@2@'$d '(@8 $}D ('9T| ( ('9T| @@!0 $N($B(<4BHD@<840$'P<'2X!'x|xtplhd`x' $!$(!P! ! !' !x(! $'P,8x'1Bp(!$  0L ! '0'9H@ !@>! !  (!@6@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@d@ ! 'T@.`!$ !0! 8!@!@!d'$ 'X@ P@`!8$}DX @ `!P@`!8$~ `!|xtplhd`'<'/!'HD@<840x' !!! !(!$ !' !x(! $ `$ !(! `0! @8!@!'(d@'$ 8 (!$}D !@ !(`! @!8$~ !HD@<840'P<'.P!'HD@<840x'!!! !(!$  !'  !x(! $` $ !(!`0! @8!@!'(d@'$ 8 (!$}D !@ !(`! @!8$~ !HD@<840'P<'-!'Hx(!$0! ''(!x$l '` !(!x$ '8''X''x'|('4'$@'Lȧ!@ ! '@w@!@t<0@p<x'$ ! (!'(!P '$<( ! &@  !@ !ʈ '@&@&B8$l'8!$N0 $X$+ !& $ ,4 + (+0($9 l 0+ 8++<H $x|$$' 8!,B@ <($lhd$$,0! 8!<4B&R!'<')!'(ԯЯ̯ȯ!! ! '@@!@<8@ ! @ ! <4Q @< 4B<4Q<4BB& !ԏЏ̏'<')!'௿ '9a @8 $$' <'(!'௿8($B%D%%l%' $$$ @&䏂$@$$$GD$F$f&$B $ F#CḽcC# &(!$P $Ƈ!' <''p!'840,($ !!P$@)!!!!  !(! !\@0! @!0!&8@!`8!$֨ !&@&s P!B@@!@@!840,($ '@<'&D!'<8400' $@'$'( !$@ !0'$$LP'( P!$b#(B@!Bb0!$ b @ !0``$X ( !<840'@<'%<!'tplh$!!$w0!>!0$Yd'? "#$%&'()*+ , - . / 01'9     ?'" #$%&'()*+,      0ͨ@ ! $Cb@!!!C@(!$ ͨ&1@ !b & @ !<ͨ $4C#!B@!,ͨ@ ! $H(!|$P $ @!$ '9e @ !$ '9d` '@'@ !(!$P $A$0 $$tplh`!'x<'"l!'p|xtplh $!!!(@$ !$ !X(! $ " !͐@ 'H @ !(!0! 'L @.(!0\$ $ @&&͐  !@!$ Bx'(  !(!0!'9f `8! R$|$#䯢 (!`0!'P 8! @[ !͐  ! @ !(!0! 'L @1LW:"0B@2"NH8B0B@G&0\$ $ @?2"@H8B0B@ &0\$ $ @0"$'(  !(!0!'9f  8!$ C$|$#䯢 0!'T(! 8! @ 0$0$  o$  ! P !   ! \@ !$B!($bHBcH 'X'\'80! '` @($X8B0B@`ͨ !W8B0B@'8 &s <$E4$B,$E菙ͨ  ! үB$H`   !&#\c$\ !C D  !&#\c$\ !CD$B`!!` !|xtplh!'<'T!'Я( @ $'9id  ('0<'!'Я( @ $$'9id  ('0<'!'Я( @ $$'9id  ('0<'\!'|xtplhd`\X x$#'8$! !(!$L@DH ! 'H !x(! $H '(!0x$OP'(P'@h'Dt'H'L \ 'Ꮩx(! $O ` ! (! '@! @y!  !!$ b$=b $ $=&DC&&(\ !$ $ @ !4\$P $ @  !<\$ $ @JL` !  (! @B@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@ ' !(!'9d` @ @`! !'0$P $ @I!$`0! 8! @<@!,'( $ @ '(@@0$H(t$* $ @ '(@@0$h $NJD|0!'P 8! @ !@@!0 $ !|xtplhd`\X'<'!'` !'' '0 8!@%Ĕ '@'@x !(!@$H ' $4$lH'0TP$$0!D  8!կ'<' !'ȯ0,( ' '$(!0! 8!@"! <@&$ 0p'$(!0! 8!@ H@0 $0,($'8<'$!'P ''''  0!8!$ @@(! ' @!B+''  0!@8!`!쯰00,$$D $7`' '' ' 8!@/'0|'$P`0!$  ! ! '9e @!@(!$BR #0$F,$b8$!*@0$FH8$@(!'  `0!'' ί$'<'T!'`\XTPLHx'0!!! !(!$  !x' $@ !8`(!0!  8!!@D@!͐ ! $Q@!0\(!$ $@'%0(! $0 !͐ $Q@!0$P'@ !(!0! 8!@@@0 $l<  !@$0$ $`\XTPLH`!'h<'!$ $Ɛl<'h!$ $l<'H!'د $EP$|! FL\؏0 ڼ 4 H$yH$ $yh&Џ$ $l&Џ4$P$ $Ɛ` !q'(<5!4ϳ%)4&)@(#((!<%/4B @k# 9@8#08k!8!< &5J9((88&H# HB0!1B@ABj¬((¬88 8!(!@C!C!C!@!`$D<b4BM) H!@C!C!C!`$D<b4BMA@D!D!D! $H@E!E!@f!E!<b4BMI<'\!B<<'<!'<840$!!A!(@$ !w*$4!pX(! $@ ! @@ !(!0! 8!@ 0 $R$ @ ! P ! @ !?$@"!($bHBcHBC'('0! 8!@'ͨ @ !<$E4$"&,$E菙ͨ @ !`'($"(! @ !B!(!H$\c\CD!<840'@<' !'<840$!!A!(@$ !w*$4!pX(! $@ ! @@ !(!P0! 8!@ 0 $,R$ @ ! P ! @ !?$@"!($bHBcHBC'('0! 8!@'ͨ @ !<$E4$"&,$E菙ͨ @ !'($"(! @ !B!(!H$\c\CD!<840'@<' !$ l4 $$ $H$G쏂$F菂$E䏂$D$b8$0C@$/ЬCD$CܬJJJ$H܏$G؏$Fԏ$EЏ$D$b8$C@KܬIIIKDHGFHED<' !'HD@<840x' !! !!(!$  !&<(`$@ !`(!0!  8!@!0< $P$$Bb!e $('9 @ !!HD@<840'P<'!' L H D @ < 8 4 0 , (x'X!!! !(!$  !'0 !x(! $('4x'<'@'H'D'L'P'T' ؏ `$'  !`l@(!`0! 8!@!!@0!0,b@90$cC!B\!@$$$$X$$$$X $$` $$$$x$$$࣠!$S$@3$&,b@3$0$c C!B\!@@@P!U!B@'0ͨ $hs @@P!U!B@'0ͨ $t` @@P!U!B@'0ͨ $M@@P!U!B@'0ͨ $:@@P!U!B@'0ͨ $'@@P!U!B@'0ͨ $ @3$@P!U!B@ 3$0ͨ' $ 3$@F@P!U!B@?&,b@<0$c(C!B\!@@/'0ͨ($h @''0ͨ $t@'0ͨ$@'0ͨ$@'0ͨ$@'0ͨ$ &* @@@'  !!@$0$Bb!f$ (!@!'  !!@ގ$0$Bb!f$ (!$$b$4`<C+@ 0$0$Bb!e$DC+@0$0$Bb!e$, 0$0$Bb!e$`"<@ '0p @!<@"P+@ "<@< <b@P!P!P!$B4cMC0@!$@(!0(!$ D@"P+@ "<@D <b@P!P!P!$B4cMC0@!$4@(!0(!$| 4@5+@3<P4DP&44B<@ <b@E!E!E!$B4cMC0@(!$ 40$ 9$0$x  @'' (!' 8!@꼏  ' @ @'0' $(@'`'  ' $'  '0@0 $ ! L H D @ < 8 4 0 , (!' P<'!'`8 0 8@!&$ȏ000$B0$D$B0$ (!$B0$B 0$B( 0$B0$0$B8(L$B<,L$B 08B<0@$bH00$0$c800$@$cH$@0! (,0&$(! @8!8''@'P '8@X$B<@4 'P8T 'x0$CPdBPcx|,` $8P$$Bb!b'x\`d h$l($ ($B<$Bį,t@($B<$Bď00$\(! '@8`''<'!'hd`\XTPx'0!!! !(!$H !'HD$'  !`(!0!@8! 8 !@0! @!@ !$(! !0!'L0$@`! L !@ !H@0 $l`! @$0$ $hd`\XTP`!'p<'!'@x!!!'0(!$  !'` !x(! $0'@'P($$bD' h'cЯTDP@t@ !`(!0!  8!@H@!  ! ! 004 '@$꼏4 '@$@@0 $084' ' @0 $,0 4, !'<'!'|xtp 000$B$00$$BD$,$D$  $ '8X'h'(@0! 'l @!'H8 (!0! 8! <'X(!0! 8! l$0$L$ '( 'h|xtp$'<'!'xtplhd`x'@!!! !(!$X !'XT$'0H@ !`(!0!  8!@6!  !@!$(!0%$dP !'  '\\@ X@0$  !@0 $𰏤  $ $xtplhd``!'<' !'p|xtpx'!(! ! $ $&b<4$l 0!$$@8! ' !x(! $','4'8'<'@'D'H''('L'X 8!@<'(b<4@'( 꼏X '\ 0!@8!0$l$@$8$\\@,48<@DHL h+ `+ X+ P+ H+@+++ȧԧ৩짨 `'X''(x !(! $0$'PX'p'`'D0<H,8'`(! 0! 8!@?ʈ` '\@$\꼏 'd@$d꼏 'h@$h\@ d@h@(!0! 8!`(!0! 8!0!@8!4$l$ $؏'`|xtp'<'!'د '(!0! 8!@  ''(!0! 8!@ $ꀏ `' '(<'!$ $ƕ,<'!$ $,<'!'௿̏܏0 l (D<'9 0((H$ƛ$ $$&$ $,&4$P$8 $ƕ !' <'!'lhd`\Xx'8<!!! !$(!P !P'P@'T'  LD04BD$T@ !`(!0!  8!@!``00$H@$PT $lhd`\X'p<'p!'د$ ! !@1@!  !!$ b$=b $ $=&DC&&(\ !$ $@ !4\$P $@  !<\$ $@@!$@!$ '(<'T!'쯶诵䯴௳ܯدԯЯ0x!Pp$!!'!(!  !$x<'0 !(!$< ' D'pP'x\'h''i(!$O8 he !('h'9` !@> !q  (!@6@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@`@  !$C$$ !(!0! `8!A @!@8 $|$@@ 'ď@y0 $̏r$p ' @@!@g!<4Bb($EAT($E쏄0+$L@;$b''ȏp '̏@$@B($E0 $(b @/'t0$L ' 't@ @8$}d@$܏ď @$@8$}  !$쏶菵䏴܏؏ԏ'<'!'  @!B0B@9!@ B0B@/!<$$ '@'!$ '@!X&D'A $ @#̎,8D !$$c4Ba$ A@$$C$$ `!'<'p!'`|x x$<'! !(!$H`T !'T '(,' 8'XD'\P'`\0x'ABp(!$ @ | !('@'9` ! @@! !  (! @8@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@Ȣ@ ! 'd @$dL !  (!'@ @!@7!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@@<d(! 'h @$(а$B0! 8!@!  ',<T(! 'l @ 0 $ $Tl '` @$t@ @`  ! @ !D(!0! 'P @ P0B@0 $ 4@4$D$b('p t 't @$`@^ !t($E0 $(pb `@K !0'$$L ATl '$ @@!@@ $TlX @!` L@ $Tl\ @!`@ !`P!$P#$c`C!E<4Bb8$F}؏0$FH0 $@  !|x'<'\!' '@p@!A@'A8$F}0'1 $̏$0$Bb!e $$" 000$D$p $ƗH<OB4BCb@0`&@ $&@0 $$0$B\b!e $Q $00$Bb!e $Џ0 $NQ@!0܏ $쏦䏄0 $@!'<'D!'LHD@<8x'<!!! !(!$0 !'0 ' ,`$@ !`(!0!  8!@4(@'$<0 '4@0 $(04'9t $4(04'9t 0!@@!0 $N4$B4<4BLHD@<8$'P<'ݴ!'LHD@<8x' <!!! !(!$ 0 !'0(`$@ !`(!0!  8!d@0 LHD@<8$'P<'!'p|xtplhx$<'! !(!$$TP !' ,'P8'T 0x'ABp(!$ @e !('@'9` @!@ !q  (!@8@!  !!$ b$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@Ȣ@ ! 'X@!pXqL !  (!@8@! ! '@!$ b !$=b $ $=&DC&&$ b$=b`$ $=D&E&RC@@<X (! '\@0!$0! `8!@#@!<T'$ '`@ P@!0$TT` @ !P@!0$T !|xtplh'<'!'D@<840x$' <!! !!(!$$$ !' ,' 8'$ X$@ !`(!0!  8!@?@!<$'$ '(@  @4!0,$$( '@@  @$!0$|DA  @!0$$( @ ! @!0$  !D@<840'H<'P!'D@<840x$' <!! !!(!$$$ !' ,' 8'$ X$@ !`(!0!  8!@G@!<$'$ '(@  @<!04$$( '@@  @,!0$$4DA  @ !0$t$( @ 4$( @ ! @!0$ !D@<840'H<'d!'ȯ0,($ !!@@(!'$">*"@$ !"$"4!z  !@ 0 $菼k$  ! @ 0 $V!P ! @(!  !I$"!($bHBcH '@"$ &R@(!ͨ  !<$E4$",$E菙ͨ  ! '3  !!H$\c\CD@3@!!0,($ '8<'!'د$  !@ @(!0$ $0 '(0! $T( (!@ !'9t 0!@!&10@$N <4B$ '(<'!'PLHD@<8x' <!!! !(!$ 0 !h'0$(@ !`(!0!  8!@($@ (0'9   !@4 $菼0('9 0 '0PLHD@<8$'X<'И!'plhd`\Xx'@<!!! !(!$ P !' $@0!8!` !(! H@(!0D 0!$x !@ !`! 'P@0$ plhd`\X$'x<'x!'LHD@<8x' <!!! !(!$ 0 !'0(`$@(!`0! 8!  !@0$ (!`$ !@ !0`! @0$ LHD@<8$'P<'\!'LHD@<8x' <!!! !(!$ 0 !'0(`$@(!`0! 8!  !@0$ (!ߔ$ !@ !0`! @0$8 LHD@<8$'P<'@!' 쯰诼x'(!$< !'H(!x$H ''(!x$ 'Џ'(!x$$ ' 'ԯt'د''1$'X (4PL\h/!@(! '@9@!A4<,'A`@.` ! @ !D8!' (!@$܏x !(!$ `(!' $ ܏0$4$08$l'$N0 $<4B"&Rx$ !(!$ X$@Dx'(! $!@(! '@M@!,@J<P'1 '$'A`  !@ !D(!' 8!@$b dP(! 'A܏+4d̓$8 8++pا|$&DbD$c $(@(@ <($l$$` 'H<4B"&Rx$' '(! $$@?D!' @(!@2@!A/<,@+<P'1,B@$'$ $` 'A@ !D(!' 8!@U($l'$ $<4B"&R!' @(!@2@!@/<,@+<P'1,B@$'$ ` 'A@ !D(!' 8!@$b($l'$ $<4B"&R '4$l'$'ȯ$$d ' 쏰!'<'ƴ!'\XTP'@$!<'H !@, !H(!@0!(@8! @ !@(!'X $ '88!4$l$$ 7H&9(!@0!$&9 H 'H\XTP!'`<'Ř!'LHD@<8x' <!!! !(!$ 0 !'0(`$@ !`(!0!  8!,@ LHD@<8$'P<'!'LHD@<8x' <!!! !(!$ 0 !'0(`$@ !`(!0!  8!@0 LHD@<8$'P<'!$ $ƩH<'!$ $H<'ô!'د 0 $:$ $%GPBP$%$@$%x$bƠ($$%ȏ$%nƠ"$&(x#$` $l&$\$ $H0((H&`$ $܏&$\&`$P $Ɵp !'(<'P!'tplhd`\Xx'0!!! !(!$P  !'( !x(! $$'PH$' <0` !(!0! @8!@;@!8(! 'T@@!<4Bb8$E|ď($E쏄0 $x!8@ LT '4@0$D@$TP @$8$}  $tplhd`\X`!'x<'t!'P@!B0B@+!$ '@$!, '@!P&$ '( @,b8(!$$c4Ba$ (@$ $C$ $`!'<'h!'p|xtp x'$!!!@ !(!$0\ ! '( !x(! $ '  !x(! $'X8'\ Dа !( ,$B\(!0! `8!@! ', ! '` @0$̏,` '؏ @ @0 $쏼 '$ ! @(! @0$4 (@$B0B@^D$bZ'hX` !@(! $ w @@0!'d ` ! 'X,@ (!d  !@ (!Џ 'H (! @ L\@(!   'h @%(!h(C` ! @L\bh \@@(!0A$d0(! $=(@$L` @(! @@ !4@ $`X @ @ !@@+$`\ @#@ !P!$P#$cdC!E<4B 8 $F}؏0 (!$  $0$FH8 $x !|xtp'<'!'(ԯЯ̯ȯ, '@!`@Q' @ ! '@F@!08<$`$$~|b'  0(''$ 0@8!@'(8$F} <| @@0!0&%H $8@0!&%H0 $`8&%H0 $t!ԏЏ̏'<'@!'0ȯįx' !!! !(!$ !' !x(! $ ௱$` !(!0! @8!@2@'$ '@', '@ ('9 $('9 (!@@!0 $N$B<4Bȏď$'<'!'HD@<840x' !!! !(!$ !' !x(! $ `$ !(! `0! @8!@!'$@'( @( @!0 $!HD@<840'P<'|!'HD@<840x' !!! !(!$ !' !x(! $ `$ !(! `0! @8!@!'$@'( ٨@( @!0 $!HD@<840'P<'P!'HD@<840x' !!! !(!$ !' !x(! $ `$ !(! `0! @8!@!'$@'( @( @!0 $̏!HD@<840'P<'$!'X!!, ! '@ @!H@ ! @<4R<4B"&@0 $$'<'h!'௿ x'(!$$!  !' !x(! $0' !x(! $ '$''''ܧ䯲ħد!, ! @(!@!@&18$8l$N0$8!@0! ` !(!x $'P @(!$<<4B!, ! @(!@!@ !0&1@B$H '(!x@:$ $ !x (!'P @(!'P '08  +$(̏(l$+4$$d<0!8! ,0!($,Bl$$x@8! <4Bx' !(! $0'$!, ! @(!@!@ !0&1@$H $` !x@(! 'P @(!$<($l$$d0! 8!<4B! ' <'!$ $ƭ<'|!$ $<'\!'ȯ40,($ &pDl$B$&H8$Bĭ $$&)%$&f`$(e%(($ H"$G%$&ǘ$B8$Fg`ǘpOCcc$4&Ex##  $T&Ex$ $&Ex(!$P $ƭ40,($ !'8<'!'`0x(!B8$O!( ')' !x(! $<'x '(@ '0 $x '','p$0¯P'tpt8(L4'@D@4$l$$Ƥ0! 8!'8'  (!@!`@Y@U'Xx` !(! $(!$Px ! !$ !p\h `@ !(!0! 8!@,$b!, ! (!@!!<`F$0  !.B !,(!@ &R @!0$b Bc "#.B@$h'xlx0$l$<$`0! 8! ' $'<'!'plhd`\Xx'!! !!(!$<HL !'H'L$'P@' 'T 8!@ !`(!0!(4 ' ! @!@0P$S @H@L<@ <4cC$PC%$@ <T04Bb$'d%0@"P' (! (!$.$_$/$$$,B@ ,c$` ,B @I@ ! F!D!0 $0 $ԏ0B@($E<$Eď0 $䃢@'4$EL0 $A($E<$Eď0 $ $0 $<4Bplhd`\X'x<'H!'@$50x!B8!!'!(!$O  !' !x(! $'Џ$'  8! !@(! `0!@!@X'p͐  !@ !(!0! 8!@$p̴ ! r@t0(!8$H͐  !4 @ !(  !<@!4bC+@4b ! <4QPb4QRb !0' $x0'  $0' $܏0' $  !'<'!'쯴诳䯲௱ܯدx'!!! !(!$  !'Яȏ$ 8! !@0! `(!@!@H'  @'0 $;З$40$C* 8!@$\-(!! 0d@ !p @!@ !(!0! 8!p@  ! t @ !Џ$ 0<4c0C$\$  !쏴菳䏲܏'<' !'PLH8'('   (!@'@!p @ !@ !(!0! 8!@p@  ! t @ !䌗   ' PLH$'X<'0!('9 <'!'P0x')B8(!$O ('x' 8 `(!@@!0s$0 &DN0 $0 $ $,b@0$cC!B\!@0$؏0$菄0$0 $0 $0$(0$80$H $b$ !p '(@ ! (!0! 8!@&0 (! $Xbgb0 $h &DN'  `(!@@!0$N $'<'!'쯴诳䯲௱ܯد0x!P8!!8'9(!$ !8'9x(! $h'ix(!$O ԏ' !x(! $'8$@(! !`0!  8!@@!x'  !(! $'8(!x $,'Џ$  !Џ'8@ ԏ$8!'$ $p8! ! $@Z@!<4b3C+@4b"C+@44b+@E(!#b4b(!=<4Qb"C+@4Q4Qb&4Qb (!0b)4Qb#(!*0(!)$0%$ď0!$䏄0(!$0(!$40$\0(!$0 $0(!$䏄0(!$  @<$BH 0  $40 $D0@N@!($b5@$,b!0$P<Q!E $0."&10@$  ."@0$h 0 $N0$p0$ &@ 0 $@0 $0 $$@@!4$K &0 $N0@$ @@!0 $@!쏴菳䏲܏'<'!'د $!&D (! 0!D (!D 0!D (!D 0! !'(<'|!'د$ !!0@0!$ $@0!0$$| @!"%$ '(<'!'د  '@$0B,C `!'(<'!'Я($ !! ! '<@4c  ! (!8@8! $~|!($ `!'0<'!'௿8$$mX $쏼00$P$$ $ƹ00$P$$ $ƴ!' <'p!'TPLHD@<840x$'(!$T! ! $ ('X !x(! $ 'h !x(! $'` !x(! $8'+'8'x '8,'|8'D'P'x'p'L|'̯'ȯ'T''' '$'x'''(lܯ `\, '@!0!0$l$h$(@@8!8x8|@+ H+ P+++ X+(4@ L$B<4B$  (!@ `0!0$l$x$  @8!H$ (!@!0!4$l$$x@:@8!  !P ' ȏlPLd '̃TX8B@'0T0$l', H+ P+ `+011k8$䧣x̧$p$՜0! @8!$B<4B!TPLHD@<840'X<'p!'௿ $!3!(@$ !n$'!h !@ 0 $Y$  ! D (!@K$  !D@!$"!($bHBcH!@ ! '@! !ͨ@' &<$E4$",$E菙ͨ  !<4Bb&R$2  !!H$\c\CD2!!@! `!' <'@!'LHD@<8$!3!(@$ !n$'!hP !@ 0 $Y$  ! ԌD (!@K$  !D@!$"!($bHBcH!@ ! '@! !ͨ@' &<$E4$",$E菙ͨ  !<4Bb&R$2  !!H$\c\CD2!!@!LHD@<8`!'P<'!'LHD@<8$!)!(@$ c!$!\P (!  ! P !  !C$"!($bHBcH!@ ! '@! !ͨ@' &<$E4$",$E菙ͨ  !<4Bb&R$2  !!H$\c\CD2!!LHD@<8'P<'!'x|xtplh$!!>!(@$ ! $2!~` ! '8@ 0 $̏o$PD (!  !` '8@\$PE  !  !O@!$"!($bHBcH!@ ! '@!@!@ !'8 @'8ͨ(!  !<$E4$"&,$E菙ͨ  !@ !H(!<4Bb&R$2  !!H$\c\CD2!!@!|xtplh`!'<'|!'`$!3!(@$ !n$'!h$ !@ 0 $Y$  ! hD (!@K$  !D@!$"!($bHBcH!,@ ! '@! !ͨ@' &<$E4$",$E菙ͨ  !<4Bb&R$2  !!H$\c\CD2!!@!`!'<'L!'p@!B0B@Y!,D '@Q! xPb '8,P '8|8DPb!$b$4Bb$c 8@$ C$ 8@$$C$$x@$C$|@$0C$0@$<C$<@$H$C$H$`!'<'!'诿  x'!!! !(!$T ! '((!x$p 'H''''' 菢(а'H( 8!$B@ !`(! 0! @U@!@$𐏤 (! @=@ $ @1@$ (! @&@ $ݼ @@ $ @@$菤 @ !$P!P#$c(0C!E $  ! '<',!'plhd`\Xx' !!! !(!$  !'@ !x(! $ $ !(!`0!@8! H@! (!| !'P8 $|$@! @!`$<4Bb0$E(0$E80 $D!plhd`\X'x<'!'hd`@!B0B@t!"D '@l!P' ! '܎#$ bP'\ X&,'X & $P'#8X$D b#P$\B0Bb#h%t0B$0Bb# (!,B8B$ 0Bb$4B$ \@$"C$"@$"$C$"$XA$"0C$"0@$"<$C$"<$hd``!'p<'!'`|x x'(!!!` !(!$ !'h0'l< 'p'('`'(lHT!'x'$&b$B$c а8!( !$B (! 0! @m@!8@ $hhl @H@!D@$4h  (! @=@!P@ $Ph (! @1@!\@ $hp @%@!h@$h '( @@!!&qL$S !$cC!"@ &1 yh @@!&.@@!P!$P#$c՜C!E<4BB0$Fl0$FH8 $x !|x'<'}!'LHD@<8x' !! !!(!$  !'0(`$@(!`0! 8!  !@ @!0 @!0 $!LHD@<8'P<'|!'LHx' !(! $0(!$ @ @ !$@'0 $LH$'P<'|,!'௿! ! &<4cC('9 $' <'{!('9 <'{!('9 <'{|!'h!, ! ''&10@!@<$ !'80 $x0 $'80 $0|0 $L0 $h0 $0 $N0 $N<4B$'<'z!'P!x'P !(!$  @ ! ' @@!$$B !$$Bb!0b$'  '@쏼 h (!(!0 $!$4$Bb!$K0B@&e *@0 $N@($F80$FH0'd $ȏ '@@(!0 $胢쏼@'쏄0 $` 'p (!(!0 $$b0$E0$EH0 $$`%@!'  (!@@!C($b', 0!0@$8 H`0 $N<4Bb9&R$'<'v!'x|xtplhx'P!!@ !!(!$ !'  !x(! $0' $ !(!0!`8!X d@! ! !A (!8 $|$@! @!`$<4Bb0$E(0$E80 $L@!|xtplh'<'u<!'HD@<840x' !! !!(!$  !'0 !x(! $`$(@ !`(!0!  8!@'@!  !<@!4bC+@4`!b4b 0 $l0$0$0$ !HD@<840'P<'s!' ܯدԯЯ̯ȯ(!!'`@ ! (!(@O@!0(! $(@ !'0$ (@:@!x' !(! $(%$'X 0!($B<$ $l !$ (# %$$0$Bb! 0!$c8!0$G, `(!(@ !H'00 $N(<4Bb&R/0 $4($"Ь@"&3Ь!$&1ЬQ!&P!0Ef$@ &R(Q!"0&sP(!&R$L@0!@&s (b$@܏؏ԏЏ̏$'<'qP!'௿(< $`( $T($ $(X $(t $&$ $l&(!$P $`!' <'pP!'\XTPLHx'(!!! !(!$ !'@0'"<p$` !(!@0! 8!  !P@ ' @ @0 $(\XTPLH$'`<'oX!'ȯ0,(0<,$q$y &$X'  !x(!$  &$X$$Bܔb!f' $P (!$P@'0,($'8<'nx!'x|xtplhx'!!! !(!$\`d !' (!x $$ P'X'\'('0'8'@'& 'L,'H$8'`D'dP@ !`(!0!  8!@D\@0@ @0 $h084<\" ,Bb%X"$d@$``$4b$4b"P$ ' @\@'\($E0 $ď|xtplh$'<'l0!'x'!!! !(!$ !'  !x(! $'询؏ $ !(!`0!@8! 䏼(!P@ $ $@0 $䏼$'<'k!'lhd`\XTP!!!`0T0'H$$($b,B@ g+@`0!0`$  'H $b,B@ `0!0`$'H p&d 'Hf'p0 $ $$!'p0$ $( ,B@ g+@'p0` $ $,B@'p0`$p&d 'pbe0B@0$F,,$Fy쏄0 $4<4cb$P '0@$@ 'z<$@$H04$@$v` d4$(4'  $v`'  0!@ 8`f$~|'  0' $HbP$ '0@'z$@<$@$H b@' p&d ' 4$v` $(p,r.+@ '   !" !0!0`@8! $P   !" !0!<` $ďb@'Hp (! &d0 !$ $(p(r*+@ 'H  !" !0!0`@8! $P   !" !0!<` $ď0g4$\'  'H'x !(! $bcP$(! $ b@&dp ' 4$Bv`00$ɀ&p$ $ c $b b@' 0 $ɠ`' p&d  ' 4$v` $(' $0$ɼ&p $ e 4$Bv`0&p$$$  '0&p$$ $ b<@ &b<0&p$$ $ 00'$p$<$$  b8$00$\$l $ lhd`\XTP'p<'c!'Я,($  x'!!! !(!$$  !' ' '@$@ !`(!0!  8! @`008$Bʌ0,<$Bʼ,$ʜ$B7`$Jx$\$ $q 䏙x@'0 !(! $$d 4( '9  P$ ,D # (! @ !+'((! $ x !(! $$d( 4( '9  P$ ,D # (! @ !P$ '( @'0,($ $'0<'a!'p|xtpx'!!! !(!$dlh !' (!x $$ P'`''d'('0'8'@ '&,'L8'H$D'h$P'l\@ !`(!0!  8!@a@`d@0@ @0 $h084<4C C $0 $̏ b!d@,D4"l@$hh$b4$b4"(P$8 +D # ' @\@'\($E0 $|xtp$'<'^!'쯲诱䯰௼x'!!! !(!$  !'  !x(! $ !$(!`0!@8! ؏(!P@ $$ "@0 $䏼쏲菱䏰$'<']!' x'!!! !(!$  ! '询$@ !`(!0!  8! @3x'((! $ $*$\008$B40,<$Bʌ0($Bʼ,$<$Jx$B7`$\$ $q('9  $P '( '(@(!$'<'\$!'xtplhd`x'0!!! !(!$$ !'  !x(! $ 'X8'$D'(P$ !(!`0! @8!(!P@ $ X @0 $dxtplhd`$'<'[!'<840,($ x'(!$! ! ' !x(! $' !x(! $'@', $'$$cDa$B x'0@ !(! $0P:8 '8:` '($0l@$$ 8!x'H !(! $0L$|' 'P'X$'`0'h<'NH'tT'p`'l'x$&$ $cDa$B CtJL0"B0C,c0B0@$$0B0B@*0c`(B8$0Bl0!8!$M@$NvrT\dl X+ P+ H+@++ `+ h+p++ ,8DP\ hP$  (!@P$ @(!@r$x'H !(! $$J$|''֯''P'X'`'h'N'p't菼'' $'$ $cDa$B IJBB0B@B0c`@0",f@;0B0C0$`$d08Nvr +T\(+l0$l9) H+@+8+0++ P+ X+ `++̧ا䧬$0$0! 8!P$  (!@!<840,($ '@<'U!'௿P$ (!$P (!$' <'U|!'௿<$& $<&(!$P $0!' <'U!'쯲诱䯰௼np!!C$!n$b` ! !$b`!$$*@6$P '@(@& '@pnC$P$ '@ '! `(!@!P$ @ P$$c0b"*ʣ쏲菱䏰'<'S!'쯲诱䯰௼@!B8B0B@"!@B0B@! B$Sx'$ ! (!$P'@ ! D$P  (!@!P @(!D $Be0!,!D4f!$(@dLPT8DPdebTP'L x\htb|M M BbMȎLNX!$"PRBTNObPb$`%k $$ n!(b@` $d)$b$HJ0B80D(B @0000B0c %E%0%`HyTHJ0B@0cC%<p0HJ0B@0cC%h$HJ'H1K1I!B 1 9B A00100B1)  *0%8% @%0c0lxKL$b%(b@$n$Bb$> B0B1c@ @@ؓOPb$0!1̎B0B0c(% %خ#1C@`%b$(! B0B@@C$0!1B0B0c(% %$쏲菱䏰`!'<'N!'x|xtplhd` x'($(!!D !(!$ !  !(!x$ &6&0'(<','0'4'8'<'@'D &4а(xT`&<&:&,&`&d&8$B8@د䯩lH @ !`(! 8!@! H!@G&0(0C$bP(b@` $:$be$bZ$3t@C% |D %p0c0`0B4B@!0B@d$4cd$0`0!$S&t0bcdefghijk l m n o pq&sBQCDEFGHIJK L M N O Pt&RX\0B0@0c$+@ @$'%ܭLP0B0@0c$ҥ   $@ȗ$4<4<C%! D%)" !(!4<C%4<D%(@" !E%g!D%@C%000c`!@4@0B@40B@40B@40B@40B@4B@(!0c$`$ 0B@%)0B@)"%))"@<00!$SX&t0bcdefghijk l m n o pq&sBQCDEFGHIJK L M N O Pt&Rbcdefghij!BCDEFGHI0J@8!0$Sє&t0bcdefghijk l m n o pq&sBQCDEFGHIJK L M N O Pt&Rbcdefgh!BCDEFGH@,`0@488$b[(b@$$b$bR$@42!0$S&t bcdefghijk l m n o pq&sBQCDEFGHIJK L M N O Pt&Rbcde!BCDED@*D@D@ <@$D@@@db0!$bcDQXCEFICGHJCIJK L M N O PRSUVWTYPHDQKCLCMCNCBOXP HIJKLMNO0b+@`0b+@$$|xtplhd`!'<'C!'840,($ $!!Pm!(@$ !=$a!x' !(! $' !X`(! $$P(! $@ (!8 $Q8\$Q< $@ 8$Q@ $PD  (! ` !$x' !(! $E$X' !$ (!P $@h$P` !  (! ` ![@!$`"!($bHBcHbcx'(! $) @$` ! @ ! @!!&+ͨ@(! ` ! &<$E4$",$E菙ͨ ` !P' $'$8\@(!@$Q<$"! ` !b!(+HE#$\c\CD!840,($ `!'@<'@T!'쯲诱䯰௼x'!!!@ !(!$! +$bE*b@$` !b0$b;!X' ! (! $>@(!P $@$0B@  (!0 $$P (!  ! P  !  !i@!$b ($bHBcH"#$0b` ! !0$b`!$D*!@=$P '@/ !'0B@$  ! @!!&+ͨ(! ! <$E4$b,$E菙ͨ ! &P$$c0bB*ã$b!  !"!(+HE#$\c\CD!쏲菱䏰`!'<'<!'쯰诼x' ! !0! !(!@! $ď$$X''(!& $ (!P $(!X !@ $P`!  !  ! 0(! $P$ 쏰'<';!'<840 (P'(''9=8  @@! K!@@(!0 $| ?!x'$ ! (! $'P'/ $P (! @$$P '( @@!@<4B!,B@ $0' $҈ $0$Ҙ $0$ $<840'@<':,!'௿ x'!!! !(!$0 !' (!x$ $''$'L&@ !`(!0!  8!@!`?&$@ $L@$B4$0,$ԯL$P ' <@!4b C*@`4b4b$0' $҈$0$$0$ $ ' <'8H!'xtplh ('(''9=8  @@! F!@@(!0 $| :!T@ 4$0,$@$BTP,`(! $<@!4b  P*@4b $0' $҈ $0$$ $0$ $xtplh'<'6!'ȯ40,( ,!! !x$@$  "(n0C!C"l1`$H@ !$ $D&'$   P&,0`P! !$` $ %&&0Ĩ !4  @(!( $ԏ @ !$ x $ 40,(!'8<'5t!'X!0`'$h0 $p<ad4Bd(( !''96 $Y!'<'4!'௿  x'!!! !(!$0 ! '( !x(! $$.$'/' ''0$,@ !`(!0!  8! @T@!.@4B$b '菙(0!$'9V\ $;4(0$B40`$B(0$WP$ $B*0$x !$BӐ   (!( &Dԏ   ! @!$B؏x0! !$- 菼 !&Dԏ (!   ! 0!(('96 $U $ `!' <'2!'诱䯰௼x'$ ! (!(!P $ @  0@ $Ӝ 0 $Ӹ菱䏰$'<'1!'D@<840x!!$0(!' $,T $S%&6B/ 6_Y'4'''' '$'($&4& <8&&,&`& d& 8& :',$(@p|Яܯ诮 (,LXdį $0!<)@$ ($|0#08B(B0B00000clxhti0#0B0c`\T`P0#0B0cHYD 0.1j1I9B B ! ) 1 B0c00000B1)1=$)@$ B400B1c@$1$1B0c0B$$0@CBbB$B0B̧@$CBC1$1B0c0B䯢ԏ$l` !8!'  $D@<840!'H<'.,!'诱䯰௼x'!(! ! $ď$($ !0!'9V\ (!菱䏰'<'-!'௿(, $G< $($ $N䏼$l%&8!$0 $ $%#b4Bb0$Bԭ<0$ $&h$ &h$P$(! '  @$L$ @$4$B<'+!D <'+!'px'!$ ! (!$(!P $' !x(! $(!P $'<'+!'쯰诼!@!B8B0B@m!B@B B8B0B@b!x'$(!  !  !E'PP $ P(! $ @E!PD,'0 'D8'P&QD $ptCxGeb,EF  B00c$BP$`(! &&1 &s |!$@ !$+&@*`$ z@0!!0B&@*<4B<`$ $쏰`!'<'(!'쯰诼 x$'(!! !(!!$ !  !(!x $&80 '&&h&&X&&į'䯣<`T̯H'l&$$b$B $c  @!($C`а`(!0! ! @8! @k@!(!$&$8$$ d@(g%d&G !(!$@@<0B@bb%b0B@DbF`$($ @$Ld0B@–`4B`0B@ @`4B`@`4B`  !8ȏ +\$b$\@ 0 $ȏ $쏰`!'<'%!'쯰诼!`xB0c0B$%' ௥د(!!! !$ !&8('د4'ܯ'&&h&X&į'䯣L@Xį'd&$$b$B $c d8!$&$$$+(`$ b&$<8!$0B(`$ @$B ! !(!`8! ' l !(!`8! ' 쏰'<'$!'x' !!(!$! !  !(!P 'X  (!P$  @ '4|$ !' `8!0B@$ 0!(!, $P$' '<'"!'0̯ȯįx!!!'(!$! +!@&L$"H*"@$ !"T$"\! @ !@!(B0@' 0@(!$P ! @(!$P '@'X0 $|PB0B@ @(!0$0 Z$UP (!O`!0$Qt  !T+`@!&X (!@ ! 0!P!!;@4@ !& $Kԏ1@!P@$ '@(@ !' PB0B@  ! @!!&+ͨ (!@ ! &s@ !,ͨ $菼P$`!̏ȏď`!'<'!'8x'!!!@ !(!$! +#`Y0c$bU(!X' ! $$P @(!@+ !' ' A' @ @  !6P ! (!$P@(! $@'T0 $҈N0B@ (!0$ $P '珼  ! ؏` ! (!0! 8!'<'!'د$ $!0$b*\DEFGHc*\BDCEFGHBY!$'$b@ !$d$@& $cC!EP @ !8`@ ! $~|0$8$ $~|P($$b@!$q$bb!d@(! &1$@"@&$$cC!B@$0 $ڀ$$ `!'(<'!'|xtplhd`\X ޸! !@! $T4&2̏``0!x@ ! $ S !(!P &s @(!( $ԏ P&>8 !0 (! $ P  (! @'(P &%h @ !$ x6 0! S! !0`& $ڜ   !'`$d$( $b!0 $dU!$E$.B0B@$L$.0` ! $ڤ   !( ` !(` !$O '(#d #$ #b$0#d|$H (! 8! &h'l0@(! $( @@"`0B@($b'( 8!'9p@  P !6 (! P|$|xtplhd`\X'<'T!'H x'(!!! !(!$  ! '0ȏ$ (!@0!8!  ! @@!ʤ  !@!$ bR'8` ! ' @0!@ !$ '8 @ !0ͨ $ (! !x $   ! 88P$ (! @'ЗpxB0B !(!$@'8 '@eܯ'$$ 0!8!@ !  (!, $Gd 8P$0 $ڬ '菄0( $ڸ $0$000`$BD8$@ !$Bڨ8$B˜   @ ! &$@(! @! 0!@ !x$- ! &$@(!  (! !x $  ` ! $P (! @-'x !(!$  8  0!E'|$$L$ @8!  8B0B@$cS8$Cg0$'$0 $0 P$$`!'<',!'쯶诵䯴௳ܯدԯЯx' !!! !(!$ !'8(!x$  !'@('@ ! 4@ !(!$80!`8!p (!P@$ @!@<04Bb! 0!$`,B@'x0 $|! 쏶菵䏴܏؏ԏ$'<'!'䯶௵ܯدԯЯ̯ȯx'!!! !(!$  !'  !x(! $'($@(!`0! 8!  !@!`+  ! $P(! $@!<4b C*@4`$ b4b0'` $|0 $$䏶܏؏ԏЏ̏'<'4!'쯶诵䯴௳ܯدԯЯx'!!! !(!$ !'  !x(! $'($'̯@(!`0! 8!  !@!`+  ! $P(! $@!<4b C*@4`$ b4b0'` $|0 $$쏶菵䏴܏؏ԏ'<'!'@x'(!$!  !  !$P (! $@@ 0PRb$ $'<'!'(ԯЯ̯ȯį 菙!E! !! !@0!$ 3'( $ '(0ͨ $ @$(` !(!@0!'('9p@   ! '( ($P (! @$(` !'9p@(!'0'(  P$ԏЏ̏ȏď'<' l!' ܯدԯЯ̯ȯįx' !௥ !(!$ 쏼䏥P'X &((!P$ &ܯ @e0B@'L$E菂,$E菙ͨ  !0B@L$E,$E菙ͨ  !0B@0$EE,$E菙ͨ  !B0B@4$ET,$E菙ͨ  !䏼@px' !(! $ '䏥询$0!$ 'p' '` !$$$@$ !$,`'8'$ !$ $  !,B@ ,$bHEDcHB ! ' !$ ,x'0$b/Ec/DBCDEB ! (!'x($8! 0!$(! &R@ !0`0! $H ! B!,B@&Dx$. $@@ !,`$ '}8@0B@<$FH0$FH0`@ !$X &gB!b8@2B0B@<$FH0$FH0`@ !$T &g8B!2@<$FH0$FHb@&g4$G@B0B@<$CH0$CHb@&c4$C@0`@ ! $`0c`B!<$FH0$FHb@&h؏4$H@0B@<$CH0$CHb&g@4$G@0`@ !$p 8!00$EH0$|$ 8!p@0'p $ۘ0 $N$P' @$ P ' @'`䏧@0! P$܏؏ԏЏ̏ȏď'<'!'쯴诳䯲௱ܯدx'8!!! !(!$ !'  !x(! $'Я4$'@@0!8!Я( (!  !@!'Ї$,S$b.`< ! !`8P$ (!@!l0!@ ! $m$D8D$(! @8!$P`^(! @$X0( $۬0 $菼@ !880$BT<0`$BD$$ $  @ !&$@(! @!0!@ !x$- !&$ԏ @(!`<  !` 8P$(! @$`8F ! 8!$P`(!$쏴菳䏲܏'<'t!'د d$!B0B@!$BP$ (!<@!4C*@ 44b*@` b  &t0 $| 0 $ $'(<'t!' $'(   ! (!@@! @!`!'<'!'د$  x' !!! !(!$̏8 !' !x(! $'X$'0@(!`0! 8!  !@!`H$ ! ( 0P$$B0$  (!@5$0-$0B@$)$0!$0P (!<@!4b C*@4`$ b $0' $|$0$ $$  '(<'!'쯰诼!!0!'$ $ $(P$ $B( '@ C0<$x0B@$ 700$0db$$$d$P$  (!<@!4b C*@`4b4b  &t0 $| 0$ 쏰$'<',!' $'($   ! (!@@! @!`!'<'!'௿ x' !!! !(!$̏0 !' !x(! $ 'X` !$@0! 8!(! @!`&` !,B# ( $P$(! $@@!<4Bb '0 $| $0 $$ ' <'4!'诿 x!!!'p(!$̏( !'@ !x(! $' !x(! $''H$(!쯷௶ 0! ! 8!@!܇,Q ,r@`$0$H  !L40$c栯0$p$0$cp @' $-x $Ll' ( $ԏ@0$P(!' x'pP$B $ @ @!<4Bi`p$_'䏙$L(!0!'  $؏0܏$܈$0 ' U !P(!$ @3@!P' (!'p$ P(! @ 0!$(!@' $L 0؏܏$܈$G$0@' 0$FH $P@(! $P'@ $$<4B `$'0 $|`$0$ $ '<'D!'د  x!!!' (!$̏8 !' !x(! $'X$'0@(!`0! 8!  !@!`:@ @ 0$0($H@$$舯(  ! 0P$$B0 ' @@!<4Bb $0' $|$0$ $  '(<'!' دԯЯ̯ȯįD!!S|`! @',` $󨏼0ͨ'$ܠ  !' @ !x(! $ $P@(! @"'8XxB0B !(!@$ '(@$l0! !`(!8!@<'LH P$'  "@',`$  0!0ͨ'$ܬ  !@ !(!x $ @(!P$ @$XB8B0B@'8x !(!@$ '($l@'LH0!< !`(! 8!P$' R@<Q4B P"@ 0!,`$ 'P0ͨ'P$ܼ ` !'P !x(! $P$P  (!@,'菙x !(! $̏' 'XP 菼(!$ P @'藢H|@ !8B0B`0!@$ P$'菙P$!؏ԏЏ̏ȏď'<'p!'ȯ40,($ !!! !(!@0@&L$&14"$$$@D!e!D!e#Dc! ! '@M!x0! (!B3!@@@0! 8!&H0 $ $D (!"0H@0!8!% @ $ $%L&L&R4B&14&L440,($ `!'8<'L!'د !$ $ď@!@(! ! !  ! '(<'!'௿ď0  0!%'(%  $ $%$(TT4c4444BT䬇T$$c4Ba$L0P$ȏ$(! ' <'!'ȯ40,($ $!!!HY!(@$ (!3$M(!$bd@$pd$bdb!d@(! &$@@&$$cdC!B@$0#$B!Bb$ !$$td$cb` !$$P$Bdb!e @ !@ !40,($  '8$b@($bHBcHBC$!Cd`)$Ud @ !@!  !!&Ѐ+ͨ (!@ ! <$E4$b,$E菙ͨ& @ !@&$b!H  @ !&\c\B!C D @ !&\c\B!CD$b!!`(!40,($ !'8<'!'xtplhd`\Xx'8!!! !(!$w !'  !x(! $'P4$'@8!P( (!@0! ` !@!$P,Q$b- <!B 8P$ (!@!l'`0!@ ! $x$D8D$(! @8!$P i(! @$c !!0' $۬0( $菼 !880$BT<0`$BD$$ $   !&D (! @!0! !x$- !&Dԏ  (!`` !򄏙`CEbF 8!$$CT`$PT򄏙`C&EbF $@$xtplhd`\X'<'D!򄏆0$E $H<' !'௿ x' !!! !(!$  !'(0$ !@(!`0! 8!@@!$b$00 $ ''00 $4&, !880$B 0`$8$Bd$@ (  !&d (! @!0! !x$- !&dԢ  (!@ ! '@>'p@($F<$Fď0'4$l 'D!!0įЯ 'Џ@0&1$E$"0$EH$<$BTb!f $&*@0 $N@ !0 $݈!0 $菼&, !0<0`$ݔ$8$ݜ   !&d (! @!0! !x$- !P&dԏ  (!҄'00 !'! @!'4 @$$BTb!E0$EH08' $ݸ| !'&&R*B@$ `!' <'!'௿dD !' <'!$ $<'l!$ $<'L!򄏙ȌF <',!򄏙D <' !'Я($ !0`&&$ !!$bd@ (!&X$dd$@$$$cdC!F0$F܏,` ! $#`!"b0B@<$FH0$FH0` !$X &'!#b0b@<$FH0$FH"@&'4$G@B0B@<$CH0$CH"@&#4$C@0` ! $`#b!0B@<$FH0$FH"@&'؏4$G@0B@<$CH0$CH"&%@4$E@0` ! $p($ '0<'!'hd`\XTPLH!@$0!@$!@$!@$|!@$@!`8!b0B@2b` 0PcC$@P ' <`f$0 ' <$FH0$FH0` !$ ' ˆ!4$b@Bc@"@<#C0b@BB0P<$FH0$FH<`&G$" !0B@#' BD0B0! 0P@<`F0$0 ' <$FH0$FH<` !$'  "!  !L"!p&'  0P@8!<$FH0$FH,` ! $`5"!b$0BC0$cb$b*&ebd1d0P<$FH0$FH0`1$  !<$FH0$FH0` ! $"!0 !$bGEFcB%#&" '"!<$Q0b@B0P<$FH0$FH<`&$" !0B@#' 0B0! 0P@<`0$0 ' <$FH0$FH<` !$'  "!  !L"!p&'  0P@8!<$FH0$FH,` ! $`5"!b$0BC0$cb$b*&e bd B1d0P<$FH0$FH0`1 ! $<$FH0$FH0` ! $hd`\XTPLH'p<'!'<840,($ <쏑 'ď"$$,&D$ $P$$ $܏P&R,,H$ƨD $d%PP Pb,,H$ $ƨb !WD$Ԏ&ĮX\ `dTDt$$WhT !\` XTdt$T$b$,$BD @ !c$b@ !ԌVp c$w@$&4@d$P'ď<840,($ $ (! '@<'א!'HD@<840x' !!! !(!$ ` !$` !l(! 0!@8!( $$ !d  @!HD@<840`!'P<'ְ!'쯲诱䯰௼x'!! !(!$ !$F!*@$ !L$X!  !' (!X$ @!  !@!*b @` 0 (! $`_$[`!8!'Ȍ $ $F*B@$&P0X !$ 0!0!!8@4!4 !&E$K $*@!  !' @ '  !+C!,&B*@$f`0$FH<` !$ 8!''؏ P#0!&s`!쏲菱䏰`!'<'!'lhd`\XTPx' !!! !(!$ !' !x(! $T$8$<'$'8'<'@ 'D$'H$'D0D@H@ !`(!0!  8!@!`E@<@b%Db%Hb%$D؏8$B88  !<@!4bC*@4`"$b4b $0$$0 $ $0$䏄0$ $lhd`\XTP'p<'Ѹ!' x' !!! !(!$  !' !x(! $  !$`(!0!@8! @!` ! @@!<4Bb $0$0$D $ '<'Ѐ!'plhd`\XTPx' $!!! !(!$8 !' !x(! $T'8'<'@$ 'D'8'H$请0@ !`(!0!  8!@!`t@8$B8@$C$<C%؇@ $C$@@C%؇@ $C$DC%؇ @ $C$HC%؇,@(!P 'D  !@ @!8<  !@!<4b C*@4`$b  $0 $ $0$h0$ $plhd`\XTP'x<'͘!'䯴௳ܯدԯЯ !@ 0!0`' $ⴏ' ` !b!4 $bDEcBDCBE'  '@:'`؏x0B ($c0000Bȯ̯į !(!$T 't'D'ď$'ȏl'$ +' 'D` !$̯hdp| 0! 8!  !@ ' @' <$,$b̐HIc̐BHCIB$'8!'9@ 䏴܏؏ԏ!'<'`!'ȯ0,($ 0x'8!!! !(!$  !0'@H$@ !`(!0!  8!0@.@!$b '8$,E'98 $0!$0$b⼐F c⼌EB8D< @0'8@!0'8 &D̏00!'8x$= 'H00! (!(@ &dԏ0@  !0@'L($E<0 $ԏ0$ '8(00$BWP0`$$B4$$B0$B<$BԐ $($0$B( (0 '80&D'8 @!00!'8x $-00! (!&d @0  !0 !' $W 0@$$@$B0cb!Œe0F 0c0`$E($B<$B($B<$B<$B4$BP0'L$4$  0'l ! !0@!``!b`!@> B0b!bB0B@ B0b!bB0B@&&! # B0b!bB0B@&&#(B)@!@#(B(S#*)@$(#u(!(!00$T$H 8!00 $N0p!0 $N0 ! [' 0,($ `!'8<'!'x'!!! !(!$  ! ' $@(!`0! 8!  !@!`Q@7@  !@ @!<4Bb(0:$`l'0! ! $ !'p<ͨ $$(!$,0!$$'9@  (!8 $0$|d  !@@!<4Bb0$㨏0$ $'<'!'௼ '' @  '' @'؏$'<'t!,'98 (!<'T!'௿, $ $$D $ $' 00$P$P$ $<'!'hd`\X$!R!(@$ (!8$(!x' ! $8'@(!X $'  !@ 8!0 $q$&'H $ $ @ ! P ! $ @ !M@(!8$M$($bHBcH' 'P@ ,ͨ@ !$ %@ ! ' ! @!!&p+ (!ͨ@ ! @ !<ͨ $4' 'P@ @ !B!(!H$\c\CDhd`\X!'p<' !'0ȯį x'H!!! !(!$  ! 'X !x(! $8 ௰$P@ !`(!0!  8! @H@!@V ! ' @0$,00<0$Bi$<$ƌD$L&$  4 $ '(@@ ! @0!0$F\<$G0$b0$GH$0$Bb!$b0$BH'\&$   ! ' @$ '( @0!0$F\$0b<$G4$GP@($B<$Bį0$b0$B0$BH0$b$$Bb!b0$BH0'\$  '4 $  ! ' @ 0$@ $XbF0`$b 0`$b($E0$E`4$Et00 $l  0 $0 $䤓$ b $b($E0$E`4$Et0($䬗 0 $0 $蓣$ b $b($E0$E`4$Et0$   0#0$ 0!0 $0 ɔ ! ' @l$ȏď`!'<'!'p|xtpx' !! !!(!$ !'8 !x(! $8$h'<('h4$ !`(!0! @8!@! @  ! @!0 $h!|xtp'<'!'x|xtplhx' !! !!(!$  !'0 !x(! $8$ !`(!0!@8! (@!@  ! @ !0 $焏 !|xtplh'<'!'䯶௵ܯدԯЯ̯ȯx'(!!! !(!$H !'x !x(! $8' !x(! $'H' <'pT'`'l$0p` !(!0! @8!@8@!xD`pP@pr @l$  !@ 0 $砏$$ l ! @!0 $砏!䏶܏؏ԏЏ̏'<'!' ܯدԯЯ̯ȯįx' !!!@ !(!$H !'h !x(! $8' !x(! $'L'@'4'X'd$( !(!0!`8! @!T@ !h<H` @!0 $ď!܏؏ԏЏ̏ȏď'<'`!'`x' !! !!(!$$ !'H !x(! $8't4'|@$ !`(!0!@8! (@!@  ! @ !0 $菼 !'<'H!'x|xtplhx' !! !!(!$  !'0 !x(! $8$ !`(!0!@8! (@!|@  ! @ !0 $ !|xtplh'<'@!'௿ x'(!$8!  !'(!x $$' 'د, ! '@'؏4$l8B+$䧢($ @8! !x' !(! $'0` !x(! $H'\'P'询D'$'h'駣@t4X8 ! '@# !䏙 `0!@8!0$l$ܼ@$h엣ꓩ闢j&+@+ H+Ldp ɔ !x' !(! $8'x !x(! $$'$'ܧ| ! '@ 0!4$ԏl$p$|@@8!  ! !' <'t!'௿՜ @0 $$$' <'!'ȯ0p '0@$@$ (0 $d0 $舏0$'8<'!$ $<'`!$ $<'@!'௿$,$ $0$& $0$$ $̏&谏4$P$ $&谏,,H$p $P!' <'p!4$ES 0$E0 $<'0!'p|xtpx' !!(!$0! ! !'`('d$4'h@'lL@ !`(!  0!@@!$'H!$@w$`$$H ! 'P@v$*@$ 0 $P锏0$Pt0 $Q쏂0$P鴏0$Q0$QH !0 &dNP@($F<$Fď0(! &DQ@($F<$Fď (! &DR@($F<$Fď0&D $D$S@($F<$Fď0&D $t &dNCH'X ! (!@;$2 !$@(B+X0@4B+Y<@@B+ZH@LB+[d ! (!@ $$,'9` $|xtp`!'<'X!'`\XTPLHx'8!!! !(!$  !|x$' ` !(!@0! @ ! (!@@! $`\XTPLH`!'h<'!'XTPLHD@x' !!(!$! !t !'8p$('<4@ !`(! 0! @@!$$0@ !8`$<$<8 0+$XTPLHD@`!'`<'x!'LHD@<8x' !!(!$ ! ! !'0(d$`@ !`(!  0!@ @!$@ !0 $LHD@<8`!'P<'!,!!(!@0!`8!$'9ޠ <'d!,!!(!@0!`8!$'9x <'(!,!!(!@0!`8!$'9X <'!,!!(!@0!`8!$'9P <'!,!!(!@0!`8!$'9ޠ <'t!,!!(!@0!`8!$'9x <'8!,!!(!@0!`8!$'9X <'!,!!(!@0!`8!$'9P <'!,!!(!@0!`8!$'9ޠ <'!,!!(!@0!`8!$'9x <'H!,!!(!@0!`8!$'9X <' !,!!(!@0!`8!$'9P <'!,!!(!@0!`8! !'9P <'!'h$ !(@$$ $L$H0$R؏ $Sո0$R䏂$S40$R􏂁$SذH ! 'H@/$IJKHx'tx| !(!$0 p'p ,4't`,'x$'P8'|@(4$ @0!$ ! D !`(!l 0! 8!!`!'<'!'د ,!$Q< ! $ ! ! $ !'(!<'!'<840,($ &Ф&P40$dӰ&Ϡ&\&,$%FԀG$J%k(0+x&'7x$B؏"Ϡ0$Bb4040$Bbh004$Bb0H0w,%'@$B0 D%DGФFD$B4",% $B " %%ո$BذB,&R0&sì$BB ,L@$BlӰ  4,+4hiDjxK4 44!&1V$NЏ,$B䬂t,%`&H$BԬt,mଐ8$BĬt-ԀQP,<$B娬@,48$B\ ,$B昬@,<h$BL ,$$ $B爬@l,p$B 04$M808<$LD0hl$Kd0phlp$Ht0!$ (!!^!$$GIO J$BL$(nmlkh$_@$c|$Ah0&,$Bꐬ0&\$BĬbd000$Bt0&$BL0$$$Bd0$B锯0$B ȏ0\$B8d$B[,0 $(h $B8bL0iToXĬj\ iiiP$ $EϠ<840,($ !'@<'!'௿0$P$$ (!!' <'!'LHD@<8x' !!! !(!$ 0 !'0(`$@ !`(!0!  8!@D@!@0,B@$0 $쏤0 L $@($E<$Eď0 $䏼L $@L $@(!0 $0 $N$LHD@<8`!'P<'!'hd`\XTP0x!B!!'1(!$0 !'  !x(! $ '0$` !(!0!@8! ( !@@! $hd`\XTP`!'p<'!'hd`\XTP0x!B!!'1(!$0 !'  !x(! $ '0$` !(!0!@8! ( !\@@! $hd`\XTP`!'p<'!'௿0 $ 0 $N$' <'x!'௿ 0 $  0 $H$' <'!'p|xtp0x!B!!'I(!$H !' $x !(!$$h l'h4'l@$'H` !(!0!@8! ( !(!ː@@!hlV@$$`4 $|xtp`!'<'!'xtplhd`0x!B!!'9(!$8 !' $x !(!$ X'X4$'8` !(!0!@8! ( !ǜ@@!X $xtplhd``!'<'!'plhd`\X!!! !P'90x(!B$'  8 !(!x$ '8'P($4 !@(!`0! 8!@A@!@$@P,B@ $0 $t$PP  !P@($E<$Eď0 $P@, P@0!0 $0 $N$plhd`\X`!'x<'!$ $<'!$ $<'`!'௿0$&H $@&H,,H$P$0 ' <'!' دԯЯ̯ȯįx' !!! !(!$  !'($@ !`(!0!  8!@)0000 $܏&/<0$B8$$BT00&$B4$@&& &GЏ'0$ P (!@'8P$ (!@0$\0'j$h 0< 4$Bv`0@(! $h4<0 @(! &p;!@ '<4D   0$BH0@(! $' !x$. $@$!$ G ' C#H0!#(!0B$c@(dC#00!$ $!$' r!B"@y$P (!Y@!0,<..4B..$ $菼0$$&p'j r!"0 $,B0B@ 0B@L $E菂( $E80B@($EX($E`0 $8r!HB$!$ G##H0!c(!0B$c@(d##0$$@ '@  $ $,r!0G" $P $ $,r!0G"$\'j !&R*B @' 0 $NP$ ؏ԏЏ̏ȏď$'<'!'௿P$  (!@0 $x$' <'4!'௿0$& $&𤏅0P$ $ܐ!' <'!'د L!P  !x@ !$ @ !61 ! '($+<'4!'د $C,`$Q,!0"&$@@0!% &1.@0 $N"@! $'(<'!'د $C#`$Q#!0"&$@@0!% &1*@0 $N"@! $'(<'!'௿8! $4@U!8 ! $@@M$0 ! $rL@  !8 $L@ !;$8 $X@3$0 ! $@  !0 $@ !!$< $@$0 ! $ @$0 ! $,@ $0 ! $8+$c`!' <'4!'د  ' (B'(<'!'௿< $f䏼,B' <'!'د 䯠 ' ',B'(<'p!'hd`!!X ! 'X<@4cXT'$<@@ !  ! (!4@8! $KQ*<@4c!hd``!'p<'!'ȯ0,(t!!'  !< !8 (!$q @ 4c <4<4c8:G#@G!@#BC#@# Q*@!<4C0,(`!'8<'!'ȯ40,(t!!'  !<@4c#  ! !P  B@ !0$D8!  (!Q*@!<4C40,(`!'8<'!'ȯ0($b$D T @!x   P$Q@0!0P&$ $ @ &$Џ@0! $8@@!픯L P@ !8 $0DpT tx |@ !$E+ '@$8$04$>$D T @!x   qP($Y0P&d@0! $ @ &d@0! $8@[@!D, @@픯L P@ !8 $,D,pT tx |@ !$E+ '@$8$04$>$D T @!x   P4$X@0!0P&d $ @ &d@0! $8@@!D8 @@픯L P@ !8 $4D8pT tx |@ !$E+ '@$8$04$>$D T @!x   P@$Z@0!0P&dX $ @ &dX@0! $8@@!DD '@@픯L P@ !0 $DDpT tx |@ !$E+ '@$8$04$>$D T @!x   ]PL$Y@0!0P&d0 $ @ &d0@0! $8@G@!tDP '@?픯L P@ !0 $DPpT tx |@ !$E+ '@$8$04$>$D T @!x    H  !̏ȏď'<'t!'د $!&̎ (! 0! (!$h 0! (!D 0! (!D 0! (!D 0! !'(<'s!$ $<'s!$ $<'s!'د 0$!$ &$&$,,H$, $ 00$P$$ $  $b!'LHD@<8x' !!! !(!$ 0 !'0(`$@ !`(!0!  8!@D@!@0,B@$0 $@80  $@($E<$Eď0 $@p $@ $@(!0 $0 $N$LHD@<8`!'P<'= !'@<840,($$0x!BD!!'Q(!$ǣP  !'  !x(! $0'('4' @X$'P@8!` !(!0! L 8!@@!  $$@<840,(`!'H<';!'LHD@<8x' $!!! !(!$ 0 !'0(`$`(!@ !0!  8!(!@@!0 $$LHD@<8`!'P<';!'௿ $' <':!'Xx' !!! !(!$$ !'H !x(! $3'4'@$(!` !0!@8! ((!@@! $$`!'<'9!'h|xx' !!! !(!$p !'8 !x(! $3'p4$(!` !0!@8! ((!x@@!p $$|x`!'<'8!'X$x' %pCpBxp!!! !(!$t !'8 !x(! $3'4$@ !`(!0! 8!(  !l@ @!U!EP $`!'$<'7!'ȯ40,(\'  '$ h0 !@$@ 7D`! <b@!8 6Mӏ @!"#0ژ P 0$@8!$@0!e  @(!0 $A @(!0 $AH4  0 $N40,($'8<'5!'௿8 0 $Ax 0 $A0 $N$' <'5!'ȯ0,($ 0x!BD!!'I(!$ǣH !'  !x(!$$ '('@H$'H 8!@0!`(! ! 4@!@! @ !@!0 $A䏼D @ ! 0!  !$0,($ `!'8<'3!'ȯ0,($ 0x!BD!!'I(!$ǣH !'  !x(!$$ '('@H$'H 8!@0!`(! ! 4@!@! @ !@!0 $A0 @ !` 0!  !$0,($ `!'8<'2!'PLHD@<80x!BD!!'a(!$ǣ` !$' x !(!$<,0( 4'((',@'0L'4Xh$'`@0! 8!`(! ! 4@*@!<(@,$B, @ !@!0 $B( @ !4Џ,0 (!  !$PLHD@<8`!'X<'0H!'TPLHD@x' !!! !(!$8< !'8('<4h$@ !`(!0!  8! @@!8< $$TPLHD@`!'X<'/d!'د ! !!"!@BQ,'9\l  !0\@$  h$  !\ @(!$ `!'(<'.!'TPLHD@ x'(!!! !(!$ 8 ! '80h$@ !`(!0!  8! @@!80 @ !@!0 $BL &B((40$BWP0,$B'̯0$݄$Bh$B*$  &B(40,0$c{$BBx$T$Bt`8!  d @ ! @@!D Sh0 %@0!0 $B$ 0d$ $ @ !h @! &DB @(!   !0&DB $B|  @ !0 $H% @!,&'9\l @ ! "@ " @  !0\ $ " @ hD  !\ @(! h  ! 0$BB|0@(! $h   ! %0 $9# 0b@4$E䏂0$E9B0B@0$F90$F90B@0$G9Џ0$G90B@0$B90$B90 $9 \@ ! ` ! $TPLHD@`!'X<')!'`\XTPLH0x!BD!!'i(!$ǣh !$' x !(!$H@408 <'0('4@'8L'<X'@dx$'h4@ !`(!0!  8!@E@!<@4$B488+<@4@@!40 @ !@!0 $B0 4@ !((! 8!@ @ !@(!0 $B  !$`\XTPLH`!'h<''!'XTPLHD@0x!BD!!'i(!$ǣh !' $x !(!$H408 <'0('4@'8L'<Xp$'h@0! 8!`(! ! 4@9@!<<0,P`@4$B4 @ !@!0 $Bȏ0 4@ !(! 8!@ @ ! (!@0!0 $B  !$XTPLHD@`!'`<'%!'0̯ȯį0xАPD!!x'y(!$ !@'Ax(! $Ǐ' x(! $Ǐ'яx(! $Ǐ'  !x0(!$T $UC'('4'p$'x'@''Я 8!@LXd@(! `0!!!@@!p 0 @ !@@!0 !$C$ @@!0 !~$CH @@!0 !r$Ch @ ! (! @ ! (! @ ! (! @ ! (!$0B@4B`$$"$b$$"$b$"$<B4B0c@ $ % $@0!&$  (!@ !0$C0  !@ !` @(!@ !0$C   !  ! @ !$̏ȏď`!'<'!L!'LHD@<8x' !!! !(!$ 0 !'0(`$@0! 8!`(!  !p@J@!0 @!0 !  !08$C@! C@!\@ !$ (!b0($C! $h@@! @ ! @!(!@0!0 $D(  @(!0 $DT ! $LHD@<8`!'P!<'`!'௿0$$H $p!' !<'!'LHD@<8x' !!! !(!$ 0 !'0(`$ !@(!`0!  8!@!0@$E| 0 $Ф $LHD@<8`!'P<' !0 $H $<'!'د$ Ѥ!' ! P$Bb!e  !$ !'(<'p!'Я($ h! ! !@!@!$,b, ! $ @!@&  !@@!"!C$,b3!$ b0\ !$ST $ @-* @&% P &D0* $bS`PDEFGHIJKL M N O cS`B DCEFGHIJKL M N O B  P@P@ !  (!($ !'0<'!'Я($ h! !@!! $B"!E@ ! &@ * P$B "!E ` !`($ !'0<'!'د$ h! !@!@! , ! $-@ !$EP@&  !@" !$-b$ P@ !  (!$ !'(<'!'د$ Ѥ!' ! P$Bb!e  !$ !'(<'!'د  !& (! 0! (!$h 0! (!Dx 0! (!Dx0! $4 (!Dx0! $h (!$ 0! (!D 0! (!D0! $4 (!D0! $h (!$8 0! (!DH 0! (!DH0! $4 (!DH0! $h !'(<'!'௿0 &Sp $&Sp0 P$S| $ƒ!' <'p!'ȯ0,($ !!!!$  ':C& (!@0c$$`&R ""&1!b$Bb$ b&@2B@ .B"$B"b$Bb.B8B0,($ '8<'X!'Я,($ !! !@!$ bE$c$b@,@4$,0$,!@ :B0B@&R &1$,$  ':C& (!@0c`&R""&1!$ b&@"!$B",($ `!'0<'!'د$ <! '$@$$b !!$ `!'(<'!'PLHD@<8!0 !$Vp !@@@!B@<tt#*" @'V$  !(!  0!! ! &s,B(@  @(!P  !@(!$B)@(! ! &F)@(!1!E)` !E(! &F*C)D*@(!d!$B+!C($B+@*  !,B(@  @(!P  !@(!$B)@(! ! &F)@(!B)B(!PLHD@<8'X$$$$B00c$b0$h$$+@<'D!0$bVcV b $  b@$gc $$ $ .@!$(b @$g0$gW@!$0C(b $@$g0$gW%  BB$@$%)+@ P@<'T!'د (!`!$x$0! 8!)b! 0  !#*P !$B` 0!$+$)%*$ !00! ! '(<'x!p $$<'P!'د$ !!! ! !  $FF* (!@ !&F&!@  !$ '($$ %$$,B@$66$$b,B@$gf# !$$,B@$66$$b,B@$g#!@!$ `(b!@$i $@(C!`F$$@0!`$(b!@ i $$@(C!`G%!&&$0$,B ,c@H!$$`,H$$I+8E!<' !'840,($ $0!!b!`!8$xb$Xb$$$$+$$ !$Q  !Q'&& (! '&@S+`$rq+@$b!!840,($ '@<' \!'د$ !(!! !@@! !Q+@B+@$$ `!'(<' !'840H!!!' !(!%!B !C!G $,0 `%!( !!B$@,`0' (!'9  0!(Q(!, $B`$0$W840'@<' !'<8$,B!0@ !' P!H!'<$$!%)E$)b$%J-B@%0(!'9  '00!!@<8`!'@<' !'ȯ40,($ !!!!!$$: &1$ $-$. $`"$B&$BB! '@&s$.b@ B&0t$B$ծBC!0T!40,($ '8<'!'<840,($ !!!!!!!$$:&1$- $*&&s*&B!!@!B$? $$B$4B B '@$&.@$C!0V:b+<840,($ '@<'|!'د ( '@!@$@` ! !'(<' !&&$:$- DQ BQ<'!&&$*$? DP BP<'! 8!X!$ `$¥Q$P!`$P$P%'"%'(b @$h0$hWH$0C(b @$h0$hW(%k-b@ `B!<'!0 $߀<'!66$ %Gߔ$@! H@$@!$@%Bߔ<'L!'د ' '<ѷ4BY @C!C!'( #BD!<'!'د$ <Q4B<4ƈ@!!0` !$VB@8!F@G!G!#B@!FC##01B98#8 g8#!$ '(<'! $߸<'! $<'!'د$ !!$ ! !"b+"` #$BB"b#<4BB@b!C#B#C#B$ '(<'!܌be<'!'ȯ40, @!( $$` 'Y  ''  '(@P#P!(@,C+@40'8<'!'840,@!<b6MD  !@P#P!"#` 'Y  ''  '((@,Q+@840'@<' !'௿ 0B' <'!'ȯ0,($ !!!!!#$.@"!<4BB?P+@<b&4DM$@Q#Q! !#,b@ `!d$@Q#Q! !#`!,`` !$ 0! ` !@(!@!$C T(@$&BC*@IC#$FE0#!$.(C$ 8!$$<Q<&#4Bb8&#24Bb9B!$$,d@$, @<!&<4DC!@$8e !0` $V菼 ` !@(!."@&!$$!$k$be!!$Mb$e!*`@ 8!!S !c!B$ca$8!E#@@!$ !$cD`$`!!@`!0,($ '8<'!4 $<'`!'HD@<840$ (+$ !)!!*`!!@3!20$ '0 $V`(!0 $V ($0$W e'P !$,B_&s@!$.0&1 $W2+@20T+@4$O0$T 2"@420 $$&10$T !$ 2$C(' $OHD@<840'P<'d!'௿0 $W ' 0 $WP<'!'ȯ40,($ !>!!!0B0#P!$W8!`BBCP!p!B'C` & %&0" '(#$W0# "%$C(##BP!B d!C&s&`&1 40,($ '8<'!'TPLHD@L!'hl !@.$$B0B,B @'D(!&F '8@!8!@!' !%$``0!`!  '@&1&+@$TPLHD@`!'X<'!'Я,(!'  $@@! +,(`!'0<',!'Я,(!8'  $@@! +,(`!'0<'!'௿!0 $W0@0!00!0 (@(!((!(0' 0 ( $W $$$$+`$D!@8!@@! !@@!00!!Ef!0!@!` 8!e+@0!`8!`e+D!E!bbD!E`!bbD!E`0!$$+@` !`8!C`0!D# 0b@ CD#0D!C@!0!D#E+@D#D!CD!@!C 8+ d0+!$BC+@`@!!<'l!'tplh!!j!h,@e!, @`! !'&$+`$@$*@@!' &C*@ $$d`$$x$@ !0 (!$@@ !@8!$$$"$P0!'%G@"(!C !#$ I $@#$$$%@@!tplh'x<'p!'Я,($  0$Bb!!$$ $0Đe$X 0! '0c@ !x2E&&&` !  !,($ !'0!<'!8!(8!@$ b$BF+@8!!<'D!@$ !$!!<'!'<840,($ 0@!0! !.@$}!&"C$$B0Q&C<$c0t!P+@!<#$BQ  q!:$P0,@ (! ! (!@@!T!$E0@   !@@(!&b@ !@!!$c`@(!B @DDD#<P+EӰ!E @!<  +q`@@!$$$b$cE<PM&#&$4BagBV C(V$ 0<Re4DdZ$ޭ!D!x0!&D0 $@!<840,($ '@<'d!'௿H00 @!0 $X@!$`Ccc@!!' <'!'௿H0 0@ !@$(!C0DbdD!' <'|!!BB*<'L!''$$c$a$C` !b!cd$'<'!'<840,(! 0@ <ni04B0C% $c0<$BX4$X$ '  &2"@6$#<PM4Bagb/$" #$C+@)$%E+@$$" R+@$$(!C<Re4BdZb$E#$b@ $'$B0!0c b0S$@&0$ "@"R22@# S%$$c$ޭ # <840,('@<'! <'!'ȯ0,( !P2@<PM4Bagb <ni04B0C% $0<$BX,4$X$ '  '$ @$ N! B$2"@?$"+@:$ Q+@3$"0 $B0 `($ +@!$ D+@$($##b@ $&1&0! )B((!0c0b' $0<Re4BdZb$ $  !0,('8<'!  !<'h!'Я,(! 0@<PM4Bagb <ni04B0C% $0<$BXP4$X$ '  !`0b@$b+@$ C+@$ D+@ $c $ϯ $̯ ,('0<'@!'د$ !!Q 2"@<PM#4Bagb 0@!%* &$ '(<'!'lhd`\XTPLHx'xp! !(! $0x!!$$!+p5!$@*%!` !"C&*@&1 &*b@|!#0@$e$D p"C!"&R^+@$ '*!! ! !,$% @"R*@ !@!$& &1 C!"&RS*!`&1 x!p4!@ %!'"&D*`&1 ` $!"g $ (+@$!& !D&R^+@$ !lhd`\XTPLH'p<'!'\XTPLHx'!!!` !(! $0@(!!$`! !'!@F@&R! `!F$ce*@& e $(@@@&14+@$  '!&1 &  \XTPLH'`<'0!'د 8!00 $B$Xt $<@!<4C `!'(<'!'<840,($ ((0$TT*!0R@$u! @!@!@~@(!#0F!$B<$ +<(4$ ",8 bf#0S2r@ 0V&!  !@(!&0T$$<  +"Q11$ % "(!r@ 0R@(  !@@(!"Q 1$ 0  !!$$B< "%!!<840,($ '@<'!'د  !p $C,B@ !b$E,B@` !e  !   ! '(<'\!'௿،  !' <' !'ȯ0,($ !00 f!$"+@_!@ !+@ !0E`+ 2Ԏ#"# 0S@X!`A!($ jb<b%c((( <8% #(!$$cdef ju"( ikB bd(<E $d(C(<4Bb$ %d(eB$C D,E8Q#b$c Q$d,e8P`k`!0,($ '8<' !'ȯ0,($ !0b!Ԏ @h!@!@!W!$ b(($ , 8  $BĎ0S$c($ ,8"- 3 !Ԏ @h!@$BR RD Q  !!Mb$B!b "ͭ(-0,($ '8<'$!'LHD@<840,(!00(!bf@o!+@l!B$$BG*@d!#$B0V 8!@! `X!U +B@ RB!0U+@ CQ@$? #0+@ !CB0w!#b#%!+$(! @ 0! !b#"!bs`0pqd` $ 0!b$0# !!0q$b+R@#B!0U#!0V0w LHD@<840,('P<'!0 0<8!4H $$C!$@!$!<'`!'د !00P+\$X|@(! "$$#P! #p##"$$ '(<'!'د !0"(`0B@$<#b$"D#$P0B@ "D#$BC*@`!`$`!$(!0\ $X"$$#P# !!#"$$ '(<'!'840,($ 0!!!+0!!@3'!$T< @(! ! r0#<>4B"Q1<#$b-<" G#$BG*@*<,4B`2!2 0!#(<4Bb$P!#(4S+08! !1 $"Q<"C<4B 1 $!840,($ '@<'$!'Я($ 0$R+@!<4B!# ` !C+@`!@!p!0!% 1P# 0R!($ '0<'h!'௿0!! G+@0! @!!`!' <'!'د $0H!+@ ! 4 !1 !!. !%0 +@ #"#$ #P!p#$"#$1 0p#(%$&(<' 4B(b$(#0% P!%$&(' *"8 * 1 "8 H! ! '(<'Ѽ!'د $0+@!<&4Ce#"$0bE+@ !e#! (!#$0(!+@ ##  0!! `!'((@! B0B@! D##C!$C<e+@ !  0B@ <G#b!$BE+@<4D!<'H!'Я($ !!!X !(B0B@! D##C!$S<r+@&@0# !(! !720B@!E#$Cr+@   0!(! #R#c!R+@<&0# !(! !  0! # !S#C#<4D !B!($ !'0<'Ό!'د$ <!0! !4C"!  ! @ (! <@4cx !(! 0! 8!BE(!(#  0!B!Q#B$ `!'(<'ͤ!'د !!E#PF0# ! (!# !p##'(<' !'LHp! ' b ,8$DP($b,<$4B& LH$'P<'`!'쯶诵䯴௳ܯدԯЯ x'(!!! !(!$T ! ' !x(! $,'<'H' T'`'l'x0а0$B` !(!0! @8! @ @!@c$@($E<$Eď0' $]؏ $T (! @(!0 $^ $T (! @(!0 $^( $T (! @(!0 $^P 0 $^x @($E<$Eď0 $^ @($E<$Eď0 $^,@D @ 0 $^ 8@*x <@!4 b C*@`4b  0 $_ 0$_@0$_ D@* <@!4 b C*@`4b  0 $_ 0$_0$`, P@ @ 0 $`\ \@ @ 0 $` h@ t@$4 $쏶菵䏴܏؏ԏ`!'<' !'x|xtplhx'!!! !(!$L !$"C*"@$ $ !"$$"9 ! !@(!$  8  !@ 8 $X{$b8@ ! Cb !B 8@j$@ !(! 0! @ !\@ !$@"!(@ !$H 0!$.8Xb$0B@%sB0B@`0B@@ !' 0!3&<$E4,$E菙@ ! 0!d '@$$3 @ !0# +HB!D #$\ $@3!!@ !|xtplh!'<'!'plh@!B0B@&!x' !(! $L" !B 8@!#X$  (!b<$$B#,?b$4B$ $plh`!'x<'$!'(Я̯ȯį x'(!! !!(!$0 ! 'X(!x $L' 0'<'H'T0а$BǸ@ !`(!0!  8! @@!8@% <@!4 b\C*@` 4bY4b 0$`0$` D@&H$ 0<@!4 b3C*@` 4b04b 0$a0$` P@+! <@!4 b C*@4`!b  !0 $a$!0$aD!0$` !Џ̏ȏď'<'0!'8į x'(!!! !(!$  ! '0؏$@ !`(!0!  8! @(!x'8 $L $X00<88$Bad$al$q$8 $k|b쀏` ' @0!0$Fax |$cC!G$X \ $Bb!b0$Ba$]@$*$ 0$a 0!  7$|b3]T@ 'h $ @8!0 $ad $ @8!0$a$ $ $0$  $b_ @($G<$Gď0$$bH $ d'8  ! @$ď$'<'P!'Px!!' (! $쀏 'X '@1  $c !0@8!$bx 0! !(!x$ !'h$(8&< $ !,@$裠hh@ 쀏@ `(! ` ! ! @!$b#0p+$b 8!`$ @$0(! &Rh`(!'h$ 1 p , 0!'h'X !@&<@$0(!0'h$b$   8!u( (!T $@8!$0$  $b 20$Bb!g$b$ $ 4 (!T $@8!$0$  $b菼8 (!T $@8!$0$  $c1@1 !x(! $!@ $쀏@ 'XH (!T$ @!8!0$$c8 $ p 0! $$ $0@$cP  ' @'<'!'Px' !!! !(!$ !'8 !x(! $L'4'X($$X@ !`(!0!  8!@*80<80$B($ct$q$8 $cXV0'9΀ d  !@ !0'9΀  !$'<'d!'X0808$c$8$c $(' (!x$ !l쀏  '8(,  $c !00@(! $c !(!x $'`(6&< $( !,@$裠``@ 쀏8 @(! @ ! ! @!$(b#0(+p+$b)@$ ` 8! &s` !@(! $( (!'` 'P !@&<0(+$b)@$  '` ' @'P$'<'!'tplhd`x' !!!(!$  ! !'X(p '0 4B $@ !`(!0!  8!@@!@ $,@$X ($EX@<$Eď0 $cȏ$tplhd``!'x<'!'x0 '0 $c؏0 $c0 $d( 0 $d\$0 $d(0 $dď,0 $d00 $e,40 $e`80 $e<0 $eȏ@0 $eD0 $f0H0 $fdL0 $fP0 $f̏T0 $gX0 $g4d0 $ghh0 $gl0 $gЏp0 $h$'<'!'௿ $' <'!'௿ $' <'!'@<840x'(!$T!  !'@ !x(! $0' (!x$  ` !'$'$$BeA$c ' '$'('','<'h''lp'o'@ !$( 0! 8!4 l$ $'H !x(! $L$h @$bl $Bl ( l@0! 8!$ $d  ! !0@$H@@ `0!< l$$  8!@<840!'H<'H!  $Ʀ(<'(!  $(<'!'௿ 0$ $İ( &^ $H &^&^0 P$h8 $ƨ菼!' Bb!0!<g!0!& J0!d!<74Byf##Bb#d&"0#0&C##BF#D&f##b#d&0#$0#0&C#!BF#D&f# b#d&0#0#"0&C#F#3F&0B<'x!'௿@/!0$'9p (!@0!B`b!b@!dD `(! bc`C!P' <'!'د  $!0$'9p (! `!B@@!bPcp`!@`q!Q '(<'!'Я($ 04'9p'4 !C`#!p!&` ! $@4C !B`"!Bb`!`!($ '0<'!b\b\`@C`C|`Tx`$E\b\`TPx<'H!'د !P  !  (!@!\! '(<'!'د Y ! bpbp@CCl0Ph$QL$cP ! h  !  \b'(\<'!'௿040 !b@!(!!  !  <4B !' <',!'<840,($ !!Y'UR@S !B,$Dc$b0e'9 @@!8P  1"#DP$c @ !."#$BD@$&B$@d&"<","4# $Rڐ @(!HCDEFG",H CDF G 0Ee$h 0!b0F0D E('9  8!@!0 $h!<840,('@<'!'D@<840,($ (!!!,$R@!txS!'0(!$@ b!$(b(b@$e$b $ b b $b  $I$O$R$S$T0$x$bhHDEF GchB408<@D^H$0b00$biGDEF ciB408<@ID$b0$bi(FDEci(B 408<8@$C+@0$bi?@A&<," HGCDEFCDEFH G" 4C $Sڐ `(!(h,cdefgH CDEF G 0 (!$k 0!(0 0('9 8!(@>!0$k!ts!' !$$' !(@'BEFGB0B$l,O$ bBEFGB0B$l>B+@  !@D!ctD!b!BEFGB0B$lP$bBFGB0B$mPB(! | <=>?@A&<," HGCDEFCDEFH G" 4C $Sڐ `(!(h,cdefgH CDEF G 0 (!$m 0!(0 0('9 8!(@{!0$m!t'S!b! !$$'  (@'BEFGB0B$n0$ bBEFGB0B$ny DECBB+@ !@D!ctD!b!BEFGB0B$nQP$b(!BFGB0B$oTB< p !(00'9 @ !(@P Pp(B @#q "cC+@ !100d$Q ! &od  ! &o(0'9 ` !(8h (P$$chlP"%Qpl !H\ dq  D\h( # 0'`8!$Fo$  $ $   ` !($F!d$B 40G(! 0(C(@!儔< b%($  !(` ! @!(0B$`8! (! ! ( ! @(!BCDEFG=<>?@A"&<( 4,$Wڐ (!(,0DEFG C H   !(' !$$ ' (@T! ` !(0B !`8! (! $(Q?<4B 0DEFGC BFGHDEC" %1XFGHDCE C#@ !T !   ! (Y   !(b bdefgh <=>?@A&<," ibje HFGCDECDEH FG 4C $Wڐ (!(,H CDEF G 0(!$p$ 0!(0 0('9 8!(@!0$pT w0'9 '؏(@@!<m4BPV $Pb4BFGB0B$pBb  (<M4B&<<>@c," b F $Qڐ  (!((,#$%&'H CDEF G 0e $q(0F0D E('9 8!(@0 $h(0'9  !(!@  !(D@<840,($ 'H<'! 0!G"(!0$ '980!0$'9  <'!00!(!'9  !<'`!'د$ @D!ctD!b!#P$b,B@E!C$d$?D=2PPl,$B 0` !Q$q40b !Q$qh0'9 BQ ! BQ 0'9 $B  !0$ '9 '($ '(<'!'Я,($ <4E4P,! ڐ'R@ !  X !(!$ R'$I#*"'()#)"('*(+), *-  P"$#&"(!" 8"",($ !'0<'!'Я,($ 0'9 !@!<24D\<4D-4 ڐ'R@ !  R'$FX#)$*%+&, !"('-(! $  P"$#&" !" 8"",($ !'0<'!'ȯ0,($ 0'9 !@<4BTB*@<$dxT|`bx`\D$|!P\<{4BX(!Ct<4B\)##b $ $3P%  """@!4bZ$80CW0`&&" 4c@%@!`$ 4d &&8@@!$"$ $@ @!$8$ $@@!Ԗ$  4dԖ$  4c0'9  !,!l$"&"&@0!&'$ $8&"1$/8菙P !   " ! `(!b!0c 8!@ !$D`(!G@ !$$䏧`(!0@ ! @! $B*@'`(! @ !,H EFG $ࠐDB !DG?HAc 0&B@!&B!`$$F0! 4c@(@!`$$F0! 4d@@!$ $ $@ @!$$ $@]@!Ԗ$ 4d&B!ԔD 4c@$cC!D @\$cC!D 6B!$"d`$દ$F0!0 4c@Z@!`$$F0! 4d@@!$ $ $@ @!$$ $@@!Ԗ$ 4d&B!D 4c1!!.b&逦b@&0!l T$B"!$'8!0! 0!l$B"!$'8!  ̏t 0!̏t 0!!`!0B,B@0q0q?0B,C`@ !0$D$<*"(@r@(!Bx@ !bP  $@P @0&x &!B&Y8Q B@4&tK     '"#$%&'()*+ , - . / 01'9!&Yx&t     '"#$%&'()*+ , - . / 01'9&!CRd$cCB D$B逦b$B@c` !x`` !0B,C`@ !0$D$^<0B,B@0d0d?@d!$Bb!$b$ $0B %$b#0B@$`E!B0B@40$$|"" @$tT!F$O00 (!@ @!0 $|菼< 4BB(< C%$ 0!` ! b(&08 ! @!0B@(!8!` !$ $@(!` !$ &' @!"x@&0x  !0B@(!䯢8!` ! $@!` ! @(!`," $0@T!B b $" " g$@T!B$0`(!0! "00 ` !0 $} $0 0!," d@T!B $ $"'&$ 0$xx !0cb 0'9  !!0B,C`@ !0$D$<`4D0B,B@0d0d?@d!$Bb!&X8&y &Tx     '"#$%&'()*+ , - . / 01'9!&yK&T     '"#$%&'()*+ , - . / 01'9BC6 !bBcb !,` !0` !<840,($ '9= '@` !<840,($  '@<4B<840,($ '@<'?!0@d!$Bb!d f!@$B ! e$B!$c<'?!0@d!$Bb!!``<'?H!0@d!$Bb!!fe<'?!$C<'>!'د$  !$h $@<@!x(!$ $(!$x&  !(!0!$G`!E $!(C$P$R$%H!c@$D !$`!$!D$# !$ '(bC(!!!86b+@$`!<'=(!!6*@  4䌄C!B!`!<'<!'840,($ !!0!42S!6!2C!B$g0b!*b@$` &bQ$b:&B"Bb2"@B& &E@B0B@0B0b0B@4B4BBb0@!BbB~B}Bbx0@t&&E $@p&s!B0hBbc0EBBb[B0B@BbS0B@’BBBbJ0B@BbA?$b(b@$g06&b02&@BBb*B0B@-!Bb"B00@ BBbBbB0B@! B b B b&!&2*@,!840,($ '@<'8!'د$ D' !0!(!x@! $ `!'(<'8d!4 <'8H!'د 0!$QSl !  ! !  '(<'7!'Я($ !!0!$B4R  @!"$B"0(!'9N\ $ @!$D@`(!!($ '0<'7!'د$ 0!! (!$"4Q` &0'9N\ $ @(!@*$ !'(<'6|!'௿!(!P 0'9N\ $ @@(!!' <'6 !'d`\XTPLHD@|t0x0X(!@' $.@7<4D0,$B~'$ '8@<4D0 $B~0$8$PS! $8@@!x@ !(! $8! $<@@!0'9Sl ` !<4D0$B~?Bx$<@ ! (!$䏙P&$C!P'3 4 54 ! "8>5$ t46 0! b@@ !tb@ !$BbD !B$BC"#CQqd`\XTPLHD@!'h<'3!'Я(@00' '9U 0('0<'3H!'௿<4F!0$B~:<`4F0$B0'9N@ 0'9S  !0!!' <'2!'Я($ <4C!!!0!$B~0'9N @!< !`0!4C0$B,0%4'9O @0! ! @ `(!<4C0$BH B"4C!F !($ `!'0<'1!'ȯ40,($ <!4C!!0!0+$B~04'9O  !0$uN<@4c0$BH! A<@ ! 0$cC#'9S @ !@!@ !<  4C0$B~7b46T!Ff0 0'9Sl 4  !T!B$cB@  ! 8@ !4C!F (!  !6!$B640,($ `!'8<'/t!'د$ <!4C!!0 $B~0'9N <@4c0$B,,"6 !$bB0*$b (!$  '(r#&E$H4C!F((!F 0 !6!$B6$ `!'(<'.(!'lhd`\Xx!!$' 0P(! !'0(!X` ! $2+ O@!` !@!@!0$+ 'P0!` !$"'9U' $( ` !$'T@! @!lhd`\X`!'p<',!'@<840x!!!('(!$ !+ !@! !`!+$ ` !' '(@!`!@<840`!'H<',,!'ȯ404$!(b !+8!@!8!`0!H$+  !''( @ ! !40!'8<'+!'plhd`\Xx' !!0 !(!$ P !'0`(!X@ ! $    0$ +'P0!@ !$$'9U8!"%&'()O @ !$'T@! @!plhd`\X`!'x<'*H!'@<840x'!!!@ !(!$  ($+ !@(!` ! '(@!`!@<840`!'H<')p!'ȯ404$X!h+!''((C@!hlcijk$  !@@!@!40!'8<'(!'Xx' !! !$80x(! !'X@(!X ! $'$$X`(!$' !"w`    !L00!T'x !(!'9U8!P  !(!'|@! @!`!'<''P!'xtplhd`\Xx'!!(! !!P$8 !'$X (!$'` !   ` !DHL(! ! 'P@!!xtplhd`\X`!'<'&8!'xtplhd`\X4'!!!x !!$8(!P@$! '0$X(!$'@ !   @ !DHL(!0!` ! 'P@!`!xtplhd`\X`!'<'%!'|xtplhd`\Xx' !0 !(!0P$ 0'0@(!X ! $$`0! 8! !$O!6 "$ %&(*,0'P'9U  !$'T@! @!|xtplhd`\X`!'<'#!'LHD@<840x'!0 !(!0($bf ! (! !'($`@!6B` hbcg "$ @!!LHD@<840`!'P<'"!'ȯ404$00!(''(HNRbX!($@!5@ IBCH "$ @X!X!40`!'8<'!!'ȯ0 NJ000VR'(Z^`bP+@X!@`H!@X! !`hH+! `P!!@@!笥  0'8<'!$!'Я(B00GH+0JFNR@' P! @@!P!8!@C@+`!@H!`! !gbjc'  ('0<' p!'ȯ0 NJ00VR'(Z^`bP+@X!@`H!@X! !`hH+! `P!!@@!<  0'8<'!'ȯ0 OK000'(SVZ`bH+@! `@!@!!笡KBC  0'8<',!'Я(C00GH+0GJN@' ! @!!`8! '  ('0<'!'ȯ0 OK00'(SVZ`bH+@! `@!@!!p%x%6x%<o&4Bbh$x& p&O&<Dh$n& ,0&dh$& bp&x&B<UUO&4UUEh$x& @p&<N&4Ch$p& x&BO&Eh$ @p&11 $x&b%<$$d%bp%L<4$P  !x$!$Q$"NV8@.6B@ Bx% p%ex%p%x$p$)!90<0B<003BKEB(%8%1)0100c1?U1?B%0%h%1J800 X( `80BCBj%D%(!8!pX!0`!10!d@!p!P!cB %(%(% %h% %0 b0%<$$/0%e%&D%''9&1!'!$ `!'(<'!` <'!'௿,\<4B !' <'!'௿, !' <'X!'௿$! ! @(!!' <'!'௿ ! ! @(!!' !<'!'௿,`<4B !' <'!'௿$ !' <'H!'௿ ! ! @(!!' <'!'௿ ! ! @(!!' !<'!$D!,c `!$B!<'!$D#,c `!$B!<'@!'௿,hX$ !' <'!'௿x !' <'!'௿T! ! @(!!' <'|!'௿ ! ! @(!!' !<'0!'௿,Џ`$ !' <'!'௿x !' <'!'௿! ! @(!!' <'l!'௿ ! ! @(!!' !<' !'`C!'$cC 'c!` ' `!$D &$"&1(b4@ `!x &*4"`&1BH'$BB@8!$ pH!, $1dD !%))&!`8!!BbP!1BB!C@@!ExKJ$ (! $h`'<'!'د$ !B,B4@$4'9 Bx@$BB$B  !'($0$ !$@!1"#!f$B"!0B"!e'(B '(<'!@!$D!C$c(b@!$4'9 $<'8!'௿B@4'9( 4'9, $' <'!'د B@4'9( 4$Q, ! && ! %2 '(<'$!'د$ B@4'9( 4&1$R,@!  ! !@!  !@! % !@! %%$ '(<'X!'د$ !! ! P !&+`$ '(<'!(!C@DB $h<'!'د t' $ '(<'P!'plhd`\XTP< j&4Bb$CP&bX& K&0CcX&BP& <33j&4B33b$CP&bX& <k&4Bb$cX&BP& B<UUj&4BUUb$CP&@bX&x  'BDP%|\ ?BL gX%   $ ($,(8@0,HL40PT84X\<<`d@DhlDtpxHB0& 0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&b0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&B0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX& b0&$0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&(B0&,0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&0b0&40:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&8B0&<0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&@o0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&DX0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&y0&0:p@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&Q0&0:R@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&s0&0:t@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&U0&0:V@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&w0&0:~@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&HL0&0:B@&4-!00E !:C@%0-!F1 !:-!eX&Dc0dX&1 E!:fX&D0-!cX&C!BeX&dX&cX&bX&Ln0&0JLN0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&Hl0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&W0&0:^@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&u0&0:v@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&S0&0:T@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&q0&0:r@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&Y0&0:P@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&Dx0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&@O0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&8b0&<0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&0B0&40:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&(b0&,0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP& B0&$0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&b0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&B0&0:B@&4-!00E !:C@%0-!F1 !:-!eX&Dc0dX&1 E!:fX&D0-!cX&C!BeX&dX&cX&bX&b0& 0Jb@&4!1)E0- !JC@%!1)1 -!GJc!EP&D1)DP&F1 -!JEGP&!1)CP&D-!bFP&EP&DP&BP&  @CP%  @CX% B<UUk&4BUUb$@cX&BP& <j&4Bb$CP&bX& <33k&4B33b$cX&BP& J&0CCP&bX& <k&4Bb$BP&pxlhd`\XTPcX&'xJK<'!'plhd`\XTPx  'BDX%|\L  $$( ?B,(, 00448<<D@t8@DHLPTX\`dhlpHxgP% b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP& $B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&(,b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&04B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&8<b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&@O0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&Dx0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&Y0&0:P@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&q0&0:r@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&S0&0:T@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&u0&0:v@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&W0&0:^@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&Hl0&0:b@&4-!00E !:C@%0-!F1 !:-!EP&Dc0DP&1 E!:DFP&-!0CP&C!EP&BDP&CP&BP&LN0&0JLn0&0:b@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&HL0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&w0&0:~@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&U0&0:V@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&s0&0:t@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&Q0&0:R@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&y0&0:p@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&DX0&0:B@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&@o0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&8<B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&04b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&(,B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX& $b0&0:d@&4-!00E !:C@%0-!F1 !:-!DEP&c01 EDP&!:DFP&-!0CP&C!EP&BDP&CP&BP&B0&0:D@&4-!00E !:C@%0-!F1 !:-!DeX&c01 EdX&!:DfX&-!0cX&C!eX&BdX&cX&bX&b0&0:d@&4-!00E !:C@%0-!F1 !:-!EP&Dc0DP&1 E!:DFP&-!0CP&C!BEP&DP&CP&BP& B0&0JD@&4!1)E0- !JC@%1)!G1 -!Jc!eX&D1)FdX&-!1 JEgX&!1)DcX&-!bfX&eX&dX& @ bX&d%pxlhd`\XTP ( @E%'x<'o!'ȯ40,($ < H&6V$@&"H&I&0C#H&@&<33 H&633U$@&"H&<I&6T$#H&@&<UU BH&61UUQ$@<"H&@&!$! !@ !(!< 0!@ !`(!< $IH BH&Q$@&@"H&I&T$#H&@& H&U$@&"H&I&0C#H&@& H&V$"H&@&IH40,($ '8<'n !'ȯ40,($ < H&6V$@&"H&I&0C#H&@&<33 H&633U$@&"H&<I&6sS$#H&@&<UU BH&6RUUR$@<"H&@&!!(!0! ! !(!< $ !(!< 0!)( BH&R$@&@"H&I&S$#H&@& H&U$@&"H&I&0C#H&@& H&V$"H&@&)(40,($ '8<'l(!'D@<840,($ X\T!!&@$'%% %%1J*EP%"H%4FP%#H%>&`!GP%$H%A$&&&&&&&*B%e%4f%C%>&g%D%HTj&I&' $&* &1"&1 "&1 "&1&) &1"&1 "&1 "&1S&!,$P!`-!L$c C!B\!@&&B%&B%&B%&&b%&b%b%HTj&I&' $* &1"&1 "&1 "&1) &1" &1 "# '  %% % % 1T%ð%,$%İ%6>`!%ǰ%C$&&&b%c%&d%&&&&B%C%&HTD%' 0!TP&* &1"&1 " &1"vH&&1) &1"&1 "&1 "&&&1`!@!M&&&b%c%&d%&&&B%C%&HTD%' 0!&5!TP&,VH&$qL$c@C!B\!@&1 "&1 "&1 "&1)&1 "&1 "&1 "*`!@!'%%%%D@<840,($ 'H<'e!'D@<840,($ `dT!!&@$'%% %%1)*%H%BP%4&H%CP%>&`!'H%DP%B$&&&&&&&*B%e%4f%C%>&g%D%הTX\i&J& ') &1"&1 "&1 "&1* &1"&1 "&1 "&&&1T!&!,$P`-!L$c`C!B\!@&&B%&B%&B%&&b%&b%b%הTX\i&J& ') &1"&1 "&1 "&1* &1" &1 "# '  %% % % 14%ð%,$%İ%6>`!%ǰ%D$&&&&&&&*e%4B%f%>g%C%&PTX\D% '4H&) &1"&1 " &1"VP&&1* &1"&1 "&1 "&&&1`!@!N&&&&&&*e%4B%f%>C%&Pg%TX\D%' &5!,4H&VP&`$QL$cC!B\!@&1 "&1 "&1 "&1*&1 "&1 "&1 ")`!@!'%%%%D@<840,($ 'H<j 4Bg<g4B<?@AB $   TPLHD@<840 'X<<j 4c4Bg<<g4c;4B <<<4cl4Bh,(<A<4ck4B٫40<~<[4c!y4B<8!!ȬD@<<˻4c4B]<6|<b4c4B)* <0p<Y4c4BZ<</4cY94Bج<<g34c 14B&g$ <hX<4c4BJ,(<d< 4c4B. 40<<G4cO4BH<8!!ȬD@<'T!'د   $ ,(40<8!!į̯ȯԯЯܯد䯬௯쯮诱'$BCDEFGHIJK L M N O PQ&Rbcdefghijk l m n o pqT&s'&$? T [@j@% _B Pj0% [@ TjH% _B Pj8%&'&0B?%>2%?0B%>2% i 6h% a6@ym&x%u!q(&L&u@+(&P &qT! &H!e!e@+D!g!H!g +F!D!'&!@ !`0!@`!h!L;[TC4' %b(%j%%I 5GW :B ] p'h%(8%@% H%r0% & $P$ B$ x'+`%3$x$@ &`%Lp$(&+$SX$@(&h%&NP&P&Up!q&8&tH$0&!@$'oX&N!!p+!(!OH& !@+N(! ! !@+i&(!8& !8!@+0& ! !0!@+0!x!+'p!!p!'+!+P@j!ď̏ȏԏЏ(!8!؏+ !3H! !0!+qX!0!@!3+h!@!PP!q+BP!+쏰`!x!`!+p!3!p!!3+!u!u+T!R!<8 40$ ,(  '(<'Nt!'د$ $!!b!4'97 $H#D"@$c,dD! Ȯ#D"@@D%*(@ D$!&`(!(fDH#&Rx !(! 0!(*@4@(!'97  !#D"@&$c,eE!*#D"@ &R%(@ D$!&`(!(fDH#&R$ '(<'L!'lhd`\XTPLHx!p0! ! (!D@&BQYDP%`8!hX!nBh +@0!BP!DP!`!F+$@  g+@%-p! $B/B !%%/B%%E%)p$ %0!$(pH`$!$D(p^!@H`!$(H` !$D(^!@H`!ȏx !(! 0!'H(!x $p $ $?%%,($ D%4Gbt^lzHlX%h%x%,:'H!08@ģ£Ó/ !œ7Ɠ'4Ǐ8'97 ' $ ,(40<88pLHTP\Xd`lhtp|xBCDEFGHIJK L M N O PQ&R V&lhd`\XTPLH'p<'Hp!'د$ $!$P! !L&@ (!@0!$  '(<'G!'د$ !$P! !L&@ (!@0!$  '(<'G!'د$ 8!!,b4@!$(@$!" !4$ (!@0!'9C`$,bd@$<4B4 (!'9C` @0!&44 (!@0!'9C !$ '(!<'F!'TPLHD@<8 !$0 !"#$%&'()*+,-.h/@$$8!Tb' '4 @@!!TPLHD@<8`!'X<'EL!'TPLHD@<8 #h(!h$!"@$ 0$%&'(' )*+,-. (!/8! @@!!TPLHD@<8`!'X<'D,!'د h!0!@8! $ '(<'C!'د h!0!@8! $ '(<'C!'د h!0!@8! $ '(<'CP!,`(! <4B!<'C!'د l8!$ !0! `8! !'(<'B!'د l8! !0! @8! !'(<'Bt!(!l0! <'BP!'د ,<`4C!(!! &$&`@@! &$&`@@!  '( `!'(!<'A!'Я( $l@!$$ !0! `8! (!'0<'A8!'Я( l@!$$ !0! @8! (!'0<'@!(!X0! <'@!'௿,<4B !' <'@d!'௿T !' <'@(!'௿0! ! @(!!' <'?!'௿ ! ! @(!!' !<'?!'௿0<@!,c0!h4B$` !% (Ï!' !<'?,!'௿М!(! @0!!' <'>!'௿М!(! @0!!' <'>!(!0! <'>!(!0! <'>`!'௿<4H00!(,B@ !`$$ (Ï@!!' !<'=!'د ď8!$ !0! `8! !'(<'=!'د ď8! !0! @8! !'('Я($ !!$'! !0! (!'@$Y `(!@'Y @'Y  @!Y  '$($ `!'0<'`!@%'H%A$&&&&&&&*B%e%4f%C%>&g%D%Hh&I&'(! $&(&1"&1"&1"&1&) &1"&1 "&1 "&1&!,$P!`-!L$c C!B\!@&&B%&B%&B%&&b%&b%b%Hh&I&(!' $(&1"&1"&1"&1) &1" &1 #"1U%ð%,$%İ%6>`!%ǰ%B(!&&&b%c%&d%&&&&B%C%&HD%' 0!U@&(&1"&1"&1"vH&&1) &1"&1 "&1 "&&&1`!@!$I&&&b%c%&d%&&&B%C%&HD%' 0!&4!U@&,VH&$qL$c@C!B\!@&1 "&1 "&1 "&1)&1"&1"&1"(@<840,($ 'H<'/`!@!C&*E&G&H!C&"D&E&"   C&"D&E&"  C&"D&E&" $2p!L< < $H`L$ $J`" ' #H!0Eh! f" !($h!E&c0$E0F&D&$C&#E& &d&(&%%"$#%J%)$ C&"D&E&"C&"D&E&"$;< L$H`L$J`"#'H!h!0Bf # !.K$((!b&<0$0Ef&d&$b&"e&% &D&(&" %$#$%$%Jw$ "E&&#,"(%)C&"D&E&"C&"D&E&"$V!L<<$J`L$O`",#J!1Fj! g !% 0$J!D(&8$(&0c(&'(&&(&$ 8&0& &Jh!0BJ@!00cJX!%$j!% '$&($,%$g"0$8$hF&0c$G&%C&H& &(&&#<"0$4%8%) `!<'*!'D@<840,($  H8HC(!` !$%* $`$$C*@$dL$^`H$6;q0BF0H^! @0!RL@!Ky0cVfk00$B`[~! P8!10(0s0!(!L1)1k1^P!p! @@!J !L>H!1~X!2h!21)kLx!!>!$c`1 `8$Ƣ`8!`! Pp%`BP!p! H X h#H!cX!h!H!Cxx!!&!F `(&w`!(&(& !8h!!-w&gl&$h& &HV& &M& &I&l D@<840,($ 'H<''@!'@<840,($  ! \ TF d  k&J& @&z @&Q&U&@&&K0&L N l-H&r $^`L.H&p&2H&t&(C$&!jH&$W`LL{$`%`& v12Rx!%!H! [ QiE!0c p21)h!p! !2E"O!1 Hvh!7H!-O& N&aM&1kI&hX!2h10u`!1J08@^P!0!8!@!S %)' & (& &t&(&q& & &(&l& 0I(&h&20h40lFrT0~@U01C 0LL1%`$ƺ`2x h !F!x!h!18f!8!Tp(2l2+p! H!(! ` X P7H!s`!~X!8^P! )@@!n8!Mw!0& l0&0&(& &O& (& &M&(& &L&ɠ&&H&:H0&0L $Ʈ`1f! !eF!G < < F!H($1C $ &0f! & &(h2b (!F!&IF!$:#$4'J @$($(&1)2(&(& &f!2" !hF!I:,#%'3 @$ $ &F!G11)1((! &F! &f!BH&h f! & 2 ,$& % K$) 8$dG& 1H&D&@<840,($ C0&"'H" # $&<' !'840,($   ! \ TF d k&J& @&z @&Q&@&U&p&t&&K@&L N l-H&r $^`L.H&2H&(C$&j&!$W`LLv{$`$Ʀ`[i0cp1f!p!x!&a1k2R11fX!%!F!vE!2h! 1@ !`!E@!"OQ2g 2ut&1J28^P!!8!q&0 HS0!7H!l&h&- & (&O& &(&N& & &(&M&%I&(&2n40V0' lFr0T0q~@T0 1C2 1 LL1%`$ƪ`x hx!h!( !!2G(!218H!h!8!p ` X PTsp!`!@~X!^P!  H8@!n8!Mw!7H! l)0&(& &O& 0&(& &M&0&(& &L&ը&&&<H@&0L $ƚ`1f! !eF!G < < F!H($1C $ &0(2f! &(! &F!h&IF!$:#$5'J @$2C($(&1) f!(& !h(&&2,:%'4#F! @$ $ I &F!G111)((!F! & &f!B&h f!&,2$3 d% & K$8$ 1G&H&D&C@&" 840,($ "'@# $(<'!'HD@<840,(!!`!$D$!$b(b@$d$b/$~!hL`0!@8!&P &&s&Rr0!n!8!'g!!Db(!$D&(`hL@8!'&P &&s@0!&RUR!pbcdefghijk l m n o qPBCDEFGHIJK L M N O Q!hL&@0! '0F !0B2bE&(! !$@b%(@F!C'0BC @0c& %*@٢&&R&s$HD@<840,('P<'!'d`\XTPLHD@!lx ! $$0b@$!09$b((b@$$b$b$(0!lEL8!8 $DP8&'%(0!leL'8 $dP80!'(!!D$(D&` ,-. &'/!0"1#2$3%4&5'6 ,-./0 1 2 3 4 56%(S  !lh8EL$D@0! '8(! !$@b%(@(!C'0BC0c @ %(!20Bb&D&*`֠&%'$(d`\XTPLHD@'h<'!'%0Bp!x!!!$@ $$@S%b0K m!j%b0KL!0L M!I J !iI!%e0cL!0L M!I0m! (h(!JI!%d0cL!0L M!I0m! 0g0!JI!0BL!0l m!iM!DI!0BjM!B.<(%"(%(%'9&$"$%% 3"$y#$I$-"d (!@$L $cC!B\!@%b0K m!j$L!0L M!IJI!0BiM!B.%b0K m!jL!0L M!IJI!0BiM!B(%'%b0K m!jL!0L M!IJI!0BiM!B(%'%b0K m!jL!0L M!IJI!0BiM!B(%'%b0K m!jL!0L M!IJI!0BiM!B(%'%b0K m!jL!0L M!IJI!0BiM!B(%'%b0K m!jL!0L M!IJI!0BiM!B(%&'p$D$p%f%b0K !%b0KL!0L m!i ((!I!0BM!jB%%dC&0%L!0L m!i 00!I!0BM!jB%%dC&0%L!0L m!i ((!I!0BM!jB%%dC&0%L!0L m!i 00!I!0BM!jB%%dC&0 8L!0L m!i%8!I!0BM!jB%%dC&0%L!0L m!i ((!I!0BM!jB%%dC&0%L!0L m!i !I!0BM!jB%'C&%L!0L m!iI!0BM!jB%C&M%38%b0K !'L!0L m!iI!0BM!jB%C&%%b0K !'L!0L m!iI!0BM!jB%C&~%%b0K !'L!0L m!iI!0BM!jB%C&e%%b0K !'L!0L m!iI!0BM!jB%C&L%%b0K !'L!0L m!iI!0BM!jB%C&3%%b0K !'L!0L m!iI!0BM!jB%C&%%b0K !'L!0L m!iI!0BM!jB%C&Q%  '<'!L$B°$X!!k%k-b@$cP!8!@!$ !B$%kD!J!0J LH!8!"!$$bD!J!0J LH!8!"!$$bD!J!0J LH!8!"!$$b D!J!0J L!8!b da%<'!'Я,($ !!!!`!B !"!E &1$@!&*@$,($ '0<'!'Я,($  !$h!! ! @! !  2!   !(!4$$ 8!x !@!`! &  D @H 4@ L  !4 !!,($ '0!H$<'x!'௿4!! D4@L 4  !$' $,C`$<'! B  $,c!`$B! $<'L!'د ! !(!0*@!"%0! E(!#"p!P#(!"# !'(<'!X 8!@! !b!$ID*@ !$  $b!GECFC !!,($<' !'ȯ40,($ !!#!!t!BH$ TL,t!P$:  !@$B!@(!  !&1@5*`$ B!40,($ '8<'!'Я($ `!!! @ !'$ @ ! "B@$$ !($ `!'0<'x!'<840,($ !!'! C$,$\$< $@;,$D $>@ !@2$$E%\C$/b$"D@$/b$ %d H$ $ $ $=$"$'@MLKJ$ $ $ $ $@ GFEC@$@MLKJ$ $ $ $ $@ GFEC$$@%H"D$ #LC!D$ $ $ $=@ I HGFE$$@$P#$@MLKJ$ $ $ $ $@ GFEC$$P$@MLKJ$ $ $ $ $@ GFEC$$NOd$"H#L$C!D@\$NO $"$'$@Q$EC@K$"H#L$C!E`$b0B,B@$b $"H$B "H$/B  !Ҩ $:@ RҨ ! $:@$B`$b0B,B@$b $ $ !$$ $$ $$"$b!'`$&b,B@$#0# (!#d"\$p#P#"\$`#dt"$b$$#$P0# $"ͮ"\p-$/b)8$'9@  !@!$B"r!b(!0B@#T   ! $@!%X&p  !@%\$#0# "C!@$"P%`  !@!`$d |%r!E!C,b@L$cĐC!B\!@r!E!`!$ b$ b$ b$ b$ $ $ $ &@ FEDC&&` !$ b$ b$ b$ b$ $ $ $ $@ GFEC<$4  !@  !< $d@ !"r!b!$]b < $<@  !, $ $@)$#r!C!G@ `$ b$ b$ b$ b$ $ $ $ $@ GFEC$$@$9"' $ @ !$ $ $ $ $BC` hgfe$B`$#r!C!D #R!C(!#T$   ! $@$ `!"T$B"T!$ 8 `'9@  !@!$Bo"!b(!B0B@#T   ! $@h!$!D!b0B@5$b0c,b@L$cĤC!B\!@0!d!$BHb !D!@ #R!C(!#T$   ! $@!/$"`"r!b(!0B@$$b'#T$   ! $9( $#T&,#4"0 !&%0 @$!$ "$b'"T$B"T$<840,($ `!'@ !XdP\T`$P@$$!`!P<'!'د$  !@.!!)F!b! `b0#$$P@$  E(!@0! !L@'8  !@!$ `!'(<'!'د ! !@0! ! ! (!8 '9D '(<'(!'د !8 !$@0! ! ! (!8 '9D '(<'!'ȯ0,(! ! ! !'8  $ !8'9D  (!0,('8<'0! @8'9D $!!f!<'!'௿ $!0!@ !!$(d@$cb@E!B@$!$ ! !ޠ @!$!' <'!'௿$b!@ t &@@ !'   !<'P!'د$ !!@@ ! @!8$P! &$$! &$!  !! &$@!$ '(!<'!'Я($ !!!@%+D"@#C+@(!0#`! @ !@<&%`! @ !@&&1 &@ !(!0#`! @ !A<4B!($ '0<'|!'د$ (,!!2!@.,8C!D@(!'90  0!,&C!B$! @ !@(!8'90  0!|  h@$ !'(<'\!| <'@!'ȯ40!!8!!(! @0!8 $('9T ,$!40'8<'!'840!!$$!$ @0!8 $('9T ,!840'@<'H!'Я,(!!(!$@  $ $(!,('0<'!'Я,(!$!(!$@   $ $(!,('0<'D!'ȯ40!!8!!(! @0!8 $('9T ,$!40'8<'!'ȯ40!!$$!$ `0!8( $'9T ,$!40'8<'P!<@! 4B$x$ <' !'د$ !<!4D(!! $b &@0!\@8!  (!0 !$ !'(<'\!'௿!<4D$b  &( @(! !!' <'! <'!'د$ !<4D!!$b(! @(! @0! !  @! !$ !'(<'!'HD@<8x'!! !$ ! (!$ !@(!8!b$,$b$ $8$B8$B( HD@<8'P<'<!'840,($ $!!Pb!!$! !, !$@! $&@*`L !$@! $菼@@0!8de&T  8!@@!<A4Bp?@4$,B&T$ !C-$@!  8!@@0!!ED  !$L@$@! @0!@ 8!!E D  !$4@ $@! @<@@!8d$e($P! @8!de  @1 !,$@! $菼@T@0!8de $PT!  8!@@!L !$@! $쏼@A@0!d$e(!  8!@ @!4 !$@! $A<C4C`A, !$@! $O@#@0!8e d'9T  8!,L !$ $@@0!8ed'9T  8!@@!< !$@! $ߐA<4C !@ @!`(!0!@8! $@@!!840,($ `!'@<'!'ȯ40,($ !!!+!) ! (!0! @8!@<#$b0 &@0! `8!@< (!0!@8! $4B!40,($ '8<'!'௿8!8$ƚ <@4c!`!' <'! ! 쌂  + ! <'D!L$B<',! B`<' !'௿ !@ !(!$  8! b`$C !<4D!' !  $Ԍ<'d! $ ! ! ! ! ! <' ! <'!'د$  !!!@@ ! @!8  (! @ !B +$ #'( ! !e% ('!e$ <' !  $ <'! $ <'!'د 8! !@ ! (!@!" @@ ! 0 !'(<'@! h <' !'௿ $ +#' <'!'௿x $ +#' <'ܠ!'௿h  @ !@@!@bb @ ' <'4!'د$ ŀ'! @ @(!͌  ! !ŀ'   !`  &  & 쏙 ( & @  !$ !'(<'!'د$ !!@@ ! @!8  (! @ !B+$ #'(<'t!'د$ !!@@ ! @!8  (! @ !B+$ #'(<'!'د ! $@@! + @!+  #'(<'@!'௿!C!CD,b@;<L$cC!B\!@0-*'$p!ƌǀH0  T 44B @&*@8 @!<4C@!`!' <'װ!L $@<'א!'د 8! !(! @ !" !'(<'(!h <'!'د !!  C#  p t x | !'(<'|! (!<'`!'د  !@ !@ &ČBY  F! d !Q! !'(!`` !bY <'Ր!'د !!@ @ !BY @!@  !@!@0!L ! $X! $ '(!`` !bY  <'԰!L$B|<'Ԙ! B@<'x!'௿ !@ !(!$ 8! b@$C !<4D!' <'!'د ! ! @ !@ PQ$cPC '(<'p!'Я($ !!p& ! CC!BB0B@$,"$;"$=" !$""$<&B@`@!Q^$\$"D@&&@QCM"$(&C`D@!$>bA$\$>D@&&@4C0"$\$)D@&&@C&!  Bb!bB0B@$,"$;"$="&&@&p@!($ '0<'!'Я($ !!p`$,b$;b$,$;&@DC&&`!$"b$<&B@_@!C]$\$"D@&&@PCLb$(&C`C@!$>b@$\$>D@&&@3C/b$\$)D@&&@C&! $,"$; Bb!bB0B@$;"&&@&p@!($ '0<'h!'Я($ !!\$h !@@ !B@O$L $Ō@F@!,@ ! $:@!@&@  !R+@` !X(! @0!$:, ! $/@@!  !R+@   !R+@$/X` !(! @0!$/"  !R+@!X` !(! @0!!($ '0<'̨!'௿$0!$ '8@ ! @ ! '@!`!' <'0!'௿h+ @&@ !LB@!$Ō $D,@$/ 8@@! @ !(! @ !($㠏 ' !' <'L!'@<840u$Ph @n@!B@k`!<\ !$ $@$L ! $Ō@X$PV !, $/@@!  !!$QҨ ! $:@A@!Q+@?`!x'@ !(! $  !, $/@@!@ @ !,B @$/X&@ ! $ @ !'( $ @!$/" @ !,B @`!X&@ ! $ @ !'( $ @!`!@<840'H<' !'௿ ,B$B' <'!'௿8!<0!$P $,B$B' <'Ȕ!| <'x! <'\!'௿(!L$$Ő 8! bt$C !<4D!' <'!'௿(!L$@ $Ŝ bp$C !<4D!' <'Lj! Bt<'h! Bp!<'8!'௿!@ @ !BY @  !@!@0!L+ ! $#' !<'Ƙ!'<840,($ !@${!`!! !B@kB@g&Px !(! $! X !&B$D $.$ !' $@!BTx$`  !BxC!B(! $`$B`f$B@ $c$ b$ b$B$$B  $ B@@ beb$ $$$b$$$C &&1 &s#C!C $b B@$%!$B@ C `q*@ !`!D`(!Y 0!@!BP#`hBp!i0#`gB@c$@!<840,($ `!'@<'Ô!L$B<'|! B<'\!'௿8'9< !@ !(!$ 8! b$C !<4D!' <'!'د$ (! ! @ !@!$Dx(!@$8'9<  @ !! $B  !$ '($4b0b!0B$4b0b!0B!!<'X!'௿!Y @  !@!@0!L+ ! $#' !<'!'840,($ !!!${B@$ !SB q$ @/$"$$  ! !$ @! @ !D@0!Y (!@b@!D,$Y $菼@V@!B $BB C $bS癩d @!@H$h @ ! !h @! @ !D@0!Y (!@+@!D,$Y $菼@@!DL$Y $H@@!D'Y $@@!  !$``!$B !D(!0!Y 840,($ '@<'!L$BT<'! B<'!'௿8'9 !@ !(!$ 8! b$C !<4D!' <' !'د$ ! ! @ !@@!8'9  @ ! $B`@ !(!$  '(<'@!'د$ h !'  !@@(! $ !'(<'!'Я,($ h! ! !& `L ! $d@$B tC 4BB t '@@!,($ '0<'!'د$ h! !' h@@ !  $ !'(<'x!'Я($ h! !' $q @!@ !L@$p  !̏L !@$l$`!  ! !@$ ($ !'0<'!'@<840,($ ! @ !@!&V &U !@!D @!Ў   !h  ! '@!@@!~& `< ! $Ԁ@ $< ! $Ԉ@d$` @@! !  !X$癩  !h @! ! @(! !< (!@ ! (!(  !,  !  !  ! !  (! !H `(!$bx  !  !!  !!@<840,($ 'H<'t!'840,($ h! !' ' @!8 @!@ ! (!8 @!@ ! (!8 @! @ !K@!@GE (!@͌ @(!@0 @@!   !@ @ !` ` !/$QR@ ! `(!` ` !( (!@$!   !@ @ !`! ` !!840,($ `!'@<'!'௿L8$x $\@!L@)$Ƅ @!Ll@ $Ƙ @!L@$Ƥ @!L @$ƴ @!Lp@$ @!`!' Y <'!'௿!Y @  !@!@0!L+ ! $#' Y  <'!'@<840!!!@\${`S(b@$$b%$ L `L'$$L'$$t `8! 'D@0!Y 'B@0@!$ ($ )$B*Q`  !"(!Y `0!'(  !# !(!y @0!D$BY B@@!B @!S!B @<840`!'H<' !L$B<'! B<'!'௿8'9۰ !@ !(!$  8! b$C !<4D!' <'`!'د$ ! ! @ !@@!8'9۰  @ !! $B!$ '(<'!'௿h !(! @ !,B' <'4!'د \! ! &$ (!x @0!@!$ `!'(<'!8 ܏ $@<'! ܏ݬ (!<'t! ܏ݬ$B @(!<'L!'840,($ h! !! '' @!@!@B@ & b!B@ !&  p!@!  !@!"+@ 0!`0!t(!  !@g. @dL$cǐC!B\!@8 @ ! @(!Nb8 @ ! @(!Ab $>b8 @ ! @(!1b @ !*b8 @ ! @(!b8 @ ! @(!b $ b$8 @ ! @(!b( &$B b!B x '@X840,($ '@<'0! B<'!'௿(!L$,$\ 8! b$C !<4D!' <'!'௿ @ ! ' <'`!'د$ L!!$Rh @0! ! @(! @0! ! @(! @0! ! @(!  @0! ! @(!  @0! ! @(! @0! ! @(!  @0! ! @(! ( @0! ! @(!(  !@(! !@0! @! !$ '(<'!'د !$  @!  !$@! `!'(<'0!<Q4B'ÌeCD#,b@#L$cC!B\!@$7,@ $ȏL$cC!B\!@$$ʬ$$$$$,@$ȏL$c$C!B\!@X$V$T$$0P$N$$$o,@H$pL$c@C!B\!@=$o;$n9$m7$l5$k3$j1$i/$h-$g+$f)$e'$d%$c#$b!$a$`$_$^$]$ ,@$ L$cȌC!B\!@ $ $ $$$ #$<'!'ȯ40,($ ,t!$!$$$ $R @$&") '"!@!@ !' $ @!$D$(! $ @!&,Bb@ $'8"'9  !o$`@ !*e@ $ȏ ' @ !x"@ ! $x $$ @ ! ' @ !",$ 0   !@, ! $ @@$<Q4B$CC#P"C$d$$db$b(!$$!%⤎%   !8'9  !0!40,($ `!'8<'!'Я,($ !!!(!@.!,$$b$!b$" $$cF$ $ b  b$  & b(d@ 8P(#'9  !@@(!"@&s!@&PP#C! $`(!Y 0!@(!,($ !'0Y <'L!'د !!@ @ !BY @!${ ${@  !@!$ `!'(<'!'௿!@ @ !BY  @  !$' <'8!L$B<' !'௿(! !@(! !@ @ Y +$B' <'|! BP<'\!'௿8'9 !@ !(!$ 8! bP$C !<4D!' <'!'Я($ ˜! !Q @ !@!@&# 8'9  @ ! ! $B``$" !($ '0<'!'௿((! !@(! !@ @ Y   !@@(! @ Y +$B' <'!'<840,($ !!$ $$ $ $$ $$$@$$B$Y $ R!@!$$BB$C,b@L$cȤC!B\!@$8'9  !@l$8'9  !@$$&!Y @@!$B$$Y @!${bB!`@$B$$8$Y  !@@!Y  !@!@%@!8'9  !@$$B !$" # $C#" "(!0#4 $@@!" x&$S!(!$ "  & &0Y ! (!&@!" &(! !F0# $$b2<Q$4BbCC#$B,B@$$CY @F ! @(!8'9  !@$B  !@5$3B`${b!$c&b,B@&$$b#$"C  !@  !@&$Y @@!$Y @@! Y @w@!$vp$Y @i@!$Y @^@! !@(! 8'9  !@O$Y @D@!8'9  !@<$`!$8B$Y @+@!$Y @ @!  Y @@! ! (! ! @(!$v@|$<840,($ `!'@'د !!@@ !BY @!@ " @ @ !BY  !" !@ @ !BY @@! `!'(<'! B<'!'௿Ќ ,B' <'!'د$ ! ! @ !\@ @!Q R(!x @0!@!$$ `!'(<'!܏8(!D $<'!'௿(!L$$ 8! b$C !<4D!' <'P!'(Я̯ȯį! 'x !@8!L$ $̏' '@8!$L ! $ԏ '  !(!', @0!$'(, $  !@0! (!, '@ !$ '` !@(!, $Џ̏ȏď'<'!'0̯ȯį' ! !'hh( '菼@!'x '@ ! (!,@0! 'H&$,  !h  @! ! (!, @0!&$,  ! h   @! !@0!,  (!(!$ ` !`(!$, ' @ !C!P  !(!@ !, @0!&$, @ !0h 0 @!(!@0!, @ !@(!$  !(!$,  !  ! ' !@0!, '&$,  !h  @! !(!, @0!@C,&$  !&$  !(! !,@0! &4&$,  !  !(! !, @0!&$,  !h  @! !(!, @0!,&$  !  ! !(!, @0!Џ$ (!Џ̏ȏď'<'!'ȯ40,($ !h!! !$ h @!@(!<`8! ! $Ʋ!40,($ '8<'!'Я,(`!(! '&@(!, $,('0<'!'د$ 0!!$ ' '&'”@(! $$ '( $B ! <'!'د$ x!(!! ! !(!L@8! $ !$ '(<'! $$ $ <'! $4<'d!'د 8! !(! @ !" +$b'(<'!'@<840,(! !$ !$P'(! @!!!@$x0!@ !(! (!X  0! ''  '  @!$@ !L $䏼@ !$@8 $ @ !BL $쏼@0 !$@}B@y '$@!$<$Q  (!@  !  (!@8$ B@ !  (!RBe$L $@0 !$FDh $@!  ! !(!\ @0!@-(! !@ !(!$( 8! b $C !<4D!' <'L$!'د$ ! ! @ !@@!8'9>  @ ! !# $c $B0 !$ '(<'KP!'8!!!!$=`' !$$B`A$cBp!d2E$8 %d @!'༯(!&D0! 8!@8 <bQ#4cMChÏX@ !(!0!8!b#@# h`$'<'I!'D@<840,($ +`H!!!@!#$Q!!@!&R@!$ b&&"B*H'\@ $8'9@ @@!$$@!q* !L $D@ q*L ! $L@q*@!!<4C($BX@ ! <4C($B<4C($BLD@<840,($ `!'H<'H!'د$ !!!!!",@ !@@(! @&1&1  !!$P&+,@@ ! @ !$ '(<'GD!'Я,($ x'!(! ! $ !$X (! $P !,8'9C $菼@(!$<\@! $(@6!,& ! $: !$/, @! @!@Q+@`! $:#b2C&0!!@E!$R#(B@2C C C!B !0B@&2C,($ `!'0<'E!'ȯ0,($ x'!! !(!! $ (!$X  ! !,8'9C $菼@(!$<\$Q $( !$:,@%!  !$/, @! !@P+`@! &cC+P (!@ !@! @!0,($ `!'8<'D<!'د$ !! ! < R+@ !<(4B< $,@$D !, $/@@!x !@0! (! !(!X &F !($b㠐Bc㠢"#!$ '(<'C !'ȯ0,($ !!!!8P(!00#` !'9@ 'A$@!*@!0,($ '8<'Bx!'0ȯį!!!!H@'>'  !$$B`A$cBq!d2$8 %d @!'༯ 0!&(! 8!@8 <bR#4cMCÏd !`(!0!8!b#@# @#$b!ȏď'<'@!'ȯ0 $'(8H('9A询 $ 0'8<'@!'ȯ0 H8('(L8!'9A  0'8<'@0!'Я,($ 4!&%O !S`!,` ! $/@!@)` !Ҩ $/@@!&%O @ !&C&P# ` !$Q ` !@!X`(! !  0!!@,($ '0<'>!'@!!' $$LR$T $/4  !,  !4 ' !| '(!LR $|E( L $ͤ'<'=!'XҨ$/ !P#'$q (! 0!@@ ! Q!@0ͨ' $ '8'9L $'<'=!'8Ҩ$/ !@ $R# &' !@(! 0!0! 0ͨ' $ '| '$C.@0!b B\(*@ BX*@L$̏ BT*@ BP*@L$ $ L$4' 8`(!'9L ''<';d!'د$ !! ! ! 0! $@! ! 0!A$ @!<`4BC!$ '(<':! $<':!'X(!$ !@! '!* (!@ !@0!$ b$ b @ !'0! @!0!@ !' $@!'x$ @@0!D @ !| !'<'9x!'ȯ0,($ !!!2!(! $@!!Q#. !@'$ 0! !'0!P 0! @2Q#! !`(! 0!S $ !(! @0!R!$0,($ `!'8<'8H!'د ! ! ! ! (! @0! '(<'7!'௿$ $@ !D@! $`!' <'7!'ȯ40,($ ! !(!@!L $t ! '$CL (! $΄Sh 'h8' R #d !(!@=R*`1 ' (!P@) !   !"!C($/ͨ$b ! ͨ`(!  !  !(!L$Μ h' `(!$C'䏤 40,($ '8<'5!'د <4F!"!4 @!$b$b  !  !4 (!@!<4F$b ! 0! !'(<'4!'ȯ0,($ !0! ! $@!!@ $  ! $A"@!D  !<Q4BD  !D @ !  !  !8$䏙  ! (P$ u @  !' $&s@!@ !'@@0!D  !D @ !| !0,($ '8<'2!'0̯ȯį|!!B!@^$ "`A'( $$C@(!L$ά"`C bA'( $X$C @(!L$ . !bC8` !'9K '' '$C !bCcC $#`C.cC !.̏ȏď!'<'0!'88'0!'9K(!! ! !| '$C8!"b$$bd#EF!'<'0 !'<840' !'$'(', !@!$ !B*@$  !'$'( ',@$B*!<840`!'@<'/@!'D@<8!$ $@!@ !<' 4C  !D @!<4C$(!BD@<8`!'H<'.! D\ EX FT GP!'௿!$c@C!D!Y @(!$c@C!P !e+@e0#`(!!' D$$$BA$ $<'-!'د 0!L'$ $ '(<'-4! <'-!x  !<',!א  <',!'ȯ0,($ !!@C!D!Q! 7!  $L@! !(@(!((!$ $$C$&%%@b!t!bL$Bb$"&$$"$ &$q"( @ H  < D$ $8@}$#@`$"DC0#*@ `#(! ` !$ @0!"@R@ !` #(!` ! $"D#@C#b!#@"D @C#B#"@R !@O"<@"@&0 !(! $"@0"<$B"<&0 ! (!@ "H  !"@$""$&%b0#F*# @&D@ %` ` ! @0!"@ !R!"@`  ` !"Db!"D#H`B#@ #$" #0,($ !'8<')!'௿D !!`! ' (! $!' D@C!D!Y <'(!0! (!<'(!'Я($ !$$@$!D@$ &Rb$ 9C@ !@ c$"DR*@& T$ `!($ `!'0<''!'HD@<840,(Lx!B'!4(!! $ $W $@ !, @!@!T  !B@T  !@8!',(`$A $X'8 !(! $d !Lͨ $2@ B !$ $@@!@HB0B@  !$ $@@!@Ha0B@@ ' (!@@!$BHa0B@@ ' '8@@!$BHa0B@#@B@' &'0$GHL !$$d  (!@@!$BHaB0B@$@B@' &'0$GHL'8$ !$d  (!@@!$BHa}2@D@  (!@@!$BHad2"@D@  '8@@!$BHaK2@ D (!@@!$BHa=2"@ D '8@@!$BHa/2@D@  (!@@!$BHa2@D@  '8@@!$BH@D`S| @ ! @אB xB$b'(CD@C!(c@ !' R8!`$<4B  $@ !(!b$'  $ $b' @ ! $@ !'1 $@ !'( $@ !'  $@ !'  $10B@ $ @ !'  $ @10B@ $ @ !'  $ @DDE$@D!א4R!CDDE $L@!BD@b!<r!4BB@b Qq&""$"ȏL"$ &#&0#$ !$8"( @ H  < D$"$x"$" ! (!@@* (! ! $@ !'0@"$ $0b$DDC$4c@D!CR!C@DDb 40( @ !$` !(! 0!| @ !@`!HD@<840,('P<'!0 $<'l!'8  '8'@<'0!'840,($ ,!$= !@T#  !@!&"# S*"@(!0\ ! @0!@!$=b&1S*@ !!840,($ '@<'!'د 8''9m  '(<'!'د$ !B4"!D E*@B"!b@ d&*d@$c$ '(<'!'@<8!!:0, $=@ @!P(#,#,B@,!#$,8!$E$Ɣ4 ''8$Pm! '0@80'9o  '! '0@80'9o @<8'H<'!8'9o (!<'!'PLHD@<840X!(!  ! !$$, !@!@x!t$C$$b${A&Rb?&D, $}@!R+@'x !(! $# !X&& &E !8'9n &5@@!0$SH` ! & !@! $5 # !$(! $F@ !`(!   0!,@ ! $$@@!C${b&R@!,@ ! $$@@!C$P$$b  ! $@ !(!$F !!!PLHD@<840'X<'0!'௿ ௠!! !@!@$  !8'9q  !$8' '9q  $@!$b$8 !'9o $ !8'9m '@ s!8'9o @)!!C@ !`$b&@` !"&2D $ '@ $ % 0$4  "D$2$ʬ $@$ !cC!@+$  !`$C$CDC!(E(! &D@$C!D`&EL$F04$Fp܏<$BH 8!! `!' <'H!0!E 8!D *e!$Bg!<'!'쯲诱䯰௼!!􏙛!(!0!H! '$ 8!,' $Ɣ48$Pn! '@(!'@$ $'@(!8'9q  $ԏ'$ꏆ4@8! $Kԏ !@(! 0!!  ! !@(!@0! $$ `!쏲菱䏰'<'L!'௿ 􏙛(!0!!0!d & 8!$ꏆ,' $Ɣ48$Pn! '$@  !d  !@(! $ ! d$ @!@! ' <'$!'د$ 􏙛(!0!!!D 8'9n  !D$@@!0$PH !$ '(<'t!'د$ 􏙛!D(! 0!' !x(! $ ! (!X$ $ !, $=@(! !$B@$!8'9s  0!@!D$ !$ '(<'h!'Я($ 􏙛!d!!(! 0!@ !(!8'9s  0!d$ @!!($ '0<'!'د 􏙛!$(! 0!8'9q  !$$  !'(<'4!'௿P@$_Ŝb &' <'!'د 􏙛!$(! 0!8'9v  !$$ @!! '(<' !'Я($ $(! 0! C8p $Yo$B@ ! 8'9v '@$$ ($ '0<' X!,$z$ 0!<' 0!'ȯ0,($ <UU4BUV!!!C#@!T!#$S$Sx !(! 0! h!f*@c!@+$ "p&Rb!b"#p0B0D!C!B"#p0B<D!C!B"p&10B?b!b@&$ $1 "pb!b"#p0B0D!C!B"p0B<b!c$= #$=pC!B"p0B0b!b&$0,($ '8<' !'840,($ !! ! !x(!@! !!-! ! 3!  !Rp @(!"#! %b!L@(!  !@ !@(!$ $ !C$g*f$=b a`!&bb#*@$#u !@!$# !a`!&c@C!@!T!$CC+@a !`^ ! !@@!@V8! !!C$ bL$ bJ$f0,B@(! .$b,B@$b$b,B @$+$b. .b$/$>b$=$?b2!$b&(b@$` $b$b$0cb% 0cb%0?C%$$!$*@!$840,($ !'@<'!0(C  +,c$Bd$`!B B<'H!0(C  +,c$Bd$`!B B<'!0 C $B`!B B<'!$C<'!@<'l!'د$  !$C #$D0!L$ $ȏ3$$ $M$D,$ $$ '($$(!$M$D$M$DL$$ $$B(#$AL0!$ $$ '($ '(<'<!'Я($ (!! !(!! !R! "S!"($ '0<'!##@0!C%@`8! <'d!'د $  !L$$ & 0!L $$ '( '(<'!'d`\XTPLHD@L$!x| !@!$(,0@4L$U&8ȯ !&<@!!v!(b@$($`B@ $$(@$`$ (P!bPg!V!P(@!Q!@  !&& $g,8,@, 8c$`, $BE4 $Kԏ2!* @4` $4 $Kԏ$4!* @$0d 8$B E0 $ce4 $Kԏ* @!P,(! $$B<&1&R*@s&s 8$B b*@eװ!, 4$BE $Kԏ0` d$4`\XTPLHD@$K 'h W!C!נ@d`\XTPLHD@'h<'!'௿$|(!` 0!b @$8!d g!' <'|!'௿!$`$@(!b@@ ! ($  !!' <'!'د$ !!$1bM$$8H$F$ @@( "$@|"$9 $($ $@!"`.$`A` $b #&B,B@  !$0 @(!$F0  !@  !$  !!$ '(<'`!8!0! $<'@!'د$ T!@Q$@M$$!G 0!$,b@>L$cрC!B\!@$$Bd$c$0@!L $B$Bb+` L$B,$&$ $$$Bf$c<B4B" !#BC!@b#@!L$B@B0B@$$ 0!$$Bb$c$@!b` 0!$c$B$b!$@!b` 0!$c$B$b!$@!b 0!$$Bd$cD!$$db0L$$BX$  0! (!@!$"$ b5` $@!"-(!|$ @!b @$$ !bb$$Bb$c$ @!b`$c$B$b!$ @!b`$c$B$b!$ @!b$$Bd$cD!b @!L$Bh$$ ì$ $$$$ !'(<'!'Я($ !!$!%!`!$cb$ C0$C$DE0ES@$pp#"! (! 0!C$8!b($ !'0<'!'د$ !`<$b$ Dd`F2$GE,@@!L$ $IѸ!Bb$`D # !$,$@!B#EC!B$F$ PQ @ !C$bPQ!$ `!'(<'l! <@@ ! $<' !'XTP!L$$'(8< $8@!'$ @!$' !$, "XTP'`<'P!L$B<'8!$D#C!B<' ! ! (!<'!4  !H!X!D0[$X<4Lq-b@`P!$ )BjX#@5"#$8!"@!8!#@!8!$@!8!"@!8!#@!8!$@!8!" @!8!# @!8!$ @!% 8!@!& 8!"@!8!@!#8!@!8!@!8!@!%J8!)B@!%)@%J"%)8!@! C#C!8# #D#D!`@#G%<'@!'د !!<$B,B@$( 9$ $<b (! (8 !(!0! 0 4 <"0 '(<'\!'Я($ !9 (!!$@ $@!$$+!$(9  $@0!$(@$9  R! (!| !0!@($($9$ $(9$ (!!,8 !($ '0<'8!'tplhd`\XTP(40!+ @>!w#>$V2 #b!$ "L3$BҰ2 #b!374 !(!2 #b!3742 #b! !(!$374,W##,b @jL$c|C!B\!@.b@ 2P'&b&s.cB%`2P2BB$d"`$b!$b!&s2pp#L\'0'4'8'< (0408< (@"&s$&s"2 #b!$ "L&s3$BЮ !(!$74.b @ '}'&b&s.c B%`'2BbT#!!`$"@$ !$b4$,#0"(b @!C+@#w#$V#74 ! (!74#0(+@w#$V",W#$, "(b@!C+@#w#$V0+@!+@!  !(! 0!"(!P##!а#@6""@$!/#.b@ 2E '&b&s.cB%`2E2P?,@0B0C,b@2 #b!$ "L3a$B䎙 ((!$ $(@" $"&s "#$Bb+`#L$F0.b@ '&b&s.cB%`#$ 2EF!B$cD!E"#$Bb+`&s%,@L$B0b0!# $C!,@(!$`$$ '$H$"&% &&(@ % $( $(z$ x"$" 0$B0c2C!$B +x'@0p+@ s'&b&sp+B%``#H!BB$b!ep,@ $"$ p#d!$BeЮ"$$$$ $ !d+@ F'&b&sd+B%`H!p#D0g#D $B'0c2C!0!$B!C+@$$(%  2 (#b!$ "L3$B !# C!D# $C!D$'& #$'D)B'H2$0$ $ $'LL@ $(%  @!($62 #b! !(!0!3p740L@DH (@$"#2 3 #b!74 ! (!$(b<$(! 74#0(+2 3@w#$V",W#"@$ "74 ! (!74"0(W|$"2 #b! !(!$3742 #b!3ꮕ2 #b!374 !(!$ (tplhd`\XTP'x<'!'د |!! 0!(%($ (%$$ ($  (! !'(<'!'د ! ( !( Q!04'(8B,B'Я($ @!!D(Y !$$ !@PRSQ@($ '0<' !'@<840,($ 40!+ @!h#$I,HH#C,b @L$c`C!B\!@-"@,. @* "##b!564#FDEG̯ 40@0!+56 @h#$I,HH#$$$ ŮCBCB $CBG g+@ &&b&sg+%`0!`DC!B$ !b#T$BC0B@0B$BC8B0B@^B0B@$B" ##b!$ BL5^$B$Gg+@ f&&b&sg+%`0!`DC!BCE$ !$Dg#C EBG g+@ G&&b&sg+%`0!`DC!B$ !0Bc#@t0B$B6C 8B0B@E !*B" ##b!$ BL5$B@" ! (!$6#4Gg+@ &" ##b!5#4a &b&sg+%`0!`D C!Bg#$ !$D B(D (#+@#,#b#B@ A,0(b @@!C+@H#h#$I 04 !  (!40@0!+@h#$I,HH#, (b@@!C+@H#h#$I " ##b!56#4 ! (!&%),%0!(B$BB 3,0(b @@!C+@H#h#$I "4 !  (!40@0!+@h#$I,HH#, (b@@!C+@H#h#$I B%)0!%W@.b@&s&&4 !  (!@0!40H$B" ##b! ! (!$56#4" ##b!5" ##b!56#4 ! (!$@<840,($  'H!$( @(!<'!'  40$!+ !! @! #$E,M(#` !b!q-b@ $%%b%k-c``%$bH!(`$bP!8B0c0BdX#`t``1F!B$hX#$-cP! `` $%%b%k-c`%BH!($F!8B0c0BdX#`<`1h+@ %%b%kh+``%`(C!B# #$bH!+hX# `@ (##b$c%Jb%$c%,$@# +@ h#HP#b%$c%(b%J$c@%S,@ #"$#H!"H!L (OP#$c@+@0.P!@B#B$#H!u"H!"#$bX#L`,%0B@ (oP#+@P! p##  !cX#x!$LoP#+$B$`P! p##  !cX#x!$  4,@- @0-b (OP#+@P! p##  !cX#x!  4! ''!쯴诲௱ܯ!   $(,048<@D'X!`P!c%J%ke!b$B@bS$ !@$b@$c%)-"@ +@ ! !$ $'@x(!$d  !p($b` !$B b(p (p` p($ L$B$$ $$$$x$ $d ! ( @ !( ! #SP+  !(@+'@x(!$d  !(p` $(pL$B$ $$$$ $d ! ( @ !( ! #$P+<'9  !(@%'@x !(! $d(p$dL$$h  !(@ ! $( ! #P+(@ (!ͨ @ !(<'9h  !(@+pB@%'x !(! $@(p$@L$$  !(@ ! $( ! #P+(@ (!ͨ @ !(x' !(! $@(B@$@< !$,0 !$N $( @ !( ! #P+(@@ !ͨ  (!(<&9(  !( @0!(@ LL$BpF D$܄$BtE$ܼ ( (@(! $($#3Lo$ԏ<'9p ( !$' ( ! @0!( !(!x@7$ $(  !( !0# (!(@ ! ( !P&9(LL$D$' $(<  !#.(`j !(!' &1( !  !( ! @0!(@ LL$BpF D$$BtE$ܼ ( (@(! $($#3L$ x !(! $('P0!$  ! !  !( ! @0!(@P LL$BpF D$$BtE$ܼ ( (@(! $($#3L$4(! '&9(  !( ! @0!(@ L$p$BtLDE$$ܼ ( (@(! $($#3L$H<'9(  !(@ |D (@<,X$C !$0! ' @!,(C`<44 L$p$Bt4DE$\ $p܏( !(@(! $($#3L"$ݔ%(b@# L$p$Bt4DE$ݨ $p܏( !(@(! $($#3L$ (-<<4b4b'!$! L$p$BtLDE$$ܼ ( (@(! $($#3L$ (<4R<4bB4b<'9(  !( !<'9 @0!(B. L$p$Bt4DE$( $p܏( (@(! $($#3L $@(<'9(  !( !<@0! '9<<@<&9(  ! !@0!& (@@! D$p$Bt4E $p܏( (@(! $($#3L $T(<'9(  !(<'9 @0!($0 ! $H&9(  !@0!&  !(! $       ' (<'!'Я($ ! !@@!xq! &1B2 *b!b($ '0<' !'TPLHD@<840o'(!!!! $!!$$B`A$ce' Bb!d0$ %h0*d(i, $ be'h` !'  $@!$oZB!V0!8! $ $d'((!$0! 8!@ @!Xd' $ 8!@! $ C$~b*$&$ $$o ! C$ b$#!B+@$ D&R$BU*`$ b@!TPLHD@<840'X<'x!'HD@<840c(!@!!!@'( @!$ot$o!o(' `!$$B`A$c$ Bs!d0 %d$'`0!8! $ $' $(!0! 8!@! @$`@(!$<X 0! 8!A @! C$~b$ # B#  C$ b !0#P!P!  '#@$(HD@<840'P<'!'LHD@<840,(`dho!!!\ ! !(!& ' @@! @(C`$I<f!<@4PB@B@ b!b !@@(! @B @!QB&1"*@E!C @>\` (B@7 ! 0#(!$ ! ' @!$< (B4B!@! ! 0#(!$ ! ' @!$b<!`!LHD@<840,('P<'!'D@<840,([!!@!!@"! @!$ꏼ*@$$o`!q`!m<i4S<f4S<c4Sb4B`!'!$$B`A$c' $Bu!d0 %d $0!8!'  $ $༯$(!'  8!@! @`@(!<,4Bd 0! 8!A @! C$~b<$<4B  B#@<0# P! `!0!`!D@<840,('H<'!'Я,($ <!4B` ! @ !  (!@0! $,($ '0<'!'௿Q!          $ $, ,' < !<'!'د x$!(! !Q $  ! 8!L$  $܏ '(<'!<$ 42<'l!'x|xtplh(0!!'` !` & 4 ! @!,B@$X (!' $ !L $䏼@ !, $"@,$P ! $"P0#,'@(!X& L $쏼@ !, $"@,$P ! $"' ` !x(!$@ @!&8@ !x(! $  $<$UЏ Bb!bB0B@&& #Bb!bB0B@&1&1X(!00# ` !` !, $,@#@!@@! &Bb!bB0B@ #Bb!bB0B@&1&1 (`(! $ԏ` ! (!@ ` ! (!@Yx$@ !(!$  4@ !(!XE$ L $@! !, $"@=,$P ! $"@3P#."c@0&B\@ !(!  0!@X@ !(! 0!L $@ !, $"@,$P ! $"@ P0#,c@(!X&  $0 !&  '`@!!|xtplh`!'<'d!'x|xtplhd`<!$Q$ ! P  !@ ! ! $04'P $E@@!x'` !(! $` ! (!X $ ` !b !$ b` ! $^@  !<"!(0<$B!$'T` ! T&0@ !! @!@ !L $x@@ !x'  !(! $0@ ! Xb!$P Bb!bB0B@&&, ! $=@@!  @@ ! (!$=" &&0, ! $; @@! @@ ! (!$;  @ ! (!tB@ !!\, $;@@! &1#Bb!bB0B@ !LL $h@"!&S cBb!bB0B@&s&s  !"!b@Xq#t!T  !@!P+@0!`0!t ! (!@@ !C$=b$\ &RCBb!bB0B@@ !, $;@@!@X/" @yL$Bp!B\!@  @ ! @(!c  @ ! @(!V$S  @ ! @(!FT$"&Q, ! $"@@!@  !31 @ !*  @ ! @(!  @ ! @(!$$ (  @ ! @(!,`\@$;bX$cXtC! $ @&   !0!'P $ &;$@ $ @&<  !0!'P $ &/$ @&   !0!'P $ &$ <@'P&<  !0! $ &$Ӯ<&   !0! $ &L $Ƥ@ @ !b! $D@(!<I$Y󴏅L@ ! $Ƅ@]@ ! @ !b!$Q #Bb!b0B@ !&1, $ @@!@&0  !$ < ! $Ԉ@ @ !pb!<'9d $Ep$<'9 \< ! $Ԁ@U @ !pb!<'9d $Ep$L $Ƙ@@ ! @ !b!! $D @ !b!$DL $p@$"lL $ƴ@ @ !7 !$䏙x(!$  b!4"!X& !(! $ !  !<0C!D |xtplhd`!'<'!'0̯ȯį'!$\  !&  !&  'h !(!܏( @0! !&$ &  !&'x '@ !(!@0! '菼 !& $ @ ! !@(!@0! & !`(! &B$`(!,' 'H$\  !  ! !(! @0!&$  ! @ !@0! ! @(! ! (!$(!,  !$\ ` ! '` !@0! '&$ ` !  !` ! (! @0!8@=&$ ` !& ! &8(!` !@0! &&$ ` !  !` !(! @0!&$ ` !  !` ! (! @0!&$ ` !  !` !(! @0!Џ ` !Џ̏ȏď'<'@!'!!' '쏼菦쏙X'x  !' ! (! $'@8!, !$Ɛ $$\' '؏  ! (!' @0!$'( $  !@0!(! '' @(!` !@(!, $'<'! <'!'Я,(<!(!'9  '&@(!, $,('0<',!'TP<!(!'9  '@@(!', $& 'TP,B'X<'~!'د ,$!$=  !&u@ (!@  ,B'(<'~8!'ȯ0,(<' $ $ !$Ʋ$ !  ! ! !&&”@(! $Z0,('8<'}! $Bɰ<'}!@D<'}p!@B<'}P!'840 ! $($Џ ! &@($b ! $篦(840'@<'|!'௿ @ !<( $̸@ ! ' <'|$!'<840 ! $(!$Џ ! &@ $X  @(!$!$(b $ $௦(<840`!'@<'{,!(!$$$  ! $!$Dɰ$c@ `$!C! $cɰC!C@@ `<'z!'د  !@!8!|L@0!@!$ !"$޴ Ex `! @!@0!LP$Џ Ex  ! '(<'y!'௿L @!$,L$Q@ $菄L$b$L$4 '  ' <'yD!'௿D ! !< $ʘh ' <'x!4D@8!$K$  $_<'x!'௿D !$D (!$$,8! $K$#*L'  $l<'x4!'د <$ $ʘL !@!&&߄8!(!@ !$DLb<$ $$&&ߘ 8!@!&$ߘ @!<L4B$߬$#2 &$߄ !<4B$#2L $ȏ$D (!$$,8! $K! '(<'v!'ȯ40'(',!(' $ '$$C $' $$b!$ !40!'8!<'v !!8! !@X$_`$ 䏂Bb 8,B8,B<'u!'X' !@ !!8( $Ɛ@ !(!x$t @! @ !(!x $4  @@ !8( $d@@! $D (!X $ @ !8( $x@@! $D (!X $ $1b$3b$#) $@0!@8!L $ $菙 $@0!@8!L $$ @!< $$ "H ` !@ 8 @,   !0 ! $HD $ !'<'r!'Я($ ! !@ !8( $Ɛ @!@ !$4x (! @ !8( $d@ @! (!$D X $ @ !8( $x@@! (!$D X $ Bp#<$1 0!$b $#)! @ ! @(!@! `!($ '0<'p!@$B<'pl!'د @x,&䯦04!(! ! $ !$<tL$@0!  &R*B(&1&s@&؏0& $N0*($c&&&'@0 \XTPLHD@<8 '`<'T!'840,(!!D!#b1@!x'"$(!` !" $$` @ `(!H$ $@@!@ $H$ '@!@$"@!840,('@<'S!'Я,($ `,B@ !L $ȏ(@ԎD(! 0!#$b !$&#&*@$c bD$&lD $,B@eL $܏&"@b!$bblD b!,($ '0<'RL!'d`\XTPLHD@ (CҔ!b#b!(!0! C @@$B$Bb!b@lb8 '(Дgҏ$B0C8+$$$Џ b & @!$$@M$ @! !x(!@U$ ЎP$*(!$@ !( , @!(!P$@  !$B * @@! @ !   ! E$$LLL$B<4$ $ (! l+ $LLL$B <4$ $ (!$LLL$B <4$ $ (!  @ ! l <$Ԯqr@ !(!$'8   !(!$'8  $ @ !4$'<<  4$ԯ ! '< Џ`$ B,B@ L0$@ 0 l !d`\XTPLHD@'h<'N!'Я($ `",B@!L $h",B@< @(!L $‏",B@< @(!L $┏",B@L $⨏(0!$ (!@@$B$Bb0!@l$ !$R#R#s!C!<(!C! !'96 F@@!` !@(! $@!l$ !($ '0<'K!'د `",B@!L $ⴏ",B@< @(!L $‏",B@< @(!L $┏",B@L $⨏((!$ 0!@@$B$Bb !@l$ $<'96 (!$l @!! '(<'J8!'௿x$(! $\!' <'I!'௿`!LB,B@$ؖ  !0d$eԤԏ ԖdЏ ' e<'I`!'ȯ0,($ `B,B@ !L $((! 0!@@$B$Bb!"@!l 0$!!!@(!&R` !Q0! *B@&&s*b@&$ $  !(!x $ $l" "!0,($ '8<'G!'௿@x(!& ! $$$$BA& !' <'GH!'د$ !@@$$cC!&RQ@ ! Q@ ! *B@!$ '(<'F!'ȯ0,( !@@<$B! &1 L$ (!*" @0,('8<'F!'@!!' !$$B`A$cB' !2Q$"b%'&D0! 8!"0B@ (!X@ ! $@b!*b @' ``B,B@@(!L$H `0!'<'D!$tBB<'D!'p|xE#E#d!xb!'!(!$` ! b!< 4B <$SG`!  !D$h$t`! ! pY $0!  !B !`! pY  !$ 0!@!B̮@۰@@ !@ @ D̏` @!|x'<'C !'PE#d!E#x!R!!(!' $`"&5,B@|!b@$`B,B@L $p<!B"Ќb"$$B,B@ &P@ $$$,0! 䏃<< 4B  !$yG |t&$  $@ <'9GH0  !0Ў"t>Ў#`pb$bh$h$" ($ $$$88888 $$,@$$$$$$$$$,$b$T`B,B@$L $㰏$,$0$4(,0$$ $$$$<ff4Bfgb44@!!b$@$h0 !$ 'xx$bN$$$` !G,E$@@!bF=xt!C !$@ &$B,B@4!8B,V$@&t!C !$$@ &E4!8B,V$@t!C!$b@&b@b48B,V$c؏t!W!BV<!$`t!W!,c`VL(!$ 8!00! ! $!!t!B!W!&R،B@(!`0!L,B@$0 `(! ! 0!&*@t!@@"ď|< P$ď X8$b$ $$8b8"@$P\'\ &%Ȏ"Ȏ#ď``8$8 $HH01LHD@$`B,B@L$ElL$ExL $䄎$Ў $0(+E(# 0!`,B@L$ (!,B@Lt $䴏,B@L$h $ď,B@L8 $܏,B@ L,04 $菼,B@L( $,B@LP\ $,B@ LHLD $8<$yG  !|(!`$(!Y ' 0!$$@!<'9E h<'9E |@$t"$"@!'$<'9 !'د (ԏĎ$(! 0!$t@$ Y <4Ʈ ! $tC$l  !'(!<'8H!'د$ (!ԎD(! 0!#!C!E!b@$&*@$c$lD =$$P#d!P#b!&<%"e! !$$b $g$ $ $lD `B,B@ 0!L%$| 8!$ !$ '(<'6!'<840,($ (!Ԏq(! 0!R#R#!b!~!!@!l $@&e $@h@@#`B,B@L $嬏f&$ $ $l Y!d4 b <(b  C`B,B@$L $䏼$f&$ $ $!^!B@ @0!` ! @(!@!l `B,B@  (!L$@0! 8!d !<840,($ '@<'3x!'Я,($ `BL(,B$@@(! 0!@! Ԏd(! 0!Q#r!Q#b!x(!b! 8!&l@$d $! $b @ !@  (!<'9GH @!ld !,($ '0<'2!'Я,($ (!Ԏ!!(! 0!Q#r!Q#b!d!D !`@ !@ ! (!`$@ ! (!0!b@@ $`@ ! (!b0! @!l !,($ '0<'0!'X(!0(! 0!$!$R!T!C!&s @&&$,c`",B' x(!$`@ ! < 4B  <$QG ! @ ! !@ !| $Y  !$ 0!@!al  !'<'/H!'ȯ0,($ `!CD!L4!,c$dp`$ P#P#"!T!"@ @ !"@ (!<'9GH uخ ď0,($ !'8$<'.@!8!@!$I0! !b$(D$c!$(@%$<'-!'p' $d8! <$d4L @!4h$$C (!$~L!$B  ' '<'-0!'X$0!! $' $@!x !(!@D$n '# 0!L`  $ď ! (!P $n !(!x@($n  L$bАDEFGL HIJKB cУ$,$n%&'#()*+-`(! !$d 8!  !'<'+!'د$ (!$!0! (!4 ! @(!$$l  '(<'+,!'௿`LB$܏L`$B,B@L $ !B,B@ $' <'*x!'840,($ !!`B,B@L $,$,@$L$cC!B\!@$$"<< !$`, @0!&`B,B@vL $L`B,B@kL$p  `B,B@]L $瘏V! !(`Ԏ(! 0!,B@$L% $缏@bBb@ !$c$$cb@!@BB $,B@$L $쏼$`bB@BBVp!$Bb! !$(@$b@Q$c$$LLL$B<4$ $ $0P!D!C!Qnuv|}~LL$c@P$B\LHL$cp`$BLXL$c$BLL$c$B456DEFLLx$B L&$c@$BhЮȢLMNTUV\]^defĢ֢ !(!̢͢΢Ԣ $D& !Tx" #4ڨ(!"8# H$"#h"#,("0#ď`"#dЮ"$#( < @uLLL$BL$cx$B̮LL$Bܮp$cLhL$B$cL L$B $c,$|}~lmntLL$ $B@X$cTL`L$Bh8$cxL0L$B($cLHL$BP$c$5@\v$%& D]^d$e$ M$E퐏&f<=>46,-.LNTUVFt&ۨ& LL&d$B$cLL$BL$$B $$ $ %$c $  L,$B04 $&( ,L6$BD0l $ LL$BTd$$cd$ 4. -5$,4 L%)$Bt$LL0$c$B (46$%&,-.Y5B0B@C0B@,D@<840,($ !'H !@!$LL$$p $[$D@<840,($ 'HLL$ $pLL$ $p#LLL$$p$, $LLL$P$p$, $LL$$p $2$LL$$p $@$LL$$p $N$<' !'௿LL$ $!' <'!'840,( $"0BC`!Q<4B $?`$b]$gLL$0$ 840,('@"<P 8!LL$h$$M믢8@I$s>$$N$D 0B0B@90B@K$0B@~`S$$b$LL$0$¯LL840,($$$5 '@LL$ $ "P8!LL$$$[LL$$8!$840,( '@LL$H$"0BC< K8!LL$$$D$׏ SB 0B@o"B0B@LLLB $̯$$ $ B 0BB 4 @ ! 4  !"$ 0BCGLL840,($$ '@F ! $ @q$B 0B@tCB0c`B 0B@ !IB B LLL$$$  $B 0B@ !7B LL$D$  $0C LLL$BH$$$ $ LLG$< $ [LL$X$ 8! fD$F$쏙 S$$2$ Q3LLB$$0C LLL$BH$$$  $ |LL$$LL$$8!LL$<$ 8! LL$t$ 8! <'T!'D@<840,( $!B0BP/!C`$bB0BPLL$p $̏  B0BP @y !  $ @@!B$0BT <4B   $D @@!x@ !(! $Dc 0ct\08$8!ȏd"<4B #"0#,"((X5#4"0q6H  0B@&bB0B@-L4b $ $$ @8!TxB$0BP@`!L$ $@8! T`b0BP&C$$B`A$cB$0BCa !D@<840,(!'Hȏd"<4B #"0#(",Xq<#0"46   0B@!$L $@8!$ b0BT 0B@bB0B@C 4B <4) 0!$ C$$&C(@$$B`A$cB$0BCLL$ $̏  !LLF$ $̏ !D@<840,(!'HLL$ $̏  LLL$$$ $ 4B LL$ $̏ LL$4$0! 8! LL$d$0!  8! LL$0$ $Z   !  !LL$$0! 8! QLL<$$ 0! w$0 LLL$BH$$$ $ QLL$$ 0! &CLL$,$8! $LLL$$$ $  LL$\$0! $ LL$t$ 0! LL$$ 0! LL$$8! $v 8 !LL$$8! $TLL$ 8$8! $pLL$ p$8! $7fLL$ $8! $ \<'!'840,( !!BLL$0B$S$LL$ !$ $$"$$$`!  840,(!'@ H$ $, @!BLL0B$S $!840,('@ !<'!'840,( !!BLL$0B$S$ LL$ !$ $ $"$$$`!  840,(!'@ H(! $ @!BLL0B$S $ !840,('@ !<'Ѐ!'840,( $b0BC! <'4B  bQ0$$FB0B@M0bb$0BC9(  8!LL$ $8$o840,( '@ ! $ @B0B@0LLL$BH$$8$ P $ bB0B@LLL$̯$8$ P $ 0B@!0b@$$ 0B@qbB0B@0B4  ! 4  !b$ 0BC/840,('@LLL$$8$ t $ 0B٢LL840,($ $8$$ '@LL$ $8 HLL840,($$8 '@LL$ $8 8! $: 840,('@LL$ $8 8! 0LLL$BH$$8$ t $ LL$ H$8  8! pLL$ $8$_LL$  $8  LL$ į$8 $.  $<'!'840,( $!B0BS!$"$LL$$ $T$6 $ 840,(!'@LL$ $T $  $ @p@! <4B   $0 @h@!L# h"<4B "#@(!0    ( ,"# 0$!QBB0B@(L4$  $@8!$ EB0BS LL$ $T $ B$0BC !840,('@LLL$T$$ t $ LL$ $T  !LL$ $ $TqLL$ \$T $]hLL$ $T $   !Y<'Ȝ!'ȯ40,( $B0BC[! '<4B BQk0$$ڒB0B@ $B0BCm9( s ! (! @B0B@:BB0B@4BB$0BC40,(!'8LL$ $h LLL$$h$ P $ 4BۢLL$ $h 0LLL$BH$$h$ P $ LL$ $h 8! $Ώ $40,('8LL$  $h LL$ $h 8! $ $LL$ į$h $  $LL$ $h $LL$ $h $ $LL$ $h 8!<'@!'840,( $B0BSk![<4B $B`P8!LL$ ($ $ 840,('@ )<''4B " 0B@B0BSk$ # $ 0c`O"BB0B@8" 0B" 4  ! 4  !B$ 0BCĮ@`LL840,($$ '@LL840,($ t$$t8! '@LL$ $ " LLL$$$  $" 0B" 0# LLL$BH$$$  $ LL$  $ LL$ $  $LL$ $$<'0!'@<840,( $!B!0BS@!$"$!LL$$ $$ $ !@<840,('HLL$ $ $  $ @@!B0BS <'4B   $@! @ήB`B0BS````` ``D`,<4B   0B@$B$0BCB`LL$ $ B`L $ $ @0!UB0BSw 0B@]B0B@H $4B  @@!<4 @0! U'$S$#b[LL$$$ $H 4  ! `| XLL$4$ 0! oLL$` $ C`w` LLL$$$  $ 0 LLL$BH$$$  $ #LL$| $ 4  ! ULL$$ $LL$$ $LL$$ $&LL$D$ $ D`| LL$l$$6  8!w<'!'<840,( $!b0BC`!<4B 9$ (8@C$ 4  GCb B0B@O$b0BC9<  8!LL<840,($$$ c '@ !$ 0! @E B0B@bB0B@ <4cC$$0Ь B0B@BLLLC $$$ < E <C% (Y`#`'$@$4Q4 @ ! $"S!@4 @ ! 4  !b$ 0BCP<840,('@bS 8!LL$$ $ <840,('@LL<840,($$$  '@LL$ $ ALL$$$ $ { 4 LL&$h$ 8! ?LL<840,($$ '@@$4Q4 @ ! $"S!@LL'$$ $ Y BLLC 0L$BH$$$ < E$BLLC 0L$BH$$$ < EBLLLC $$$ < ELL$$  $LL$$8!LL$@$8! $ @<'D!'D@<840,( $b!0BRI`!  $ @@!b0B RB <4B  $L @@!x@ !(! $Lc 0cr:L,d0$l(! 8! @NL,d4$(! 8! @[ <4  ! @<`i$b8!hV!Qx#, "0<4B #4"084  $ @"L@ !$$ 8! 2 !< (! @Y8!b$0BC< +$ !  0! @0 B0B@BB0B@ <D%0c` BB0B@j <4Bb$ B$0BCWD@<840,(!'HhS!Qx#, "0<4B #4"084  $ @ˮ"L@ !$$ 8! 2 ! (! @8!LL$$ȯ$  ш  ! $D@<840,('HLL$$ $ ȏ $LL$ $ȏ LLLC $ȯ$$ < LC 0LL$BH$ȯ$$ < mLLLC $ȯ$$ < U0 LLL$BH$ȯ$$ < <LL$ $ȏ LL$$ 8! LL$0$  8! LL$T$  8! LL$p $ш  ! LL$ $ȏ Y$LL$ $6ш  ! LL$ $LL$$8! $ 8$LL$,$$ %LL$`$ $  4  !LL$$$  LL$$ $<'!'<840,( $0BS!@E$~G<4B *$Q8 4$C`F$bR0BS$0BCY< @ !& (! @" 0B@B0B@w" 4B0C`_" B0B@J" 4B" $0cb8<840,(!'@<R!0BSh(! @ ! @ &(!h @ ! @&LL$$@8! $ $<840,('@LL$ $܏ LLL" $$$  $ 0# LLL$BH$$$  $ LLL" $$$  $ |0# LLL$BH$$$  $ dLL$ $܏ +LLF'$H $܏ @LLF$d$ 8! qLLF$$ @8! #LLG$0$ $vLL$h$@8! $kLL$$@8! $`LL$$@8! $ W$"LLG$$ $ILL$$  $LL$$8!LL$($ 8!<'!'௿0` B0B@$(!$ ` !4 B0B@$(!$ 8 B0B@$(!$ P#B0,$ ' <'!'plhd`\X $!c!0cb?!A<4B b0LLL$BH<$$`$4   $8@c$8C<4G g." 0LLLC$BH$$`$쯣⯢@BL$cxC!D !LL$ $` b$0BCY< D4rf 0!$ Cb$0BC!plhd`\X'xb$0BC"< D4re 0!$ CLL$ $` $b$0BU $$"O8!  $ @o@!D<@4rg @0!$ C]`0b$0bQ$4 ! B 0BULL$8 $` b$0BCw$b$0BCLL$h$` $ $b$0BCLL$$` $ z$b$0BQ`\ $b8!LL$ $` $ ^b$0BCLL$D$` $ S$b$0BCLL$$` $Џ B$b$0BCLL$$` $ 1$LL$ $` (!LL$($` $ $(,048<@DHLP$IC0cqvb$0BCg0!D<4 '($ C8!LL$$` $ $LL$$` $LL$$` 8!LL$ $` $i LL$\$` $ LL$$` $ LL$$` 0! /ꮂLL$$` $LL$$` 8! LL$< $` LL$$` $WLL$L$`8! $o m$LL$ $`LL$ $`|LL$$` $! S$<'!'@<840,( $!b!!0BQ!@<C4B b0LLL$BH<$$$4   $D8"$<4G g$0LLL$BH$$$쯣⯢V$#P0,$ ub 0B@$ ! b d40B@$(!$ b d00B@$(!$ b d80B@$(!$ g$ 0bb$0BC6!@<840,('HLL$ $ uBCX!b0BQk!L<4Q  !(!Q0!, j8! @m&E!LL$ $ !b0BQa!!L<4Q  !0!Qn$, -8! @ $cLL0c$0$$.b8!!  LLG$$ $j !L&E$ $6 |!LLG$ $ $ޏ L&E$ $L$T8! $LLG$$ $ LL$$ @0! B0LL$BH$&E$ 8!ԯLL$$ 8!<'!'ȯ40,( $"L0BCI!f<4B b0LL$BH<$&E$4   $8L&EЌ<4G g 0LL$BH$$쯣䯢`/$b&EЏL$ "$ 0BC&E!40,('8L&E $ L$8! $ $L $䏼 !L&E$DL$$ 8! $<'!'TPLHD@<840 $!0BC!o<4B b 0LLL$BH<$$$4   $LL$ $쏼   $ @9@!X !@(! $$ C?8!V!BD,C` L$c$C!D !V!LLGD$t$ $g  !4 $TPLHD@<840'X$$8@$0bP!0Y 8,@ ! (! @@!$P!DDV!DD$}$P$$ $@"0B@C`$&`+0$BH"L<8B0B$0!  8! $SD$b$P  @"0B@C`$&`r+0$BH"L<8B0B$0!  8! $S\-,@V!Q 08~$F0S(R!0Y 8, ! (! @@(!8  !$ CpB0BS24  ! $0BC%!,@V!B(@((Q8 :$$0bP!0Y 8, ! (! @@!4  !$ $b$$$V8 ! (! PZ$0BCLL ($ $i8!8 <#4B bw$0LLL#<$BH$$$4 $8!P#0, $ 0B@$ !  40B@$(!$  00B@$(!$  80B@$(!$ $ 0bSLL$0$ 0! I,@<V!D8Y$0BC6F!C@GELL$d$ 0! &LL$ $쏼 O!bB0B@H< Q 4U 4  ! %<0!C3U$C`h$   %L<$@8!  0! ٰ @(! }{!q!!e h e h L`  ! `  ! MLL$௢$ $폼 4 !bB0B@)< Q4U 4  ! % 0!CU*$C`h$   %L<$@8!  0! l  $ Pk0$$ $@"0B@C`$&`h+0$BH"L<8B0B$0! @8! $SE$$b8$?0  @"0B@FC`$&`*+0$BH"L<8B0B$0! @8! $SAٰ @(!!!!e h e h `  ! `  ! P "@&bCbp @"0B@"@$&`D+0$BH"L<8B0B$0!  8! $$b$0BCLLf $ <$ 8! $P4 BD @ P"@&bCbp @"0B@F"@$&`+0$BH"L<8B0B$0!  8! $$b$0BCLLf $ $ 8! 0BC" B0B@bB0B@" 4B" " LLL$$$  $" 4B" P!C@LLGE0!$! $CR!C@LLGE0!$!` $FP!C@GEL(L0!$! $LL$"$  8! LL$"\$ $he  c L<$"@8! 0! he  c L<$"@8! 0! '4  !LL$"$ $V0# LLL$BH$$$  $ Ue h e h 4 !0LLL<$BH$$$" 8!<LL$#$ 0! LL$#8$ $dLL$$#l$ $ŏ 4Z !`  ! @!LL$$#$ $o`  ! @!LL$#$ $ LL$$#l$ $+4  !(LL$$$ $ 4 !LL$$$ $LL$$$P$J8! LL$$$ $LL$$P$$+8!믴LL$$$ 8!LL$$$ $;LL$$$ $ILL$$P$8!ȯLL$$P$$8!LL$$$ $<'H!'\XTPLHD@<8 $!0BC!=<4B b 0LLL$BH<$$D$4   $LL$ $D   $ @@!X !@(! $$ C 8!$B~!c,b@ L$cC!D !^!LLG$$$D $  !4 $,,\XTPLHD@<8'`^!T,@;$8@$0bP!0Y8,@ ! (! @@!$P!DT^!D$E$P$$ $@"0B@C`$&`o+0$BH"L<8B0B$0!  8! $SWD$bG$MP  @"0B@]C`$&`C+0$BH"L<8B0B$0!  8! $S$-,@^!R@Q8 $f0TS!0Y8, ! (! @@!8 ! @(!$ CBb0BT4  ! $0BC",,@^!B@00Q8 $$0bVP!0Y8, ! (! @@!4  !$ $b$$$8 ! (! P$0BCLL 0$$ $D?8!8 <#4B b$0LLL#<$BH$$D$4 z$+-@$$ c$LL$"$D8! $,@/^!D8m$0BCnF!CGLL$%8$D 0! ^LL$ $D ,bB0B@< Q 4U 4  ! %0!CƬU$C`h$   %L<$@8!  0! ٰ @(! !!!e h e h `  ! `  ! LL$%$D $ 4 !r$P8 4<#4B b0$0BC# 0b@ B0B@$(" 0B@0# LLL$BH$$D$% $ bB0B@LLL" $$D$% $ " $4B<@" 4@ '($ C $$ !$0BC!LL!&"0Q.#`z("0B@&"h !  (! @&D&&eD  0! &"$0BC, @p$h ! (! @ULL$& $D KbB0B@)< Q4U 4  ! % 0!CU$C`h$   %L<$@8!  0! l  $ PO0$$ $@"0B@C`$&`h+0$BH"L<8B0B$0! @8! $SE$$b8$?0  @"0B@FC`$&`*+0$BH"L<8B0B$0! @8! $Sٰ @(!!!!e h e h `  ! `  ! P "@&bCbp @"0B@"@$&`+0$BH"L<8B0B$0!  8! $$b|$0BCLLf $&D$D 8! $P4 BD @ P"@ &bCbp @"0B@"@$&`O+0$BH"L<8B0B$0!  8! $$b#$0BCBLLf $&$D 8! 50BSC$ 00b@ B0B@BB0B@4" " LLL$$D$  $$ 4" P!CLLG0!$& $DS!CLLG0!$'@ $DfqP!CGL0L0!$' $DLL $'$D @8! k8 <#4B b$0BC$ 00b@B0B@0B@bB0B@0"  Dш  9LLL" $̯$D$% $ $ 00BR, @Q!P~8!"0BRш  ! LL$(< $D ш  !LL$"\$D $#he  c L<$"@8! 0! he  c L<$"@8! 0! eB0BSLL$(\ $D 4  !4 !LL$($D 8! Ne h e h K0LLL<$BH$$$" 8!tLL$($D 0! LL$($D $ 4 !`  ! +@!LL$#8$D $LL$$($D $SLL$$#l$D $LL$$($D $`  ! S@!LL$)0$D 8! LL$$$D $: 4O !LL$$$D $LL$$P$D$r8! LL$$$D $c-LL$D$$P$8!LL$$P$D8!㯢LL$$P$D$8!گLL$)`$D $LL$$$D $ LL$$$D $LL$$$D $LL$$$D $0# LLL$BH$)$D$  $0# LLL$BH$)$D$  $LL$$$D $0# LLL$BH$)$D$% $4 !  C$ bLL$) $DLL<$) $l $LL($* $D LL$8!$)`$D $6LL$*0$D 0! LL$*\$D 0! m<'f!'HD@<840,( $!!!0cb5!T<4B b0LLL$BH<$$*$4   $8`<c4B b0LLLc<$BH$$*$+ 4 ᯢLL$ $* <4B b0LLL<$BH$$*$+44  <4B b0LLL<$BH$$*$4  &C$ ,b LL$+T$* 0! &C,b @#8!L$c*C!D !$0BR$bC4$f&b0BR$O$$0BCI!HD@<840,('PRgd$bZ$ap  @"0B@oC`$&`L+0$BH"L<8B0B$0!  8! $R6p$$ $@"0B@4C`$&`!+0$BH"L<8B0B$0!  8! $$0BC$$0BCP@t$  $ @;@!$C $W< 4B  qC`?$"W7T$0BCg$QL$  $ @U@!$C $W< 4B  آ$0BR`$bY8!0BR'#L$+xL0! 8! $* $$0BC$"d 0B@BB0B@| <4Bb$ $0BCf$Q$  $ @T@!$C $W< 4B  $0BU$$" $" 8!LL$+$* $ $$0BC."@ $"0C`0B@gLL$+$* 8! $x $LL$ $* !$0BC@$  $ @@!$C $W< 4B  ,ٰ @(!!!!e h e h `  ! z`  ! l0BRZ#L3$,$SB0BUL$LL$,,$*  0! B$B0BULL$,D$*$ ;$LL$,|$*$; LL$,$* 0! LL$, $*LL$,$* 0! LL$-($* 0! 9."LL$-d$*$ $LL$,|$*$LL$-$* 0! LL$-$* 0!LL$. $*$կB0BU LL$.\$* $ $LL$.x$* 0! $LL$,$* 0! rLL$.$*f$gLL$,|$*j$ۏLL$.$* 0! bLLLC $̯$*$/ < dubLLC 0L$BH$$*$/ < d[d 0B@bLLC 0L$BH$ȯ$*$/ < dBB0B@bLLLC $$*$/ < d <C%0 LL$/4$* 0! $LL$/d $*h$   %L<$"@8!  0! LL$,|$*$LL$/|$* 0! W<'W !'LHD@<840,( $!c!!0cb4!S<4B b0LLL$BH$$*$<4   $ <4B b0LLL$BH$$*$<ᯢLL$ $*쏼 8<4B b0LLL<$BH$$*$4 8<4B b0LLL<$BH$$*$+ 4  $ !LL$+T$* 0! !D$!(@$$!CLL$/$* 8! $ $LHD@<840,(!'P!gS!0Y8@0!, !  (! @@!$0BW>!!d$!D${$$$ $@"0B@C`$&`+0$BH"L<8B0B$0!  8! $R$b$  @"0B@C`$&`|+0$BH"L<8B0B$0!  8! $Rdb$0BCb !LL$ $*쏼 Y !@#&BCbQ$ ""@""0B@@$#&`+0$BH%""L<8B0B$ 0! @8! $$b$$b$0BCM0!LL$/$* 8! D$ٰ q@(!i!!m!e h e h B`  ! `  ! CbDv @^#&BCbQ$ ""@""0B@<@$#&`;+0$BH%""L<8B0B$ 0! 8! $$b$b$0BC0!LL$00$* 8! !CLLG$0x$*  0! !`  ! @!e h$ #h$E  C %L<$"@8!  0! 0BWLL$0 $*쏼 ~$`  ! 4@!e h$ #h$E  C %L<$"@8!  0! LL$1$* $E4<'M,!'<840,( $@!b0B@C4! S<#4B b0LLL$BH$$+$<4   $0 <4B b0LLL$BH$$+$<ᯢLL$ $+ 8<4B b0LLL<$BH$$+$4 48<4B b0LLL<$BH$$+$+ 4  $ LL$+T$*  0! @$B: 8!LL$1H$+ $' !b$@0B@C !<840,('@b 0B@$@b0B@C/$b0B@C!LL$ $+ !b$@0B@CL$1xL 0!$ $+ LL$1$+  0! !L$1<'Ip!'د LL#$0b$P$2 LL0b$P$2 !'( #LL0b$P$2   !'(<'H!'د LL#$ 0b $P$24LL0b $P$24 !'( #LL0b $P$24  !'(<'G!'ȯ40,($ $!b0BTI! <'4B ^  $@N@!X@ !@(! $$C\ 8!,@$<4Bb$`LL$2p$2P 8! $̏40,($ $'84  !b0BT!40,($ '8LL$ $2PLL$ $2P!LL$2$2P $rLL$2$2P $d $LL$3$2P $~4  !LL$3d $2P<'E`!'د  ! $ @!@(!,LL @!$5P8!@"$5h<(4B d8$! LL$5@ $3< 4B "0\$ '( $L$) $3$<'D`!'TPLHD@<840 $!!0BPn!`'$ 2< 0BP ` !$ C$v\U!h$b^(b @4$ $b=LL$5$3 8! $ $TPLHD@<840!'Xc4G v\g0LLL$BH$$3$3  $b$"'LL$3$3  0! $0BC !TPLHD@<840!'XLL$ $3 GR!0Y80!, ! `(! @\@!B$0BC@&Cb1@-"0B@(`  ! @!$b$dX<4G g0LLL$BH$$3$L $4 B@$&`+0$BH"L<8B0B$0!  8! $LL$ $3 u !$0$( ,@"0B@@$&`+0$BH"L<8B0B$0! @8! $T$$b$0  @"0B@@$&`+0$BH"L<8B0B$0! @8! $Tr(@,@$0BCLL$44$3`0! 8! h  L<$"@8! 0! LL$4 $3 8 #<4B bc0LLL#<$BH$$3$+ 4 dLLi$4$3  0! e h "ٰ g@(!g,]!(e h te h 8`  ! s`  ! 9LL$5$3 $ @$<'<`!'ȯ40,($  ((!$! 0@/@!$S@!x< 4B bp q` ``` !(! $s$$$b c $$b6c9$$bmcp`` `!`7`:`n`qEX!b$bLL$<0$60$ &RPE$0bL!(b@$$bW(b @ $$b3@7`9!,!0b"*@2!&1&E 0bb $0b80@-P& (!$ &&RP!40,($ '8$O0bP0$PbB E$ &F&R$O0b0$Pb E$ &}&R@`!,!0b"*@!&1&E 0b"*@!~ E$ ` !&RL $$= 0 40,($'8"0B@?E 0B@%B0B@5 $D$0c` B0B@ 4B "0B@$40,('8"0B@E B0B@B0B@D $D$0c`* B0B@g 4Bά "0B@E 0B@B0B@Q $D$0c`7 B0B@ 4B@ "0B@E B0B@B0B@N $D$0c`4 B0B@, 4B "0B@E 0B@B0B@K $D$0c`1 B0B@ 4B\ "0B@HE B0B@[B0B@ $D$0c` B0B@ 4B6 "0B@=E 0B@5B0B@ $"0B@EE 0B@B0B@ $D$B0c` B0B@ 4B "0B@"0B@LL$ $= $"0B@E B0B@bB0B@C <4Bb$֬ "0B@L $?"0B@L$?XL $=  LLL$=$$? $E h4B LLL$=$$? $@E 4B@ LLL$=$$? $E  4B LLL$=$$? $ E& LLL$=$$@ $E 4B LLL$=$$@@ $E 4B LLL$=$$@d $E ?4B LLL$$=$? $E $ LLL$=$$@ $E 4BLL$@ $= "LL$@ $= LL$@ $= 6LL$A  $= SLL$A0 $= LL$AP $= LL$At $= L $ALL$A $= LL$A $= H0 LLL$BH$=$$? $ Ep0 LLL$BH$=$$@ $ E LLL$=$$= $ E LLL$=$$> < E0 LLL$BH$=$$? $@ E LLL$=$$>4 $ E0 LLL$BH$=$$@@ $ E LLL$=$$>\ $ E0 LLL$BH$=$$? $ E LLL$=$$> $ E0 LLL$BH$=$$@d $ E LLL$=$$> $ E0 LLL$BH$=$$@ $ E LLL$=$$> $ E<'`!'Я,($ 0L$$B$  $@!@j!4d@ !$< 0!@ !$Ld$ $B @ !$Ld$ $B0@ !$4d $@ !0!L $B@@ !$L $BT@ !$L $Bh@ !$L $B@ !$L $B@ !$L $B@ !$L $BЏ@ !$L $B菼@ !$L $C@ !$ L $C@ !$ L $C0@ !$ L $CH@ !8!L$C\ @ !@(!,0! $@ !$L0$C @ !$ L $C @ !$L$Cԯ @ !(!L$$C @ !$LԀ$D$ @ !@(!,0! $@ !$L$Dh @ !@(!,0! $@ !(!L$$D @ !L$D$ @ !@(!,0! 8!@ !L$E8! @ !@(!,0! $@ !L(!$E8$  @ !L(!$Eh$ @ !L(!$E$ $@ !L$E$ @ !@(!,0! $@ !$ L$E @ !$L\$F @ !$L<$FD @ !$L<$Fp L$F@ ! $ @!,($ '0<'@!'Я,($ 0L$$F$ $@!@!Ld@ !$F 0!@ !$Ld$ $Fԏ@ !$Ld$ $F@ !$Ld $F@ !$Ld $G@ !$Ld $G@ !$Ld $G(@ !$0d $@ !0!L $G<@ !$L $GX@ !$L $Gx@ !$L $G@ !$L $G@ !$L $G@ !$L $G؏@ !$L $G쏼@ !$L$H @ !@(!,0! $@ !$L|$H, @ !@(!,0! $@ !$Lټ$HX @ !$L$H @ !@(!,0! 8!@ !$L$H @ !@(!,0! $@ !L$H$ @ !L$I $ @ !@(!,0! $@ !L$IT$ @ !@(!,0! $$L$I@ !$ @ !@(!,0! $@ !Lp$I$ @ !@(!,0! $@ !L$I8! $L$J$@ !$ @ !@(!,0! 8!@ !L$J`$ @ !@(!,0! $$Ll$J@ !$ @ !@(!,0! 8!@ !L$J$ @ !@(!,0! $$L$K@ !$ @ !@(!,0! 8!@ !L$KH$ @ !@(!,0! $$@ !L\$K$ @ !@(!,0! $@ !$L$K @ !8!L$K诰 L$L@ ! $@!,($ '0<'!'Я($ 0L$$LT$ $@!@ !L$d$F0!c!  !$4d $️ !0!L $L\ !$L $Lt !$L $L !$L $L !$Ld$L  !@(!,0! $ !8!L$LЯ  !$L$L  !$L$M$  !@(!,0! 8!!($ '0<'!'ȯ40,( L!BL0B$MP$@!N<4B b0LLL$BH<$$MP$+ 4   $ LL$ $MP#<4B b0LLL#<$BH$$MP$4 دB0B@40,(!'8 #<'$!'௿LL$0B@$MlLL0B$@$Ml!'  LL0B$@$Ml !' <'\!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$M$+ 4   $LL$ $M <4B b0LLL<$BH$$M$4 د< 4B b0LLL< $BH$$M$"4  @P0B@7"0B@Lb4Bb (!# 0c`!0,('8LL$ $M !LLLb$$M$N $ LLC0L$BH$ȯ$M$N $ LL$O$M $ $<'<!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$M$+ 4   $LL$ $M <4B b0LLL<$BH$$M$4 د< 4B b$0LLL< $BH$$M$"4  bP0B@7"0B@Lb4Bb $# 0c`!0,('8LL$ $M !LLLb$$M$N $ LLC0L$BH$ȯ$M$N $ LL$O$M $鏼 $<'!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$M$+ 4   $LL$ $MЏ <4B b0LLL<$BH$$M$4 د< 4B b$0LLL< $BH$$M$"4  b!0B@B"0B@*Lb4Bb $ # 0c`0,($'8LL$O$M $4 LL$ $MЏ LLLb$$MЯ$N $ LLC0L$BH$ȯ$M$N $ <'!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$M$+ 4   $LL$ $M <4B b0LLL<$BH$$M$4 د< 4B b$0LLL< $BH$$M$"4  b!0B@B"0B@*Lb4Bb $ # 0c`0,($'8LL$O$M $ LL$ $M LLLb$$M$N $ LLC0L$BH$ȯ$M$N $ <'!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$N $+ 4   $LL$ $N <4B b0LLL<$BH$$N $4 د@< C4B b$ 0LLLC< $BH$$N $"4 C b(@8!B0B@M"0B@5C4cCDL$ " 0B@40,($'8LL$O$N  $؏ L$LL$ $N LLLb$$N $N $ LLC0L$BH$ȯ$N $N $ <'!'ȯ40,( !B0B@! T<'4B  0LLL$BH<$$NH$+ 4   $LL$ $NH '<4B b0LLL<$BH$$NH$4 د <4B b0LLL<$BH$$NH$4 %< 4B b$0LLL< $BH$$NH$"4  b?`$bO0B@LLC0L$BH$NH$$N $ %B0B@LLLb$NH$$N $ %LC4cC$ $ B0B@$40,('8LL$ $NH $LL$0$NH $C $<'!'ȯ40,( !B0B@! T<'4B  0LLL$BH<$$Np$+ 4   $LL$ $Np '<4B b0LLL<$BH$$Np$4 د <4B b0LLL<$BH$$Np$4 $< 4B b$ 0LLL< $BH$$Np$"4  bs``$bR0B@9B0B@!L$ C4cC$ B 0B@$40,('8LL$ $Np $LLLb$$Np$N $ $LLC0L$BH$ȯ$Np$N $ $LL$0$Np $ $0B@*B0B@L$ LL$Od$Np $ $LLLb$$Np$N $ $L$ LLC0L$BH$ȯ$Np$N $ $<'@!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$N$+ 4   $LL$ $N <4B b0LLL<$BH$$N$4 د< 4B b$ 0LLL< $BH$$N$"4  b!0B@B"0B@*Lb4Bb $ # 0c`0,($'8LL$Od$N $ LL$ $N LLLb$$N$N $ LLC0L$BH$ȯ$N$N $ <' !'ȯ0,( "0B@!V<4B b 0LLL$BH<$$N$+ 4   $LL$ $Nď <4B b0LLL<$BH$$N$4 د< 4B b$0LLL< $BH$$N$"4  b$bP0B@"0B@3Lb4Bb $# 0c`0,($'8LLC0L$BH$ȯ$N$N $ LL$ $Nď LLLb$$Nį$N $ LL$O$N $X <'!'@<840,( "0B@!n<4B b 0LLL$BH<$$O$+ 4   $LL$ $O <4B b0LLL<$BH$$O$4 د `r@< S4B b=$0LLLC< $BH$$O$"4 "0B@"0B@@<840,(!'HLL$ $O LL$T$O 0! T  8!LL$T$O $i   $ @5@!ST @ @@@&H&F$G $ $C`h  L<$"@8! 0! &CbLL$,|$O $Y><'<!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$O$+ 4   $LL$ $OЏ  <#4B b0LLL#<$BH$$O$4 دB0B@ (!9<  !B0B@40,(!'8L $U( (! 0! @LL$ $OЏ $<'8!'@<840,( B0B@!X<4B b 0LLL$BH<$$P$+ 4   $LL$ $P <4B b0LLL<$BH$$P$4 د `4q < 34B b$0LLL#< $BH$$P$"4 4 ,8!LL$T$P $% !@<840,('HB0B@=B0B@$LL$ $P $  $ @A@!ST @ @@@&(&&$G $ $C`&CbŮLL$T$P 0! h  L<$"@8! 0! LL$,|$P $<<'|!'ȯ40,( "0B@!k<4B b 0LLL$BH<$$P<$+ 4   $LL$ $P< <4B b0LLL<$BH$$P<$4 د `c`< r4B B:$0LLLc< $BH$$P<$"4 "0B@"0B@ 40,(!'8LL$ $P< LL$T$P< 0! g  LL$T$P< $   $ @$@ !R$ b @!hE  C L<$"@8! 0! &BCbPLL$,|$P< $|R<'$!'@<840,( !B0B@!T<4B  0LLL$BH<$$Px$+ 4   $LL$ $Px  <#4B b0LLL#<$BH$$Px$4 د$ <4B b0LLL<$BH$$Px$4 $8<4B b0LLL<$BH$$Px$4 6L, $`,` !@B0B@&PxL$UP  0!  0! @:@!$b]&Px0B@L $Ul ԮB0B@8 (!9@ , !B0B@6@<840,(!'HB0B@&PxL$U  0! 0B@&PxL $U(! 0! @L $U菼 LL$ $Px L$V  $<'!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$P$+ 4   $LL$ $P  <#4B b0LLL#<$BH$$P$4 دB0B@ (!9<  !B0B@40,(!'8L $VD $ 0! @LL$ $P $<'!'௿LL$0B@$PLL0B$Vp@$PLL0B$@$P$'  LL0B$Vp@$P LL0B$@$P $' <'!'ȯ40,( !B0B@!k<4B  0LLL$BH<$$Q,$+ 4   $LL$ $Q,  <#4B b0LLL#<$BH$$Q,$4 دB0B@" (!9@  !$ 0! @!B0B@ $40,(`!'8LL$ $Q, $L $V $<'!'௿LL$0B@$QhLL0B$Vp@$QhLL0B$@$Qh$'  LL0B$Vp@$Qh LL0B$@$Qh $' <'!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$Q$+ 4   $LL$ $Q  <#4B b0LLL#<$BH$$Q$4 دB0B@ (!9@  !B0B@40,(!'8L $V $ 0! @LL$ $Q $<'!'ȯ40,( B0B@!X<4B b 0LLL$BH<$$Q$+ 4   $LL$ $Q  <#4B b0LLL#<$BH$$Q$4 د `Ae< 4B b0LLL< $BH$$Q$"4  2B0B@@(!9< 4 !B0B@ $40,(`!'8LL$ $Q $B0B@LL$T$Q 0! LL$T$Q $ !0! $ @!L$V0!  8! <'!'ȯ40,( !B0B@!j<4B  0LLL$BH<$$R$+ 4   $LL$ $R  <#4B b0LLL#<$BH$$R$4 دB0B@ (!9<  !$ 0! @B0B@40,($'8L $W LL$ $R $<'!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$R`$+ 4   $LL$ $R`  <#4B b0LLL#<$BH$$R`$4 دB0B@ (!9<  !B0B@40,(!'8L $U( (! 0! @LL$ $R` $<'!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$R$+ 4   $LL$ $R  <#4B b0LLL#<$BH$$R$4 دB0B@ (!9<  !B0B@40,(!'8L $WP $ 0! @LL$ $R $<'!'ȯ40,( !B0B@!<4B  0LLL$BH<$$R$+ 4   $LL$ $R䏼  <#4B b0LLL#<$BH$$R$4 دB0B@ (!9<  !B0B@" (!9< & !B0B@(40,(!'8L $WP $ 0! @L $U( (! 0! @LL$ $R䏼 $}<'8!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$S($+ 4   $LL$ $S(  <#4B b0LLL#<$BH$$S($4 دB0B@ (!9<  !B0B@40,(!'8L $WP $ 0! @LL$ $S( $<'4!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$Sh$+ 4   $LL$ $Sh  <#4B b0LLL#<$BH$$Sh$4 دB0B@ (!9@  !B0B@40,(!'8L $U菼 (! 0! @LL$ $Sh $<'0!'ȯ40,( !B0B@!_<4B  0LLL$BH<$$S$+ 4   $LL$ $S  <#4B b0LLL#<$BH$$S$4 دC0B@  (!0B@40,(!'8L $W| CLL$ $S %<'`!'ȯ0,( "0B@!X<4B b 0LLL$BH<$$S$+ 4   $LL$ $S <4B b0LLL<$BH$$S$4 د `Hg< 4B b0LLL< $BH$$S$"4  LL$W $S "0B@$0,('8LL$ $S $LL$T$S $ !"0B@LL$T$S 0!<'!'ȯ40,( !B0B@!l<4B  0LLL$BH<$$T $+ 4   $LL$ $T  <#4B b0LLL#<$BH$$T $4 دB0B@ (!9<  !B0B@40,(!'8L $WP $ 0! @LL$ $T $<'!'ȯ40,( !B0B@!<4B  0LLL$BH<$$T`$+ 4   $LL$ $T`  <#4B b0LLL#<$BH$$T`$4 دB0B@ (!9<  !B0B@" (!9< & !B0B@(40,(!'8L $WP $ 0! @L $U( (! 0! @LL$ $T` $}<'P!'<840,( "0B@!<(4B b 0LLL$BH<($$W$X4   $LL$ $WЏ G< 4B b$0LLL< $BH$$W$"4 ֯ bu "`$LS $ @w@!x@ !(! $L @ ! (!# 0c`8d<L4 @0!$ CH$$c8!C<4G gpC"0B@(4 @ !" 0B@ !<840,('@LL$ $WЏ !LLg$X$W 0! LLg$Y$W 0! YLL<$YP $W $LL$Y$W $ $LL$Y$W $N $bLL$Y$W $i 4 @ ! $0LLL$BH$$W$Z4*<'X!'@<840,( "0B@!<(4B b 0LLL$BH<($$X$X4   $LL$ $X G< 4B b$0LLL< $BH$$X$"4 ֯ b$"`Su$  $L @@!x@ !(! $L @ ! (!# 0c`'d<@L4 @0! UT$$b?8!"0B@)4 @ !" 0B@@<840,($'HLLg$ZL$X 0! LL$ $X LLg$Z$X 0! ]bLL$Z$X $ 4 @ ! LL<$[ $X( $LL$Y$X $ LL$[L$X8! $LL$Y$X $ߏ <'p!'@<840,( "0B@!<(4B b 0LLL$BH<($$X8$X4   $LL$ $X8 G< 4B b$0LLL< $BH$$X8$"4 ֯ b$"`Su$  $L @b@!x@ !(! $L @ ! (!# 0c`6d<L4 @0! UR$$bo8!"0B@/4 @ ! 4  !" 0B@ \!@<840,('HLL$ $X8 !LLg$[$X8 0! LLg$[$X8 0! WLL$Y$X8 $h !LL<$\( $X\ $LL$Y$X8 $ $LL$\X$X88! $[bLL$\$X8 $ 4 @ ! $<'p!'@<840,( "0B@!<(4B b 0LLL$BH<($$Xl$X4   $LL$ $Xl G< 4B b0LLL< $BH$$Xl$"4 ֯ @u$"`Spuz$  $ @D@!ڜ6@@@@ 6@ ! (!# 0c`&d<@4 0! UF$$b2"0B@ $@<840,('HLL$ $Xl $LLg$\$Xl 0! tLL$]0$Xl $ !LLg$]h$Xl 0! 4  ! $LL<$] $X $LL$Y$Xl $' $LL$]$Xl8! $<'!'௿0(! $$Cp$ $Ch$( $C`$X $CX$߼ $CP$ $CH$ $PA$ P:$T P3$D P,$ P%$ P$\ P$L P$ P $ P$$!' <'!'ȯ40,( LD !$^p $@!$ "b$L@|$B^ !(! 0! Qf@!L@$B^ !$ $ P[@!L@$B^ !$ 0! QP@!L@,$B^ȯ !$ 0! P5@!L@ $B^௢ !$ 0! Q6@!L@$B^ !$ 0! P$40,(`!'8L$_L $^@ 40,($`!'8L$_\ $ %0B@ LLL$r$$>\ $ % $D$0c` 0 LLL$BH$r$$@@ $ %0B@ LLL$r$$@@ $ % 4B 5T!(`B0B@($$bb0B@ $<840,('@LL$ $r $LL$t$r @8! ۮ(P@8!0B@% B0B@0B@i $D$0c`D 0B@. 4B 4T!(`E8!B0B@($$bLL$t<$r@8!$} $LL$t$r @8! ( LLL$r$$@@ $ %0 LLL$BH$r$$@@ $ %LL$th$r $ $ LLL$r$$>\ $ %0 LLL$BH$r$$>\ $ %pLL4$t $r ]LL8!$th$r $ "$LL$0$r $  $LL$t<$r@8!v$LL$t$ro$LL$u $rh$\<'n!'ȯ0,( "0B@!<4B b 0LLL$BH<$$s$+ 4   $LL$s $s <4B b0LLL<$BH$$s$4 د 0B@$"0B@] $D$0c`C "0B@- 4B@ #0c`0,($'80 LLL$BH$s$$>4 $ LL$ $s  LLL$s$$? $@ 0 LLL$BH$s$$? $@  LLL$s$$>4 $ M<'k!'ȯ0,( "0B@!<4B b 0LLL$BH<$$s $+ 4   $LL$s $s <4B b0LLL<$BH$$s $4 د B0B@$"0B@] $D$0c`C "0B@- 4B #0c`0,($'80 LLL$BH$s $$= $ LL$ $s  LLL$s $$@ $ 0 LLL$BH$s $$@ $  LLL$s $$= $ M<'h!'ȯ0,( "0B@!<4B b 0LLL$BH<$$sD$+ 4   $LL$s $sD <4B b0LLL<$BH$$sD$4 د 0B@$"0B@] $D$0c`C "0B@- 4B #0c`0,($'80 LLL$BH$sD$$> $ LL$ $sD  LLL$sD$$@ $ 0 LLL$BH$sD$$@ $  LLL$sD$$> $ M<'e!'ȯ0,( "0B@!<4B b 0LLL$BH<$$sd$+ 4   $LL$s $sd <4B b0LLL<$BH$$sd$4 د B0B@$"0B@] $D$0c`C "0B@- 4B #0c`0,($'80 LLL$BH$sd$$? $ LL$ $sd  LLL$sd$$? $ 0 LLL$BH$sd$$? $  LLL$sd$$? $ M<'bX!'ȯ0,( "0B@!<4B b 0LLL$BH<$$s$+ 4   $LL$s $s <4B b0LLL<$BH$$s$4 د 0B@$"0B@] $D$0c`C "0B@- 4B #0c`0,($'80 LLL$BH$s$$> $ LL$ $s  LLL$s$$? $ 0 LLL$BH$s$$? $  LLL$s$$> $ M<'_0!'ȯ0,( "0B@!<4B b 0LLL$BH<$$s$+ 4   $LL$s $s <4B b0LLL<$BH$$s$4 د B0B@"0B@. <4cC$ #0c`0,($'80 LLL$BH$$s$> < LL$ $s  LLL$̯$s$> < |<'\!'@<840 !B0B@!T<4B  0LLL$BH$$u`$+ <4   $LL$ $u`  <#4B b0LLL#<$BH$$u`$4 د' <4B b0LLL<$BH$$u`$4 &D< 4B b$0LLL< $BH$$u`$"4  b$ b `/$bBP8<4B bO0LLL$BH$$u`$<}LL$T$u``8! $Ϗ !@<840'HB<P8<4B b3` 8!b0B@q4<4  0!$ C?$$4B0B@\$3`O 8!b0B@<b4$ $B<*()4@ '($ C"$$LLg4$z$u`$ $LLg4$z$u`$LL<${$ux  0! $LL<(${@ $u $LLg4${l$u`  0! LL$t$u`$LL$ $u` l$LL$0$u` $LLg4${$u`  0! sLL$u $u`$i<'W$!'h|xtp B0B@! T<#4B b 0LLL$BH$$u$+ <4   $LL'u $ 0<4B b0LLL<$BH$$u$4 د <4B b0LLL<$BH$$u$4 #%!< 4B b$0LLL< $BH$$u$"4  b(b@=$ $bLLG $T$u $S !|xtp'3`"$bxBU8<4B bc.b 0LLL$BH$$u$<_bB<U8<4B b.b @$L$cvC!D !LL${$u 0! `8! $0B0B@"C$ d 4($$<,*.4 '($ C&$$B0B@3$LL$ $u y$#Lb$ D L4$| 'u h$LL<$|T$u 0! $% 0B@0 LL$BH'u$$? $ %B0B@ LL'u$$? $ % 4c0B@ 0 LL$BH'u$$> $ %b0B@ LL'u$$> $ % $C$ % 0B@0 LLL$BH'u$$? $ %0B@ LLL'u$$? $ % $D$0c` 0 LLL$BH'u$$> $ %0B@ LLL'u$$> $ % 4B LL4$|x'u 8! LL$u $u8!$y  .$*F0#$$@$L$cv8C!D !LL$0$u $LL${$u 0! `8! $0B0B@ LL4$|'u 8! "C$ d +4$B0P<$ ijh4@ 'h$ C $LL<$} $v 0! $$#Lb$ D fL4$}4% 0B@0 LLL$BH'u$$? $ %0B@ LLL'u$$? $ % $D$0c` 0 LLL$BH'u$$> $ %0B@ LLL'u$$> $ % 4Bw % 0B@0 LL$BH'u$$? $ %B0B@ LL'u$$? $ % 4c0B@ 0 LL$BH'u$$> $ %b0B@ LL'u$$> $ % $C$> LL$t$u8!$$$.$E(#<'I!'PLHD@<8 "0B@!T<4B b 0LLL$BH$$v\$+ <4   $LL&v\ $ <4B b0LLL<$BH$$v\$4 د <4B b0LLL<$BH$$v\$4 E< 4B b0LLL< $BH$$v\$"4 `$bu"R8@<C4B bw0LLLC$BH$$v\$<"<R8@<C4B b`0B@ 0B@0B@ $D$B0c`ά 0B@ '(4B Dr4<4) ($ C$$("0B@ $PLHD@<8'XLL$ $v\ $LL$0$v\ $ $`$0B@ 0B@0B@ $D$B0c` 0B@ '04B c4D<$c0 4@$ Cj$$L 0B@0 LL$BH&v\$$? $ "0B@ LL&v\$$? $  4cB0B@ 0 LL$BH&v\$$? $ b0B@ LL&v\$$? $  $LC$ f4$} &v\ E$LL<0$} $v $ LLL&v\$$? $ n0 LLL$BH&v\$$? $ U LLL&v\$$? $ >0 LLL$BH&v\$$? $ %LLf4$} &v\ LL$t$v\ $L 0B@0 LL$BH&v\$$? $ "0B@ LL&v\$$? $  4cB0B@ 0 LL$BH&v\$$? $ b0B@ LL&v\$$? $  $LC$ f46$~8LL<$~$vt @0! k$LLf4$~ &v\ 6LL$u $v\$s LLL&v\$$? $ :0 LLL$BH&v\$$? $ ! LLL&v\$$? $  0 LLL$BH&v\$$? $ <'>!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$v$+ 4   $LL$ $v <4B b0LLL<$BH$$v$4 دC`< r4B B0LLLc< $BH$$v$"4  0B@"0B@b <4cC$%0G "0B@1 <@C%$ @l@ !R$ b  @N!"&C0Bd@P$40,('8LL$ $v $ LLL$v$$~ <@ 0 LLL$BH$v$$~ <@  LLL$v$$ < hE  C L<$"@8! 0! LL$,|$v $S#0 LLL$BH$)$v$ < $<':<!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$v$+ 4   $LL$ $vď <4B b0LLL<$BH$$v$4 دC`< r4B B0LLLc< $BH$$v$"4   $ @9@ !R$ b  @!"&C0Bd@P40,($'8hE  C L<$"@8! 0! LL$ $vď LL$,|$v $u<'7p!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$v$+ 4   $LL$ $v䏼 <4B b0LLL<$BH$$v$4 دC`< r4B B0LLLc< $BH$$v$"4  0B@"0B@b <4cC$%0G "0B@1 <C%$ @l@ !R$ b  @N!"&C0Bd@P$40,('8LL$ $v䏼 $ LLL$v䯢$$ < 0 LLL$BH$v䯣$$ <  LLL$v䯢$$~ <@ hE  C L<$"@8! 0! LL$,|$v $#0 LLL$BH$)$v$~ <@ $<'3!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$w$+ 4   $LL$ $w <4B b0LLL<$BH$$w$4 دC`< r4B B0LLLc< $BH$$w$"4   $ @9@ !R$ b  @!"&C0Bd@P40,($'8hE  C L<$"@8! 0! LL$ $w LL$,|$w $7u<'0H!'xtplhd` !b0B@!@T<G4B  0LLL$BH$$w$$+ <4   $LL$ $w$ Q <#4B b0LLL#<$BH$$w$$4 د0 <4B b0LLL<$BH$$w$$4 BD< 4B b0LLL< $BH$$w$$"4 `$bb@DHLPTP8<4B b0LLL$BH$$w$$<~4+ 8!0B@D ! '@ @ 8!E 0B@0B@ 4c0B@ 0B@~ $JC$ 4"0$c$0u5$(@$ $$  $LL$$ $w@ $<Y !\X4@ 'X$ CH$$b0B@ $xtplhd``!'LL$ $w$ $b<(,048 $ E0 LLL$BH$w$$$> $ ELL$@$w$$ G$LL4$l $w$ lLL$u $w$$LL$t$w$$ LL4&w$$ $ E 0B@0 LL$BH&w$$$> $ Eb0B@ LL&w$$$> $ E $D$0c` 0 LL$BH&w$$$@ $ Eb0B@ LL&w$$$@ $ E $4BĬ LL<$$w` 0! $ LLL$w$$$@ $ Et0 LLL$BH$w$$$@ $ E[ LLL$w$$$> $ ED0 LLL$BH$w$$$> $ E+LL$@$w$"$󏄀LL4$ $w$  <'%!'D@<840 !B0B@! T<'4B  0LLL$BH$$wx$+ <4   $LL$ $wx '<4B b0LLL<$BH$$wx$4 د <4B b0LLL<$BH$$wx$4 "D< 4B b0LLL< $BH$$wx$"4 `n$bBP8<4B b0LLL$BH$$wx$<`o0B@^% B0B@0B@ 4c 0B@k 0B@U $b$ b4<$B(4@  '($ C($$B0B@ $D@<840`!'HLL$ $wx $B<D8<4B b`$0B@y% B0B@^0B@H 4c 0B@. 0B@ l$C$ ! $ LL$0$wx $ $ LLL$wx$$@ $ %0 LLL$BH$wx$$@ $ % LLL$wx$$= $ %0 LLL$BH$wx$$= $ %LHg4$( $wx ~LL$u $wx J$LHg4&wx$X $ݎ% B0B@0 LL$BH&wx$$= $ %B0B@ LL&wx$$= $ % $D$0c` 0 LL$BH&wx$$@ $ %b0B@ LL&wx$$@ $ % $4B䬢 HL<($ $w $HLg4$ $wx LL$t$wxz$ LLL$wx$$@ $ %0 LLL$BH$wx$$@ $ % LLL$wx$$= $ %m0 LLL$BH$wx$$= $ %T<'!'h|x !!b0B@`! T<'4B  0LLL$BH$$w$+ <4   $LL$ $w 4<4B b0LLL<$BH$$w$4 د <4B b0LLL<$BH$$w$4 b<U8<4B b0LLL$BH$$w$<"D< 4B b0LLL< $BH$$w$"4 `_$b+$L`dhlpt8!B0B@ 5R!(@8!BB0B@($$b !D '` @5S!(`%8!bB0B@ LL$t$w 8! ($$b8!LL$t<$w$ $|x!'(,048<8!B0B@4R!(@8!BB0B@($$b8!D ! '( @4S!(`8!bB0B@ LL$t$w 8! ($$bLL$t<$w8!$LL$th$w $ $% 0B@0 LLL$BH$w$$>4 $ %b0B@ LLL$w$$>4 $ % 4c0B@ 0 LLL$BH$w$$@@ $ %B0B@ LLL$w$$@@ $ % $C$ 0$b`d5@DhlHLpt<PTX4 '@$ C $HL<$$x @0! $$b0B@ $LL$ $w $LH4&w$ $&% 0B@0 LL$BH&w$$>4 $ %b0B@ LL&w$$>4 $ % $D$0c` 0 LL$BH&w$$@@ $ %B0B@ LL&w$$@@ $ % 4B 5R!(`BB0B@ LL$t$w 8! ($$b$L&w$t<8!{$:LL8!$th$w $ $BB0B@ HL5$< $w l4B 'l5HLS!C($$w8!$ MHL$$w 8! (HL$$w $ʏ  $HL5$4 $w LL$t$w$$ҏLL$0$wίLL$@$w$HL$$w $ʏ 9$HL4$d $w LL$u $w$\LL$th$w $ $4HLS!C($$w$qHL$$w 8! (% 0B@0 LLL$BH$w$$>4 $ %b0B@ LLL$w$$>4 $ % 4c0B@ 0 LLL$BH$w$$@@ $ %b0B@ LLL$w$$@@ $ % $C$ (,4@D04<HL8<XPT4 '@$ C $HL<$$x @0! $$BLH4&w$ $% 0B@0 LL$BH&w$$>4 $ %b0B@ LL&w$$>4 $ % $D$0c` 0 LL$BH&w$$@@ $ %B0B@ LL&w$$@@ $ % 4B 4R!(`BB0B@ LL$t$w 8! ($$b$L&w$t<8!$LL8!$th$w $ $LL$@$w8!$<' !'@<840,( !!B0B@@! T<'4B  0LLL$BH$$x$+ <4   $LL$ $x '<4B b0LLL<$BH$$x$4 د <4B b0LLL<$BH$$x$4 B<T8<4B b0LLL$BH$$x$<"D< 4B b0LLL< $BH$$x$"4 `T$bUyb0B@h% B0B@b0B@ 4c0B@u b0B@_ $C$ 5<4 0!$ C4$$)B0B@ $@<840,(`!'HLL$ $x $$b0B@% B0B@b0B@ 4c0B@ b0B@ $C$ 4<4 0!$ Ck$$LH4$X&x$ % B0B@0 LL$BH&x$$>\ $ %B0B@ LL&x$$>\ $ % $D$0c` 0 LL$BH&x$$? $@ %b0B@ LL&x$$? $@ % $4B@P HL<$$x0 0! $ LLL$x$$? $@ %n0 LLL$BH$x$$? $@ %U LLL$x$$>\ $ %>0 LLL$BH$x$$>\ $ %%HL4$ $x LL$u $x $LL$0$x $&LH4$X&x)$ HL<$$x0 0! $HL5$ $x LL$t$x$믥 LLL$x$$? $@ %0 LLL$BH$x$$? $@ %z LLL$x$$>\ $ %c0 LLL$BH$x$$>\ $ %J<'d!'ȯ40,( "0B@!V<4B b 0LLL$BH<$$xD$+ 4   $LL$ $xD <4B b0LLL<$BH$$xD$4 دC`< r4B B0LLLc< $BH$$xD$"4   $ @9@ !R$ b @!"&C0Bd@P40,($'8hE  C L<$"@8! 0! LL$ $xD LL$,|$xD $ou<'!'<840,( "0B@!T<4B b 0LLL$BH<$$xd$+ 4   $LL$ $xd <4B b0LLL<$BH$$xd$4 د <4B b0LLL<$BH$$xd$4 E< 4B b0LLL< $BH$$xd$"4 `$bh"D8<4B bj0LLL<$BH$$xd$4 "<D8<4B b@{$̏b0B@mT @ !  $ @p@!$&TD< C @ @4B B@?"0Bt@ P$<840,('@LL$ $xd $LL$0$xd $  $@?b0B@HG4$L $xd hE  C L<$"@8! 0! HG4$LLL$u $xd $LL$,|$xd $ LL$t$xd$<'|!'X !!b0B@`! T<'4B  0LLL$BH$$x$+ <4   $LL&x $ 2@<C4B b0LLLC<$BH$$x$4 دP <4B b0LLL<$BH$$x$4 "G< 4B b$ 0LLL< $BH$$x$"4  b$b0B@$@0B@0v 0cL $=d 0c$bb0B@`$bP8<4B b0LLL$BH$$x$<[<P8<4B bT@8!0B@$ B0B@[0B@E < C% 4<0u)(40 '($ C)$$b0B@4<024 '0 U$$bb0B@ $'LL$ $x $H $( sLH&x $ LLL$O$x $ < $T3@8!0B@"$$ B0B@0B@ < b% 4<C$B0P=8?]9:;<>4@ '8$ CJ$$$L B0B@&x0 LL$BH$$> < $b0B@&x LL$$> < $ <4Bb$ H4$&x$  _$LL$0$x $ , S$HL<$$x 0! $HL4$$x$ ׏LH4$$&x @0! LL$u $x$ $L B0B@&x0 LL$BH$$> < $b0B@ LL$$>&x < $ <4Bb$ H4$T&x$ HL<$$x 0! $ LLL$&x$> < $0 LLL$BH$ȯ&x$> < $ LLL$&x$> < $0 LLL$BH$ȯ&x$> < $$LH4$&x @0! $LL$t$x1$ 򏄀L $=p HL<$$x 0! x$HL4$$x @0! a<'!'LHD@<840,( !0B@!`T<g4B  0LLL$BH$$x$+ <4   $LL'x $ p<4B b0LLL<$BH$$x$4 د  <#4B b0LLL#<$BH$$x$4 'bG< 4B b$ 0LLL< $BH$$x$"4  bR $@! $#`$b8Q8 <#4B b#0LLL$BH$$x$<w@8!0B@!d B0B@0B@ H< C% ''$4&H'  '$ $ ȣɏʣ˒QB0B@$0B@$B4&31$B0Vz'ȏX' $ q'X(! $ eѣңӣԏ<C !֣4@ '$ CG$$4  ! 0B@$LHD@<840,('PLL$ $x菼 $<R8@<C4B bC^8!"0B@d B0B@"0B@ < xC% 4'( !(!$RQ 0w &3'+X$1* ( '](!X $1 &H'X $1 $$<@ !4   0!$ C$$dL B0B@'x诤0 LL$BH$$> < d0B@'x诤 LL$$> < d <4Bb$ H4$T'x$  V$LL'$0$x $ D J$LL$O$x $ U ?$LL$u $x$ dL B0B@'x诤0 LL$BH$$> < d0B@ LL$$>'x < d <4Bb$ HG4$'x$ 6HL<$H$y 0! e$ LLL$'x$> < d"0 LLL$BH$ȯ'x$> < d LH4$t'x 0! HL<$$x 0! $ѣңׯ LLL$'x$> < dK0 LLL$BH$ȯ'x$> < d2LHG4$'x 0! LL$t$x'$ <',!'lhd`\XTPLH !0B@!`T<g4B  0LLL$BH$$y$+ <4   $LL%y $ t<4B b0LLL<$BH$$y$4 د <4B b0LLL<$BH$$y$4 bG< 4B b$0LLL< $BH$$y$"4  bO $@! $`$b5R8@<C4B bC0LLL$BH$$y$<w 8!0B@!d B0B@0B@ H< C% '(',$4&H'0 '404 Уя(,ңӒQB0B@$0B@$"4&3^$B0B<'ЏX' $ (!X' $ ٣ڣۣ܏<C !ޣ4@ '$ C$$0B@"4D$ $B<" !4@ ' P$$bu0B@$lhd`\XTPLH'pLL$ $y $<W8<4B bI 8!0B@d B0B@0B@ < xC% 4'( !(!$8Q 0r &3'+X$1* ( (!']X $1 &H'X $1 8$$<£4   0!$ C$$N0B@=4<ȧ4 'ȏ Q'$$bsHL4$$y$  n$LL$0$y $ b$LL$O$y $ W$HL<$$x 0! $HL4$$y 0! dL B0B@%y0 LL$BH$@$> < d@0B@ LL%y$̯@$> < d@ <4Bb$ H4$T%y$ 鏄HL<$H$y @0! m$ LLL$%y$> < d)0 LLL$BH$ȯ%y$> < dLH4$t%y 0! LL$u $yW$ ¯ LLL$%y$> < dI0 LLL$BH$ȯ%y$> < d0LH'4$%y 0! LL$t$y"$ HL'4$$y$ }HL< $ $y4 x$HL'4$,$y 0! ^dL B0B@%y0 LL$BH$@$> < d@0B@ LL%y$̯@$> < d@ <4Bb$ H'4$%y$ fHL<<$ $xЏ $٣ڣ룠<'!'ȯ0,( "0B@!V<4B b 0LLL$BH<$$yH$+ 4   $LL$ $yH <4B b0LLL<$BH$$yH$4 دD< 4B b0LLL< $BH$$yH$"4 4 " 0B@`0,($'8LL$ $yH <'!'p|xtp !B0B@! T<'4B  0LLL$BH$$yd$+ <4   $LL&yd $ 0<4B b0LLL<$BH$$yd$4 د <4B b0LLL<$BH$$yd$4 "F< 4B b$0LLL< $BH$$yd$"4  b`)$bD$B,C"8`HL$cyC!D !LL$T$yd`8! $ ޏ !|xtp'B<S8`<c4B b0LLLc$BH$$yd$<Y66$,b"@vL$cz$C!D !$`0c<4B b$ B0B@ LH4$\&yd 8! % 0B@0 LLL$BH&yd$$? $ %0B@ LLL&yd$$? $ % $D$B0c` 0 LLL$BH&yd$$? $ %0B@ LLL&yd$$? $ % 'h4B 4d$ $c0p<ijh 4@$ C $LL<$} $v 0! $$B0B@1$LL$ $yd ($%L 0B@0 LL$BH&yd$$? $ %B0B@ LL&yd$$? $ % 4cB0B@ 0 LL$BH&yd$$? $ %b0B@ LL&yd$$? $ % $HC$ 4$ &yd $LL$t$yd8! $@8!$@8!$@8!$@8!$@8!$@8!$@8!$@8!$ @8!$ @8!$ @8!$ @8!$ @8!$@8!$@8!LL$0$yd $ $@8!$0uB0B@% 0B@0B@ $D$B0c` 0B@ $4B 4d<($*,.4 '($ Cf$$%L 0B@0 LL$BH&yd$$? $ %B0B@ LL&yd$$? $ % 4cB0B@ 0 LL$BH&yd$$? $ %b0B@ LL&yd$$? $ % $HC$ 4$􏄀LL<$|T$u 0! $ LLL&yd$$? $ %n0 LLL$BH&yd$$? $ %U LLL&yd$$? $ %>0 LLL$BH&yd$$? $ %%LH4$@&yd 8! LL$u $yd8!$ G$$$$$$$$$$$$HL<$ $y $$$<'p!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$$+ 4   $LH$s $ <4B b0LHL<$BH$$$4 د <4B b0LHL<$BH$$$4 "0B@ $  $ l (!# 0c`0,($'8HH$$ 0! LH$ $ <'!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$$+ 4   $LH$s $ԏ <4B b0LHL<$BH$$$4 د <4B b0LHL<$BH$$$4 "0B@ $  $ l (!# 0c`0,($'8HH$$$ 0! LH$ $ԏ <'È!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$$+ 4   $LH$s $ <4B b0LHL<$BH$$$4 د <4B b0LHL<$BH$$$4 "0B@ $ l (!# 0c`0,($'8HH$l$ 0! LH$ $ <',!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$$+ 4   $LH$s $ <4B b0LHL<$BH$$$4 د <4B b0LHL<$BH$$$4 "0B@ $ l (!# 0c`0,($'8HH$$ 0! LH$ $ <'!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$4$+ 4   $LH$s $4 <4B b0LHL<$BH$$4$4 د <4B b0LHL<$BH$$4$4 "0B@ $ l (!# 0c`0,($'8HH$$4 0! LH$ $4 <'t!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$T$+ 4   $LH$s $T <4B b0LHL<$BH$$T$4 د <4B b0LHL<$BH$$T$4 "0B@ $ l (!# 0c`0,($'8HH$$T 0! LH$ $T <'!'ȯ0,( "0B@!T<4B b 0LHL$BH<$$t$+ 4   $LH$s $t <4B b0LHL<$BH$$t$4 د <4B b0LHL<$BH$$t$4 "0B@ $ l (!# 0c`0,($'8HH$H$t 0! LH$ $t <'!'ȯ40,( !B0B@!T<4B  0LHL$BH<$$$+ 4   $LH$s $ <4B b0LHL<$BH$$$4 د  <#4B b0LHL#<$BH$$$4 '#`4$bKB0B@"$ l (!B 0B@$40,('8LH$ $ $HH$$ 0! B0B@  $ $HH$$ 0! LH'$0$ $Z $<'!'ȯ40,( !B0B@!T<4B  0LHL$BH<$$$+ 4   $LH$s $ <4B b0LHL<$BH$$$4 د  <#4B b0LHL#<$BH$$$4 '#`4$bKB0B@"$ l (!B 0B@$40,('8LH$ $ $HH$$ 0! B0B@  $ $HH$$ 0! LH'$0$ $ď $<'!'ȯ0,( !$$$ ($01bHH0B$&% 0!8!C$0,(!'8  H&%  $D $H&%  $ 0,(!'8<'h!'Я,($ H!"L$0B$D0RC$  $8@!$HH$@A$D#HH@8!<4B 0c4  $(,0$D$r!pT ! 4#LH0c$r $D!,($ '0 ! f g $<'!'Я,($ H!"L$0B$d0RE$  $8@!$ȏHH$,@C$d#HH@8!<4B 0c4  $(,0$d$tr#pT$ !4 5#LH0c$r $d!,($ '0 ! f g $<'!'840,( $!b0BC!$ # "#1(()"$bE" 0B" $b$" $0BC%" 0D$0cC%" $b1" 0B" $b1" 0B" $b{$"$0BC%"0$D$0c$$C%c0B"$0bR$RC840,(!'@" 4B" 4B" $b"# 0B4c4B# ͦ"c4B"$0bR"#HH&'$ &$ "#& ' H$ &c 0bRLH$ $ LH$ $ ^HH$,$ $4 $840,('@HH$,$ $k $<'!'hd`\XTPLH@<4B c$!0cr!&X7$# $b$<4G g(! <4B b0LHL$BH<$$$4  @ $b0BR HH$0$ $@ X$$ " . "- ",#4$ &(%$&0$'%$v$ +P"\$ L$" b0BC#$hd`\XTPLH`!'pP$&0$ +P"\$ L$" b0BC &X    HH($,048$l$ 8!@$X\ ()* +$,P HH$(,04$4 $@7HH$ $@$HH$ $8@<C4B b0LHLC<$BH$$$+ 4 1`$b<4B b 0LHL<$BH$$$+44 <4B b4# $d!`$$b$b/ 8! ', $'H$cC!D !b$0BC$$100$ $b0BC0$'<ff4Ufg1b@#$b0BCC#1  $@@@!$ <  &4B R`hD  @ EL<$"@8! @0!@BVD VB@B"0B@@&C`+0$BHEB"L<8B0B$@0! 8!@$$$@uHH$($ $䏼@$0$b0BC|00$y$b0BCrH$TH $@j00$$b0BCS0$1'3$b0BC=j10LHL$BH$$$$  5LH$0$ $@V$ LH$,|$ $;HH8!$p $@'+HH$p $'@&1HH$ $@0H$HH$ $@$$1颃0HH$$ $,` @ !@M@ !HH$ $@ۢ0e hD @C,\<4B $$$ <'X!'Я,($  ! $R@1@!x@ !(! $R0c`Bq@B7@ $OD80b0$PbBn@ $ODo0b0$PbF, @!$ &3H` !&E 0!!0c`@HF ,@!$"Q &334B"Q` !&E  0!0!0c`r@3F:,3@!$2"Q &E;4B"Q ! 0!0!0c`T@$Q00b@ 0B@B0B@C400B@0B@B0B@4 "Q0B@  !,($ '00B@v$Dr0b0@nH $\fH $p !HH$t $ Q@ !"QH (! $H`(! $H`(! $i0B@1"Q4BI"Q0B@0"QDo4B:"Q0B@"Q4B@&"Q0B@""QD84B "QH $В"Q4B@"QH $"Q4B"QH $$H $TH $Drr0HH$$  $T!<' !'ȯ40,( HD$ $Ɠ $ @!$@$ @!0!$ "0(!$ H!$B  @!0!@HH !̏$4Q$ЏH`!$ $B|$  $HH$P $Џ40,(`!'8HH$$ 40,($`!'8<'!'ȯ40,( HD$ $Ɣ` $@!$ U$H@P$B|$ (! 0! PU@!$ H@$B$ $ 0! QH@!L@$B^$ $ 0! P=@!L@$B`$ $ 0! Q2@!H@$B$ $ 0! P'$40,(`!'8H$ԏH $0 40,($`!'8H$H$TH$H$܏H$(<'!'Я($ h!H"X!0B@&$  $@!$CHH<$@$"H<0B$ (!c @ !($ '0 !  !<'x!'HD@<840,( h!!b!0B@M0g'+@@cQ!u!< 4B qW$QB @b0B@9$B Q< 4B fT9@ b0B@ HD@<840,($'PbH<U!CF $,g (! (!H< $h LHH<$$$ƙ $ $0HHH<$BH$$$Ɨ $ $HD@<840,('P HH<$$ 8! $HH<$0 $HH<$h$  0! $0HHH<$BH$$$Ƙ 8!<'d!'Я,($ h!"0B@0"(+@8@,$GpH<@(!$ 0!  $ @0@0!&BDF#0c`"D(D+@#@D!C!B H<$@(! 8!$,($ '0#D!C!G ,$BpHH<$< $$<'!'840,($ h!0B@Q0  $,@b@!$C+$D$Q$R< 4B *`8!  $@& (! '@!$b4&4$BG !(!'QCr S$0B@ (!$840,($ `!'@H< $l$HX $4  !$840,($ `!'@HH<$ $$<'!'Я($ h!b0B@"0@$D8$ < 4B )4 !  (!$C$b0B@0!$($ !'0(!H< 0! $H<@(!$(  8!$HH<$`$ 8!$HH<$$ @0!$<'t!'Я($ h"0B@<! < 4B Q('+@U#@F!b8!< 4B b0&&4d !eC "0B@(!($ $'0H< $ȏ(!H< $ HH<$$ `0!$($ '0HH<$`$ 8!$HH<$h $<'!'ȯ40,($ !!!"!Hy$p,B@X" Phb0B@0 40,($ $'8hbB0B@$HX $0$p" $ $$B " hb0B@0 " C+@$" Rh0B@2 B0B@HX $P$ $hhb0B@HHL<$$$Ɯd $0 B@^$hB0B@(!# 0b@nB0B@B!0B@B0B@"YD B0B@]$HX $" LHH<$$$Ɯ $Z0 HHL<$$$ƙ $u0 hbB0B@DHX $<hbB0B@ (!H< $ԏD$LHH<$P$$Ɯ $B!0B@AB0B@Q"YD # B" LHH<$$$Ɯ $72 H< $ cLHH<$P$$Ɯ $B0B@kHX $ cB0B@HHX $H# @BHX $lHHX $<'!'HD@<840,( h!!@d!C!#< 4B !b!#$bB0B@C F $C!0$!*@$$HH<$$00 @8! HD@<840,($'PB0B@f $b@B0B@(!C 0b@Bb!0B@B0B@-ByD C B0B@b!B0B@B0B@ByD C $b$b6B0B@HX $菼 B0B@-$HD@<840,('PH<& $ @(!C F $C!0$ p!B0B@l`0!8!@ !  (!H<& $@ @(! $H<% f $t B0B@Hf<%  $@fB0B@(!B C $BpB 0B@!P B #C+@$B P0B@{hP bB0B@HX $~LHH<$$0$ƙ $ ԢP " HH<$$0`0!  8!0#HHH<$BH$$0$Ɨ $0B@=(!H< $$5H<% f $d H< $ B0B@HX $B0B@BHX $H< $ kB LHH<$$0$Ɯ $ xHX $@HX $dLHH<$P$0$Ɯ $ W<' !'LHD@<840,(!)$&, hB0B@$(+@&p@D!C!F H<(! $ < 4B &n$,$ !!CB0B@(+@'p@D!C!F Hb<$ȯ(! `8!U%U!@!B0B@ (!&0$ f  !#0bRB0B@0c$b155UF$*0b& B0B@$(+@'p@D!C!F Hb<$(! `8!$ f  !*pB0B@(+@'p@D!C!F Hb<$d(! `8!B0B@(+@'p@D!C!F Hb<$(! `8!4 ` !$HB0B@(+@&p@D!C!F H<(! $쏼*$b'B0B@(+@&p@D!C!F H<(! $$Ɛ  !$C$ $LHD@<840,('PH#P!b!< 4B u @|0B@3 !\ d"$B"0c`LHD@<840,($'PH<(!$ @0! H<(!$ @0! LHH <$$$ƪ@ $  HH<$$`0!  8! $LHD@<840,('P0#HHH<$BH$$$Ɨ $ $"HH<$0$ 8!0 HHH<$BH$$$Ʀp 8!<'c!l$$d cc`<'b!'Я( 0<$4B b0HHL<$BH<$$$`$ƪ 4   $('02<'b0!'ȯ0,( !<$4B b0LHH<$BH<$$$t$ƪ 4   $@| 0!2@g (! 20B@(!4   20B@}(!4 $ 20B@e(!4 $(& 20B@I 4 ( 20B@`(!4 (&l4$Be  !2 0B@ (!0,('8H<$ 0! H<0!0,($ '8HH<$$t 8! H< $ (H< $@ $H< $p  |H< $ dH< $Џ (2<'^!'LHD@<840(l!0" 0c@02B@  $4(@O@!%$C R2S0T1$D<$4B c `2",0c$B"$. $(`0   (@E0 !@!0$`0*@$c20b@0@1   (@ 1 !@!1$`0*@$c20b@0@000    @@ !(@$0100C@@!H!$ 01%00@0I!  *J20b@0@,  !  (@(,0!<' 4G (!($!@,G@0+@@ `$20b@0@B$4 !LHD@<840!'PH $(C !2B@CH<(! $(;H<0 $$(WH<1 $L(jH<0$ $t0! $(2V0bH<$$ $(!0! &4( !H<0 $(1YH <0$ $$0 0!(21D0bH<, $d(g0H$<$$$0  0!(2Q0b0H(0!<0$ $0! $(2a0bר  !(8!HH<$ $(T !HH<$L$ 0!(J !H<$xH8! $(ר  !(9 !H<$<'X!'HD@<840,( !0cg4<$4B b0LHH<$BH<$$$$ƪ 4   $.,1b00'+@/10bb+@*0bQ!40W(T!D!C<' 4B bM@BH<$H8! $ 4HD@<840,(`!'P1HH<0b$$ 8!$@$b!d20B@0!.!$Bզ.H<$  4 .!$BȦ.H<$@$ b!hEFU  !@! @CB B !@$ C d!EC$0D+`20B@!GHB<$p0!  HC!!'Я( 0<% 4c $0HLH<$BH<% $$$Ʋt 4   $('0!<'>H!'Я( <% 4c $0HLH<$BH<% $$$Ʋt 4   $('0<'=!'Я( <% 4B b0HHL<$BH<% $$$Ʋt 4   $('0<'=!'<840,( $;! <!4B b&" 0LHH<$BH<!$$$Ƹ4   $b@#:0d0@&" 4b< ":4t &2P@ ! !%  !C @ ! %&TԮ#4b@2"4\$0E  @0!$ C$cHH<$ $ $4b@#:0d0@&" 0b":c`<840,($'@he $0 #4%,Hf <$ @8!  0! "4$0\E  @0!$ $H<%,$H  0!$4 @"h $0 #4%,Lf <$@8!  0! $4$4o0B@ @4 _ 4@h $0 #4%,Hf <$x@8!  0!{0HHL<$BH$$$ƹ $ #:34bHH<$ $ #HH<$ $ l0HHL<$BH$$$ƹ $ #:U0b0LHL<$BH$$$"8!믢h $0 %,'4H<$  0! .&" <'7!'840,( $/!<!4B b&0LHH<$BH<!$$$Ƹ4   $B@"0d0@&4b< "4s .C%$SB@1\E  @0!$ B$bHH<$ $ B@"0d0@&0b"C`840,($'@he  Hf <$ @8! 0! \E  @0!$ $H<$H 0! "@"h  Lf <$@8! 0! z0B@ "@4 j"@h  Hf <$x@8! 0!|0HHL<$BH$$$ƹ $ "?4bHH<$ $ /HH<$ $ m0HHL<$BH$$$ƹ $ "V0bh  H<$ 0! >0LHL<$BH$$$"`8!毢&<'2!0HH<$`0!$ `C <'2!$$d cc<'2h!'ȯ0,($ !!!0- !" @1  $$@N@!<!4B  !" !(!@0! `8!@-$& D $"$c   !0,($ !'8$ $C !H<$X0g 0! !HH<$|$0 $!4  ! !HH<$$0 @0! !<'0!'ȯ0,($ !!!02 !" @6  $<@\@!<!4B  4,89: !(!@0! `8!@204& (!$&$D8$"$c$8 !0,($ !'8$ $C !H<,$X0g 0! !HH<$|$H $$4  ! !0,($ !'8HH<$$H @0! !<'.!'ȯ0,( $z!<!4B b&0LHH<$BH<!$$h$Ƹ 4   $DI@;0&   d $G "@ @ "@14  ! 0,(!'8H<$0 0!  ˮHH<$$h 0! HH<$$h 0! H<$8 0! &<',d!'ȯ40,( $! <!4B b&B 0LHH<$BH<!$$$Ƹ 4   $P$  ! P !& + IB4@;D00&E$B$C$@$d@B8$GG8@9B8@ @ 4 @ ! 40,(!'8HC$\b'D$B`!D$c $B $$Bկ$$B $B 8b'D$B`!D$c $B $$B$$!,('0<'h!'x!'H@0!$, 'H@ ! @x'$, ' $B'@8!0 xx!'<'`!'TP!X\`dX\'$,t HH@`@HL`'dd HHLL!TP'X<'!' ܯ!TX$@(B@~' $,t PP@@Pn' T'@ !H$,P '`'@ !`(!| @O'`'@ !' $`8!@ @'`@ ! @6&'`@ ! ' b!Cp$b' b!Cp' C!T' b!Ct' C!XX@T PPЏ@$Џ!܏'<' !'d`!hlphl XXpb\'H$<p` hl'$?0 \\!d`'h<'<!'x!'$,t xx@$|'H@ !'$,$, x'H@ ! xx||!'<'`!'௿! $ $ !' <'!'د$ !@H$@H$T'$ @ ' @!CH$`H$t'$ @]' $b'(b@@ C$b+<H$|H$$@  (H$|H$$@  H$|H$$@  B!$ '(<'!'د$ !( !0 B@Bb!(@(b!$ '(<'!' ܯ!䏄H$؏H$菙  @ !0 $'$@ ! ((B$B H$@0!Θ (((B H$fΘ @ H$䏙Θ A H$䏙Θ  H$Θ   '0H$@(! h(B@@nH$؏H$ ̏@\ ! ԏH$ H$ ȏ@ ̏  ='@ !$̏ @(B @ 'Џ@(!Θ $BЏȏ  ̏  H$ H$؏l ԏ !܏'<'!@!H!P!Yp!+@v4G+@2!<4BG+@$$T$ D!Cf!0# D#NbH%pP D( 1L$(0D0%X+( `0!+@$+@H0# 1H8D8%,X+ ` 8!+@%)+@%)I(%h!!!+@(!4F+@z,<4BF+@$$T$ D!Ce!0#v # +@$+@(!$h!O$4J+@U<-B,E(T$ D!Ce!0# #*H#$  D1O( $`0D0%X+( `0!+@%+@0# 1H8D8%/X+ ` 8!+@%)+@%) I(%!!F 4PJ+@-B<4BJ+@$$,ET(D!C$ e!0# + #b@%Xdl 1CH% $px8D8%(h+l ` P8!+@$+@%8!8# 1$(0D0%h+ ` 0!+@$+@0!$E(%0#+@f&h!+@"$h!,,F0PX Dh 1OCH% $h8D8%(`+h ` p8!+@$+@%8!8# 1$(0D0%`+ ` 0!+@$+@ $0! Eh%H#$0!%%0!<'!'௲@!'`!x!%P!+@W4G+@!<4BG+@$$T$ D!Cf!0##ObP%`x LI  (R1+@ 4!! ' F+@,<4BF+@$$T$ D!Ce!0## +@ #+@+H#bP#x!@!@!YX ' O$4L+@U<-,E(T$ D!Ce!0##LP# L1I  (g$D(%X+I  `(!+@+@(!(#  1@D@%gX +  ` @! +@ +@ @!@ x#!YXF 4`L+@-<4BL+@$$,ET(D!C$ e!0# +# b@% Xlm 1bP% $`8H DH%(p.+m ` x(H!(+@$.+@$(H!.H#- 1D(X DX%pn+- ` hX!h+@$n+@$hX!E%nX#L(e+8` #+@+#b(#8!@9#e #+P# (%Y/X,,F0` X Li  1CP% $(@D@%(+i  `x @! +@+@ @!@#   1DX DX%g(e+   `eP#lX!l+@eP#e+@lX! eP#<'!'د  '9 ̏9$ & " $& 1& '(x! $!x! $!x! $ x! $ ُx! $ ؏x! $ ԏx! $ Ώx! $ ȏx! $ x! $ x! $ x! $ x! $ x! $ x! $ vx! $ mx! $ Zx! $ Yx! $ Px! $ Fx! $ ,x! $ x! $ x! $ x! $ x! $x! $x! $x! $ꏙx! $ԏx! $x! $x! $x! $x! $x! $x! $x! $x! $x! $wx! $rx! $cx! $ax! $Cx! $Ax! $.x! $ x! $x! $x! $ x! $x! $x! $䏙x! $׏x! $яx! $Џx! $Ώx! $͏x! $x! $x! $x! $x! $x! $x! $x! $x! $yx! $kx! $`x! $Sx! $Hx! $Ax! $?x! $/x! $x! $x! $x! $ꏙx! $揙x! $⏙x! $܏x! $ُx! $֏x! $ҏx! $Џx! $Ώx! $Ïx! $x! $x! $x! $x! $x! $x! $}x! $nx! $mx! $dx! $`x! $Ux! $Nx! $Mx! $2x! $1x! $x! $x! $폙x! $x! $ڏx! $ҏx! $x! $x! $x! $x! $x! $x! $x! $x! $x! $|x! $^x! $]x! $Rx! $Lx! $Cx! $,x! $+x! $$x! $x! $x! $x! $x! $쏙x! $Տx! $x! $x! $x! $xx! $tx! $rx! $gx! $^x! $\x! $Yx! $Ax! $1x! $x! $x! $x! $x! $叙x! $ݏx! $܏x! $ӏx! $̏x! $ŏx! $x! $x! $x! $x! $x! $x! $x! $vx! $Wx! $Rx! $Qx! $Jx! $9x! $/x! $-x! $x! $x! $x! $x! $x! $x! $x! $x! $폙x! $㏙x! $ݏx! $x! $x! $sx! $Nx! $Mx! $Dx! $0x! $(x! $x! $x! $x! $ x! $x! $x! $揙x! $ڏx! $׏x! $яx! $ˏx! $ȏx! $x! $x! $x! $x! $x! $}x! $mx! $ix! $Yx! $Wx! $Fx! $6x! $'x! $#x! $x! $x! $叙x! $ԏx! $x! $x! $x! $x! $x! $x! $x! $qx! $jx! $_x! $>x! $-x! $%x! $#x! $x! $x! $x! $x! $x! $̏x! $x! $x! $x! $x! $x! $x! $x! $xx! $rx! $nx! $bx! $_x! $Zx! $Yx! $Mx! $Gx! $<x! $7x! $x! $x! $񏙀x! $x! $Ꮩx! $ȏx! $x! $x! $x! $x! $x! $xx! $lx! $*x! $x! $ x! $ x! $x! $叙x! $яx! $Ϗx! $x! $x! $x! $x! $x! $x! $x! $nx! $hx! $]x! $Yx! $9x! $ꏙx! $菙x! $䏙x! $Ϗx! $̏x! $ˏx! $Əx! $x! $x! $x! $x! $x! $x! $x! $tx! $^x! $Zx! $Hx! $Cx! $?x! $2x! $*x! $%x! $!x! $x! $x! $x! $x! $x! $x! $x! $򏙀x! $珙x! $㏙x! $؏x! $͏x! $Əx! $x! $x! $x! $x! $x! $x! $~x! $vx! $rx! $ix! $^x! $Ux! $Rx! $Qx! $Jx! $=x! $6x! $#x! $"x! $x! $x! $x! $x! $㏙x! $ۏx! $ӏx! $Џx! $x! $x! $x! $x! $nx! $jx! $Sx! $<x! $0x! $'x! $$x! $#x! $!x! $x! $x! $x! $x! $x! $x! $֏x! $ӏx! $Џx! $ʏx! $x! $x! $x! $x! $x! $x! $x! $jx! $hx! $Tx! $Kx! $?x! $0x! $#x! $x! $ x! $ x! $x! $叙x! $ȏx! $Ǐx! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $x! $}x! $hx! $gx! $fx! $]x! $Rx! $Nx! $Cx! $Ax! $.x! $ x! $x! $x! $x! $ꏙx! $鏙x! $Ϗx! $ȏx! $x! $x! $x! $x! $x! $x! $x! $|x! $sx! $hx! $cx! $bx! $\x! $Zx! $Ux! $Ox! $Mx! $Ax! $=x! $/x! $x! $x! $x! $x! $ x! $ 폙x! $ 䏙x! $ ͏x! $ ˏx! $ ɏx! $ Əx! $ x! $ x! $ ~x! $ fx! $ ax! $ Ux! $ Tx! $ Qx! $ Kx! $ 4x! $ x! $ x! $ x! $ x! $ x! $ 򏙀x! $ 叙x! $ ݏx! $ ӏx! $ Џx! $ ďx! $ Ïx! $ x! $ x! $ x! $ x! $ x! $ x! $ ~x! $ kx! $ ix! $ ]x! $ Hx! $ 9x! $ 7x! $ 5x! $ 3x! $ 1x! $ x! $ x! $ x! $ x! $ 􏙀x! $ 󏙀x! $ ꏙx! $ ˏx! $ x! $ x! $ x! $ x! $ x! $ x! $ x! $ x! $ x! $ x! $ |x! $ mx! $ lx! $ ax! $ Gx! $ Fx! $ 2x! $ -x! $ ,x! $ $x! $ x! $ x! $ x! $ x! $ x! $ x! $ 쏙x! $ 叙x! $ 䏙x! $ ڏx! $ x! $ |x! $ yx! $ kx! $ fx! $ bx! $ Zx! $ Jx! $ Ex! $ .x! $ x! $ x! $ x! $ x! $ x! $ x! $ ڏx! $ яx! $ Ïx! $ x! $ x! $ x! $ x! $ x! $ x! $ x! $ sx! $ ]x! $ Wx! $ Gx! $ ,x! $ (x! $ &x! $ $x! $ #x! $ !x! $ x! $珙x! $؏x! $Ϗx! $ɏx! $x! $x! $x! $x! $x! $x! $x! $x! $[x! $Bx! $x! $x! $ x! $x! $x! $x! $x! $򏙀x! $ޏx! $ۏx! $Տx! $ŏx! $x! $x! $x! $~x! $px! $fx! $\x! $[x! $Vx! $Tx! $Hx! $Bx! $<x! $7x! $)x! $(x! $x! $x! $ x! $x! $x! $x! $󏙀x! $򏙀x! $䏙x! $ڏx! $̏x! $x! $x! $x! $x! $|x! $Nx! $Kx! $Hx! $/x! $.x! $*x! $%x! $x! $x! $x! $x! $x! $؏x! $ˏx! $ȏx! $x! $x! $x! $x! $x! $x! $tx! $ox! $jx! $`x! $Wx! $Tx! $Rx! $Mx! $Ix! $Ax! $5x! $4x! $.x! $'x! $x! $x! $x! $폙x! $ꏙx! $ۏx! $Ǐx! $ďx! $x! $x! $x! $x! $x! $x! $vx! $Vx! $Lx! $x! $x! $x! $x! $x! $ x! $x! $x! $x! $󏙀x! $ڏx! $ɏx! $ȏx! $Ǐx! $x! $x! $x! $x! $x! $px! $lx! $ex! $_x! $Zx! $Wx! $Nx! $Kx! $x! $x! $ x! $x! $폙x! $ޏx! $ݏx! $֏x! $ȏx! $x! $x! $x! $x! $x! $x! $x! $x! $x! $sx! $rx! $nx! $lx! $[x! $Vx! $Ax! $7x! $,x! $$x! $x! $x! $x! $ޏx! $ۏx! $ڏx! $׏x! $ďx! $x! $x! $x! $x! $x! $rx! $mx! $gx! $fx! $`x! $^x! $Zx! $Px! $Ex! $?x! $2x! $,x! $'x! $!x! $x! $x! $x! $ x! $x! $ҏx! $x! $x! $x! $x! $x! $x! $x! $x! $x! $fx! $ax! $U<'!'௼<'l!$'9` ' >`>܌>ܜ>>(>8HOST SIMULATIONcleandiskcopycpdfdevdirdownloadcatechofdiskformatfschecklinklnmkdirmovemvmountprotectremovermdirunmountuploadshortlongcdShort commands disabled Short commands enabled +viewview=%s %s File system version : %s -rError - no input file name specified Error - no output file name specified Error - file does not exist Error - FScreate failed file Error - Link command failed Error - Mount command failed Error - no file name specified Error - Unmount command failed Error - Move command failed Error - no file name specified Error - %s cannot be created  -dError - %s failed, err_code = %d File System SYNCed -mError - no start address specified Error - no length specified Error dir command failed, err_code = %d usage : cd usage : mkdir usage : rmdir partError - Garbage collection (part opt) failed, err_code = %d Error - usage: cleandisk [part] Error - Garbage collection failed, err_code = %d -vusage : fscheck [-r | -d | -v] Error - File System check failed, err-code = %d File System Check OK Error - remove file %s failed, err_code = %d offhelpUsage: protect on|off [[..]] Error - too many parameters No help available for this topic Error - invalid option Built-in shell commands : %-13.13shelp allshellCommand not found Following external commands are available : setport exit setportBaud rate set to %ld, change terminal settings Invalid baud rate %ld, [1200-115200] Error - Usage: setport ; baudrate = [1200 - 115200] Inode dev uid gid link size mode %7u %3d %3d %3d %5d %6ld %8o BLOCK: %3u allocated, %3u free, %3u recoverable, %3u total INODE: %3u allocated, %3u free, %3u recoverable, %3u total ./../Error - TARGET file %s cannot be opened. err_code = %d please start WXMODEM Error - TARGET file %s cannot be created. err_code = %d %lu bytes successfully received and stored Too less extra memory (%d) ext_mem.c%s:%d: memory is freed in wrong order at 0x%08X PING_RESPONDERICMP echo responder9ICMP_PINGICMP echo commandICMP_LISTENICMP listen commandSENDTOUDP send commandSENDTO_LISTENUDP listen commandIP_COMMANDSIP connectivity commands %d.%d.%d.%d%d.%d.%d.%d/%d%lu %lu' %lu"PING --- ping statistics --- %lu packet(s) transmitted, %lu successful, %d%% loss rtt min/avg/max = %lu /<1 / %lu / <1 / %lu ms <1 ms . . . . . . . . . . . . . . . .}{|ICMP_TRACEROUTEICMP TRACEROUTE commandUDP_TRACEROUTEUDP TRACEROUTE commandHTTPPROBEHTTP probe commandP? IP interface detach failed: %s. RX%-36s %-6s %-5s %-10s %-10s %-6s %-s MTUAdminOper%-3u %-*s %-6s %-5u %-10u %-10u DOWN%-6s BOOT[BOOT][UP][DOWN]%*c HW-address : %2.2x%c%*c BRHW-address : %*c RX unicastpkts: %-7u brcastpkts : %-7u mcastpkts : %-7u %*c TX unicastpkts: %-7u brcastpkts : %-7u mcastpkts : %-7u droppkts:%-7u %*c Oper state : %-7s Admin State: %-7s %*c Flags : PRIMARY ARP BROADCAST IPSEC BOUND ARPTABLE PTP VIRTUAL LOOP BOOTP MULTICAST LINKSENSING INTERNAL NAT TRANSNAT STATIC UNNUMBERED ALLMULTI MTU too large. Maximum allowed MTU for this interface is %d. Failed to configure interface. Error : specify either gateway, interface or both. Warning : truncating address prefix to fit mask. Failed to add route : route already exists. gateway can not be reached. maximum number of entries reached. illegal parameter. Failed to find route. Warning : Deleting a route inserted by a routing protocol leads to unpredictable behaviour! Warning : Deleting a connected route may lead to unpredictable behaviour! Failed to delete route. Mtc Flags Legend: [A]uto, [I]nterface, [M]odified, [D]ynamic, [R]eject, [H]ost, [G]ateway, [U]p Src SelectSrc Address%17s %16s %-*s %-3s %-6s %*s %-16s %-8s %-s Origin%17s %16s %-*s %-3s %-6s %17s %18s%16s* %16s %-*s %-3u %*s %-16s %8s %-10s Failed to add ARP entry. Failed to delete ARP entry. %-19s %-22s %-17s %s IP-addressHW-address%-3u %-15s %-22s PROXY (i)PROXYDYNAMICSTATICip debugIP_COMMANDSATOMIC_IP_PLUGIN%s'%s' registration failed%s[IP_MBUS] %sip_group_atom_mbus_init() failed%s%sip_intf_atom_mbus_init() failed%s%sip_fib_atom_mbus_init() failed%s%sip_arp_atom_mbus_init() failed%sAdminStatusPrimaryLinkSensingBridgedETH.PhysETH.IntfATM.IntfATM.BundlePPP.IntfIP.IntfGroupIP_Admin_statusDownIP_IntfStatusUnknownUsedListeningRetryingResolvingConnectingConnectedRecovering%sinput mtu is larger than max_value.%slo%sEnd ip_get_index(), name or index is NULL %s%sstrlen(name) = 0, not get name %s%sname is NULL %s%s.%swifi0%sintf enum type registration failed%s%s'%s' registration failed in ip_intf_atom_mbus_init()%sAddrPointToPointIP.FIB%d_%d_%d_%d%sGIOINTFGET invalid interface name%s%s'%s' registration failed in ip_addr_atom_mbus_init()%sFIBDestIPAddressDestSubnetMaskGatewayIPAddressSrcIntfForwardingMetricIP.IntfIP_FIBStatus%sfib enum type registration failed%s%s'%s' registration failed in ip_fib_atom_mbus_init()%s%s'%s' registration failed in ip_group_atom_mbus_init()%sARPIPIntfIP_ARPTypedynamic%sthis arp has existed%s%sinput name is NULL%s%sFailed to call ic_genioctl(GIOCARPSET)%s%sthe Interface is not UP state)%s%sipaddr can not be 0%s*new%sthe object not created%s%lu_%lu%s'%s' registration failed in ip_arp_atom_mbus_init()%sIPCRIPCA%s%s: %s%s[IPCACHE] Livebox-orange-pairingmbusclientlib registration failed %s: mbus_trigger init failed mbusd_cliEnd of initialisation /var/run/appboxappbox: start loading after [ %5ldms ] appbox: end loading config load load_ip=yes flush=no/bin/shCaught signal %d 0.0.0.0/etc/config/version.cfgFT_SOFTWARE_VERSIONbootmode %d unhandled determine bootmode failed v7.2-h323-frcopy FT_SOFTWARE_VERSION to rescue failed (%s) get normal FT_SOFTWARE_VERSION failed parsing FT_SOFTWARE_VERSION failed (%s) get normal hco version failed parsing FT_SOFTWARE_VERSION for language step 1failed (%s) resc%s-get rescue hco version failed appboxUnable to register sighandler for signal %d -l-a-t Usage: %s -t [-l local_mbus_name] [-a archive_file_name] ROOTSHELdsl0dsl1/etc/hardware.confETHER_0=%02X:%02X:%02X:%02X:%02X:%02XPROT_COMPANY_NAMESAGEM_COMPANY_URLhttp://www.thomson.net_PROD_NAMELivebox2_PROD_URLhttp://www.speedtouch.com_PROD_FRIENDLY_NAMELiveBox 2 Mini_PROD_NUMBER_PROD_MODEL_NAMELB2Livebox 2 MiniFT_COUNTRY_PROD_DESCRIPTION_PROD_CLASSLivebox 2_BOOTLOADER_VERSION_BUILD_BUILDNAMEZZD3AA7.298_BUILDVARIANTAA_COPYRIGHTCopyright (c) 1999-2009, THOMSON2.0.0_HW_VERSION_PROD_SERIAL_NBR_BOARD_SERIAL_NBR%02X-%02X-%02X-%02X-%02X-%02X_MACADDR%02x%02X%02X_OUIad6836_ADSL_PHY_0x%s_MODEMLABELSpeedTouch/dl%s: memm_init failed %s: dyndata_init failed /fs/ro/etc/defaults/initparams.conf%s: mbusd_init failed %2s %1s %4s %4s %-35s %4s %4s %-35s %4s %4s %6s + Parameters: %s + Values : %s Display statisticsClear statisticsDump the content of the databaseexecExecute an sql querypragmaExecute a pragma commandexit (for profiling)The pragma nameThe new pragma valuequerydmtreeSelect mbusd datamodel treeorderSelect dump order (model or instance based)Paramater values enabled/disabledigdSELECT * FROM MBUS WHERE DMTree=%d ORDER BY Depth,TypeID,ParentID;SELECT * FROM MBUS WHERE DMTree=%d ORDER BY Inbr;SELECT * FROM MBUS ORDER BY Depth,TypeID,ParentID;SELECT * FROM MBUS ORDER BY Inbr;Lv T Tid Tpid Tname Oid Pid Oname Oidx Omidx Oflags PRAGMA %s=%s;DELETE FROM Registry WHERE Key='%s'; INSERT INTO Registry VALUES ('%s','%s');PRAGMA %s;/fs/common/config/dbpath.cfg/etc/config/mbus_ng.datmbus sqliteeth0WLAN - Fail to retrieve converted SN to Wepkey WL : error, could not initialize sha1 context WL : error, could not delete the sha1 context WL : error, could not update the sha1 context WL : error, could not finalize the sha1 context _SSID0_SERIAL_SSID1_SERIAL_SSID2_SERIAL_SSID3_SERIAL_WEPKEY0_SERIAL_WEPKEY1_SERIAL_WEPKEY2_SERIAL_WEPKEY3_SERIAL_WPAKEY0_SERIAL_WPAKEY1_SERIAL_WPAKEY2_SERIAL_WPAKEY3_SERIALucfFSSMFSEXdhmmsshmmssisodate+timetime+dateddmmyyyyddmmyymmddyyyymmddyy,kBMBGBJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSatdays%d %s, %lu%s%02lu%s%02lu%lu%s%02lu%s%02lu%04d-%02d-%02d%02d%s%02d%s%04d%02d%s%02d%s%02d%02d:%02d:%02d%d%s%02d%s%02d%04d-%02d-%02d %02d:%02d:%02d%c%02lu:%02lu%s, %02d%s%s%s%04d %02d%s%02d%s%02d%c%02lu%s%02lu%02d%s%02d%s%02d %c%02lu%s%02lu %s %s %02d %04d%.2f@ (@ P@ @ @!A?Pdmon.cdmonBad message packet size seenBad message object id size seenUnknown command seendmon init failed.dmoncmd_%xOut of memory in dmon_fd_add()!pppdOut of memory in dmon_timer_add()!Out of memoryTELNETVirtual Terminal@K@K0@KT@K|@K@K@T@U@Q@Q@U@U@V0@V@WD@X@Y@Vh@U@U@U@U@U@U@U@U@U@U@U@UX@Up@U@U@WILLWONTDODONTTELNETClosing connection telnettelnet.ctelnetdBad mgmt packet size seenSession %d seems available : using this one [telnet] E - : UNKNOWN COMMAND Session %d in use by '%s' on %d.%d.%d.%d:%d Hit Return to list sessions & scan for a free one Or type the number of the session you want to kill No more sessions. telnetcmd_%xtelnxm_getmem failed.xsm_create failed.TELNTELNET trace task creationtelnet semaphore creationtelnet suspend semaphore creationtelnet resume semaphore creationtlsrxev_receive() failed apptapptimer.cxt_create failedxm_alloc failedxsm_create failedxev_alloc failedxt_start failed@l@@@@@@@@@@@@@@ArArArArArArArArAv|Aw,AvAvAvAw,Aw,Aw,Aw,AvAyTAy|Ay8Ay`Ay`Ay`Ay`AyA{A|A}A}A~AAAA{|ATATA{A{A{A{8AAATATA}@A~PA}TA~xAAATATA~(A~PA~(A~xAAAAAAAAAAAPAAA,AhA,A8AAPAA0AA`AAAHAxAA\AAA`AAAAAApppd.cBad timer pointer()!Out of memory in timeout()!Protocol wants link up but it isn't !!![%s] E - PPP: Retry interval is zero, connection stopped. [%s] E - PPP: Connection scheduled for retry (%d s). User requestuser request[%s] F - PPP: Invalid IPCP parameters received. Receive error on PPP channel%s:%dillegal state '%d' in pppd_socket_read()!illegal state '%d' in pppd_socket_write()!Out of memory in pppd_init()!PPPDppp.lstatepppdcmd_%xUser killINCOMINGwrite: warning: %m (%d)write: %m (%d)read: %m /dev/pppppp%dppp_connect: SIOCSIFNAME failed: -%d: %m Couldn't attach to channel %d: %m [%s] F - PPP: destination interface is already in use. [%s] F - PPP: Destination interface has incompatible type. /etc/defaults/plock.txt/etc/defaults/slock.txt/etc/config/unlocked.datm97KDOhUa5dhAK2GmNP4[%s] E - PPP: interface name not specified [%s] E - PPP: no more session available [%s] E - PPP: no more interfaces contexts available _ppp - %s :[proto=0x%x] %.2x\\n\r\t\%.3o[%s] E - PPP: channel hangup [%s] R[%s] F - PPP: received short packet. [%s] I - PPP DoD: IP activity detected, trying to open PPP link ... [%s] F - PPP: Received non-LCP packet while LCP is not open. [%s] F - PPP: Unsupported protocol (0x%x) received [pppfsm] E - %s: timeout sending Config-Requests [%s] E - %s : terminated by peer (%s) [%s] E - %s : terminated by peer LCPConfReqConfAckConfNakConfRejTermReqTermAckCodeRejProtRejEchoReqEchoRepDiscReqBug in lcp_addci: wrong lengthlcp.c[%s] F - LCP: received short Echo-Reply, length %d [%s] F - LCP: appear to have received our own echo-reply! [%s] E - : Serial line is looped back. Loopback detected code=0x%x id=0x%x <mru %dasyncmap 0x%xauth papchapquality lqrcallback CBCPmagic 0x%xpcompaccomp magic=0x%x[%s] E - : No response to %d echo-requests [%s] E - : link appears to be disconnected. Peer not respondingIPCP[%s] E - : Could not determine remote IP address Could not determine remote IP addressPPP IPCP cannot determine remote IP address (%s) [%s] E - : Could not determine local IP address Could not determine local IP addressPPP IPCP cannot determine local IP address (%s) [%s] E - : Peer is not authorized to use remote address %s Unauthorized remote IP addressInterface configuration failedPPP link up (%s) [%s] subnet[%s] E - IPCP: local IP %s %s/%u [%s] E - IPCP: remote IP %s %sPPP link down (%s) [%s] addrs %scompress old-VJaddr %smask %umask %sdns%d %s%02x%02x:%02x%02x:%02x%02x:%02x%02xIPV6CPfe80::%s[%s] F - ipv6_check_options: local/remote LL address required for demand-dialling. [%s] I - ipv6_demand_conf: local link-layer address %s. [%s] I - ipv6_demand_conf: remote link-layer address %s. F - ipv6cp_up: Could not determine remote LL address. Could not determine remote LL addressF - ipv6cp_up: Could not determine local LL address. Could not determine local LL addressF - ipv6cp_up: local and remote LL addresses are equal. local and remote LL addresses are equal[%s] I - ipv6cp_up: Local LL address %s. [%s] I - ipv6cp_up: Remote LL address %s. [%s] E - PPP connection terminated. LCP downAuthentication failedNo network protocols running[%s] E - terminating connection due to lack of activity. Link inactivePPP PAP remote user %s succesfull authenticated[Remote message: %s] PPP PAP Authenticate Ack received[%s] E - PAP: authentication failed PPP PAP authentication failed (%s)PPP PAP Authenticate Nack receivedPAPAuthReqAuthAckAuthNak[%s] E - PAP: authentication failed due to protocol-reject PPP PAP authentication failed (%s) [protocol reject][%s] E - PAP: authentication of peer failed (protocol-reject) PPP PAP Authenticate Request sent[%s] E - PAP: No response to authenticate-request PPP PAP on intf %s no response to authenticate-request user= password=********CHAPChallengeSuccessPPP CHAP autentication failed [protocol reject(server)]PPP CHAP autentication failed [protocol reject(client)]PPP CHAP Challenge Send (Id = %d)[%s] E - CHAP: remote peer failed to respond to challenge I don't like you. Go 'way.Welcome to %s.nackPPP CHAP Send status respons: %sPPP CHAP Receive challenge (rhost = %s)[%s] E - CHAP: authentication failed PPP CHAP authentication failed (%s)PPP CHAP Chap receive success : authentication ok>, name = LocalDisconnectRemoteDisconnectIdleDisconnectOfferTimeoutConfirmationTimeoutLCPFailureAuthFailureNCPFailureIPCPLAddrFailureIPCPRAddrFailureIPCPPDNSFailureIPCPSDNSFailureServicesPPPoEACNamePPPoEServiceNameScanIntfNamePPP.Relay.Intfscan_status_typesnonerequiredcompletePPPStatusReceivedLocalAddressUserNameLastConnectionErrorDHCPServerPoolPPPoESessionIDPPPoEACACNameServiceNamePcompRestartRetryIntervalPassiveSilentReceivedRemoteAddressNetMaskNetMaskFormatSavePasswordDialOnDemandDoDDelayPrimDNSServerSecDNSServerDNSMetricIdleTimeoutIdleTriggerEchoToleranceUnnumberedEchoTotalToleranceTimeACcompTraceEchoFlagMagicFlagNegACcompFlagMSChapFlagMRUFlagAddressFlagRouteFlagIncomingIdleTimeRemainingDoDTimeRemainingLCPStatusLCPRetransmitsLCPTermReasonIPCPStatusIPCPRetransmitsIPCPTermReasonFlagClonedppp_ipcp_status_typesinitialstartingclosedstoppedclosingstoppingreqsentackrcvdacksentopenedppp_lcp_status_typesaccomp_typesnegotiateidle_trigger_typesRxTxRxTxmask_typescidrdottedppp_intf_auth_typesAutoDHCP.Server.Poolppp_intf_last_error_typesppp_intf_pppstatus_typesInitEstablishingAuthenticatingNetworkingUnconfiguredppp_intf_status_typesATM.Intf.%sETH.Intf.%sppp_%iPPP_MBUS%senum types registration failed%s[PPP_MBUS] SourceIPAddressSourceIPMaskpppoerelayd.c[%s] F - : Failed to add RELAY interface : Ethernet interface not found. interface already addedno resources[%s] F - : Failed to add RELAY interface : %s. [%s] E - : RELAY interface connected successfully. [%s] F - : pppoerelayd connect failed ! [%s] E - : RELAY Setting retry timer (%d secs). [%s] E - : RELAY Retry disabled, stopping. [%s] E - : Retry timer fired. pppoerelaydpppoerelaydcmd_%xRELAYRLAY[%s] E - : RELAY interface start command received [%s] E - : RELAY interface already started [%s] E - : RELAY interface start failed [%s] E - : RELAY interface stop command received [--] E - : NEW : RELAY interface name missing [%s] E - : NEW : RELAY interface name already exists [%s] E - : NEW : no more RELAY interface contexts available SessionClientMACAddressClientIntfClientSessionACMACAddressACIntfACSessionEthIntfppp_relay_intf_statusDisconnectedPPP_RELAY_MBUS%s%s: enum types registration failed%s[MBUS] %s%s: registration of '%s' failed: %s%s[%s] F - : Failed to set hwaddr. No socket resources. [%s] F - : Failed to set hwaddr. eth_linux.cethni_linux.c FATAL ERROR: %s (%d, 0x%08x). ETH : Received packet dropped. Buffer pool empty. CPCXC`CPCPCPCXC`C`C`C`C`ChCpCp[%s] E - : Failed to stop channel, because interface %s is still active atmi.c[%s] E - : Setting retry timer (%d secs) [%s] E - : Retry disabled, stopping [%s] E - : close socket atmiatmi_ipatmi_res[%s] E - : Retry timer fired [%s] F - : but not retrying state !! Select failed%sFailed parsing/processing the mbusd request (%s)%s[ATM_MBUS] Failed to get ATM socket option: SO_ATMCID[%s] E - : connect completed succesfully [%s] E - : connect failed !!! [%s] E - : recovering [%s] E - : recovering error [%s] E - : disconnected Failed to get ATM socket option: SOL_SOCKETATMI[%s] E - : connection recovered succesfully [%s] E - : connect failed select : ret > actionsatmi.lstateatmicmd_%x[%s] E - : atmi_stop () [%s] E - : atmi_start () [%s] E - : Linkup command received [%s] E - : ATM_STARTLINK : already OPEN [%s] E - : ATM_STARTLINK : No destination [%s] E - : ATM_STARTLINK : unable to create socket [%s] E - : Linkdown command received [%s] E - : Update QoS received [%s] E - : UNKNOWN COMMAND [--] E - : NEW : interface named %s already exists [--] E - : NEW : no more session available [--] E - : NEW : no more interfaces contexts available [--] E - : NEW : interface with that name already exist [%s] F - : Failed to delete ATM interface, interface is still in use ! [%s] E - : SETNAME : interface named %s already exists [%s] I - : Set destname to %s failed to get interfaceinterface is not an ATM interfaceno lower layer inerface found for bundleATM interface not foundATM interface parameters not foundDestinationAddressLinkTypeATMEncapsulationMultiPriorityQueuesFCSPreservedATM.QoS.QoSBookencapstypesLLCVCMUXulptypesIPoAETHoAPPPoAATMIntfStatusatm_%i%d/%dATM_MBUS%senum 'devicetypes' registration failed (%s) %s%s'%s' registration failed (%s)%s%satmi_qos_atom_mbus_init() registration failed (%s)%s%sSuccessfully registered '%s' objecttype !%s%sPlugin '%s' successfully registered !%sRefCountTxCTDRxCTDATM.QoS.CTDConformancePeakRateSustRateMaxBurstMinRateMaxFrameCellDelayFrameDiscardATM_QOS_conformanceUBRCBRGFRVBR-rtVBR-nrtQoSatm_qosb_%d%ssustainable rate must be lower than peak rate!%s%smin rate must be lower than peak rate! %s[ATM_QOS_MBUS] atm_ctd_%d%senum 'conformance' registration failed (%s) %s%s'ATM.%s' registration failed (%s)%s%s'ATM.QoS.%s' registration failed (%s)%s>>> QOS book: Class: %d SCR: %d PCR: %d Max PCR: %d CDV: %d MBS: %d [%s] E - : Failed to set backend: %s [%s] E - : setsockopt SO_SNDBUF failed: %s [%s] E - : setsockopt SO_ATMQOS failed: %s [%s] I - : destname found to be %s [%s] E - : pb_get failed >>> Multiple Priority Queues intf name: %s are set to: %d [%s] E - : connection failed: %s %02x%c%02x%c%02x%c%02x%c%02x%c%02x[%s] E - : connect socket [%s] E - : Failed to open ATM socket: %s [%s] E - : setsockopt SO_ATMQOS failed: %s Qosname: %s Destname: %s Sock ID: 0x%x bridged.c[%s] E - : stop connection bridgedbridged_ipbrid[BRIDGE] E - MBus request parsing failed (%s)bridge_create for fixed default bridge failedbridge_activate_as_default failedBRIDbridge.lstatebridgedcmd_%x[%s] E - : bridge_stop() [%s] E - : bridge_start() [%s] F - : Destination %s not found !! [%s] F - : Destination %s is not an ATM interface!! [%s] F - : No more bridge ports !! [%s] E - : BRIDGE_STARTLINK : already OPEN [%s] E - : BRIDGE_STARTLINK : no destination [%s] E - : BRIDGE_STARTLINK : start failed [--] E - : NEW : no bridge interface [--] E - : NEW : interface name not specified [--] E - : NEW : no more session available [--] E - : NEW : no more interfaces contexts available [--] E - : NEW : interface with that name already exist [%s] E - : NEW bridge_create failed [%s] F - : Failed to delete BRIDGE interface, interface is still in use ! [%s] E - : Destination interface %s has incompatible ulp parameter. bridge interface flushing already busy bridge removal already busy Cannot remove default bridge bridge delete failed Invalid brid pointer received bridged_instances.cbridged not yet initedInvalid nameCan not configure no bridgesbridged already initedInvalid name received[BRIDGED] No bridge found with brid=%d [BRIDGED] Bridge name is not changeable! Invalid brid pointer receivedbridge instance is NULL!dealloc (free) failedBridge with name "%s" already exists.[BRIDGED] Cannot create bridge: %d bridge instances already in use. [BRIDGED] Cannot create bridge: no memory left. [BRIDGED] Cannot create bridge "%s": Out of memory. Invalid *pribd pointer: is NULLMACTableBridgeIntfMacTableTypepermanentBridge.IntfLowerIntfStatePortStateRetrylearningforwardinginterface_statuskilledWLAN.IntfAgeing%sMbus plugin processing cmds failed for %s.%s[BRIDGE_MBUS]bridge_root_mbus_handlerbridge_%ibridge_intf_mbus_handlerbridgeintf_%ibridge_mactable_mbus_handlerBRIDGE_MBUSVLAN%senum types registration failed (%s) %s%sPlugin '%s' successfully registered!%ssys_linux.cError bridge "%s": unable to perform bridge ioctl. Args: %d %d %d %d. : err(%d)=%s [%s] F - : Unable to remove interface from bridge "%s" SIOCSIFBR failedOBC%ldbridged new failed[%s] F - : Unable to set bridge forwarding delay to zero: err(%d)=%s [%s] F - : Unable to set up bridging on "%s": wong ifindex [%s] F - : Unable to set up bridging on "%s": err(%d)=%s [%s] F - : Unable to set up bridging on "%s" [%s] F - : Unable to disable forwarding between bridge WAN ports on interface "%s": err(%d)=%s delete of OBC interface failedclosing socket failedC0CCCCCCxCCCCDtDDDDDINCLUDEEXCLUDE[igmp_proxy] F - Unknown IGMP proxy timer expired !! RecvFrom failed (%d) IGMP_PROXYigmp_proxy.crecvfrom netlink has most likely overflowed buffer.Unexpected netlib msg_type (%d) [igmp_proxy] E - MBus request parsing failed (%s)igmpMRT_INITMRT_DONE[igmp_proxy] E - Config multicast routing table : %s [igmp_proxy] F - setsockopt(%s) failed [igmp_proxy] F - IGMP message received on unknown intf Unknown protocol identifier (%u)[igmp_proxy] F - genioctl(GIOCADDRINTF) failed on intf %s [igmp_proxy] F - Could not get valid address on intf %s [igmp_proxy] F - Ifindex %d not in the intf list [igmp_proxy] E - Intf %s down [igmp_proxy] E - Intf %s up Ifindex (%d) already in use igmp_proxy_intf.c[igmp_proxy] E - Intf %s created igmp_proxy_intf_create() returned NULL [igmp_proxy] E - Other Querier Present timer expired on intf %s [igmp_proxy] E - MRD advertisement timer expired on intf %s [igmp_proxy] E - MRD solicit advertisement timer expired on intf %s [igmp_proxy] E - Intf %s has been deleted igmp_proxy_intf_get_by_name() returned NULL [igmp_proxy] E - Intf %s becomes inactive [igmp_proxy] E - Intf %s becomes downstream [igmp_proxy] E - Intf %s becomes upstream [igmp_proxy] E - Intf %s is set in IGMPv%c mode [igmp_proxy] E - Set QRV to %d for intf %s [igmp_proxy] E - Set QQI to %d for intf %s [igmp_proxy] E - Set MRD advertisement interval to %d for intf %s [igmp_proxy] E - Pending MRD solicited advertisment on intf %s [igmp_proxy] E - Setting MRD solicited advertisment delay to %d secs on intf %s [igmp_proxy] F - IGMP message received with invalid ttl [igmp_proxy] F - Too long IGMP message received on intf %s [igmp_proxy] F - Too short IGMP message received on intf %s [igmp_proxy] F - IGMP message received with invalid checksum on intf %s [igmp_proxy] F - IGMP query received with no route alert option on intf %s [igmp_proxy] F - Invalid IGMP query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Invalid IGMPv1 query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Invalid IGMPv2 query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Invalid IGMPv2 general query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Bad IGMPv3 general query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Bad IGMPv3 query received from %u.%u.%u.%u on intf %s [igmp_proxy] E - Intf %s becomes non-querier [igmp_proxy] E - Setting Other Querier Present timer to OQPI (%d sec) on intf %s [igmp_proxy] E - IGMPv%c query received from %u.%u.%u.%u on intf %s [igmp_proxy] E - IGMPv3 query received from %u.%u.%u.%u on intf %s [igmp_proxy] E - IGMPv%c general query received from %u.%u.%u.%u on intf %s [igmp_proxy] F - Invalid IGMP version configured on intf %s [igmp_proxy] F - IGMPv2 report received with no route alert option on intf %s [igmp_proxy] F - IGMP report with invalid len (%d) from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP report received with invalid multicast address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP report received with invalid dst address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP report received with src %u.%u.%u.%u which cannot be mapped on intf %s [igmp_proxy] F - IGMP leave report received with no route alert option on intf %s [igmp_proxy] F - IGMP leave with invalid len (%d) from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP leave received with invalid multicast address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP leave received with invalid dst address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP leave received with src %u.%u.%u.%u which cannot be mapped on intf %s [igmp_proxy] E - Skipping local group received from %u.%u.%u.%u on intf %s [igmp_proxy] E - Skipping filterd group %u.%u.%u.%u received from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMPv3 report received with no route alert option on intf %s [igmp_proxy] F - IGMPv3 report received with invalid dst address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMPv3 report received with src %u.%u.%u.%u which cannot be mapped on intf %s [igmp_proxy] F - IGMPv3 report received with invalid multicast address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMPv3 report received with invalid length from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMPv3 report received with invalid src address from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP invalid new sources record type received from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP invalid block old sources record type received from %u.%u.%u.%u on intf %s [igmp_proxy] F - IGMP unknown report (%d) type received from %u.%u.%u.%u on intf %s [igmp_proxy] F - MRD solicit received with no route alert option on intf %s [igmp_proxy] F - MRD solicit received with invalid len (%d) from %u.%u.%u.%u on intf %s [igmp_proxy] F - MRD solicit received with invalid multicast address from %u.%u.%u.%u on intf %s [igmp_proxy] F - MRD solicit received with src %u.%u.%u.%u which cannot be mapped on intf %s [igmp_proxy] F - Unknown IGMP message (%d) received on intf %s Number of srcs is limited to %d for group %u.%u.%u.%u igmp_proxy_db.cGroup %u.%u.%u.%u already in membership database [igmp_proxy] E - Adding new group %u.%u.%u.%u to membership database [igmp_proxy] E - Setting filter mode to %s for group %u.%u.%u.%u in membership database igmp_proxy_db_create_group() returned NULL [igmp_proxy] I - Decremented %s mode (%d) for group %u.%u.%u.%u in membership database [igmp_proxy] I - Incremented %s mode (%d) for group %u.%u.%u.%u in membership database Src %u.%u.%u.%u already in membership database for group %u.%u.%u.%u [igmp_proxy] E - Adding new src %u.%u.%u.%u to group %u.%u.%u.%u in membership database igmp_proxy_db_create_src() returned NULL [igmp_proxy] I - Incremented %s mode (%d) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u in membership database [igmp_proxy] I - Decremented %s mode (%d) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u in membership database [igmp_proxy] I - Filter mode change to %s for group %u.%u.%u.%u in membership database [igmp_proxy] E - Deleting src %u.%u.%u.%u belonging to group %u.%u.%u.%u in membership database [igmp_proxy] E - Deleting src %u.%u.%u.%u belonging to deleted group %u.%u.%u.%u in membership database [igmp_proxy] E - Deleting group %u.%u.%u.%u in membership database [igmp_proxy] E - Subscribe all groups in membership database on intf %s [igmp_proxy] E - Unsubscribe all groups in membership database on intf %s [igmp_proxy] E - Group %u.%u.%u.%u, src %u.%u.%u.%u is%s subscribed on intf %s Src %u.%u.%u.%u already in source list igmp_router.c[igmp_proxy] E - Updating LMQC (%d) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] E - Setting timer to LMQT (%d sec) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s Group %u.%u.%u.%u already in the list of intf %s [igmp_proxy] E - Adding new group %u.%u.%u.%u to list on intf %s igmp_router_create_group() returned NULL Host %u.%u.%u.%u already in the list of group %u.%u.%u.%u [igmp_proxy] E - Adding new host %u.%u.%u.%u to list of group %u.%u.%u.%u igmp_router_create_host() returned NULL [igmp_proxy] I - Timer expired for host %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] I - Deleting inactive src %u.%u.%u.%u from group %u.%u.%u.%u in exclude mode on intf %s [igmp_proxy] I - Group %u.%u.%u.%u switches to include mode on intf %s [igmp_proxy] I - Deleting group %u.%u.%u.%u on intf %s IGMPv2IGMPv3[igmp_proxy] I - IGMPv1 timer expired for group %u.%u.%u.%u on intf %s; switching group mode to %s [igmp_proxy] I - IGMPv2 timer expired for group %u.%u.%u.%u on intf %s; switching group mode to IGMPv3 [igmp_proxy] I - Deleting active src %u.%u.%u.%u from group %u.%u.%u.%u on intf %s [igmp_proxy] I - Adding inactive src %u.%u.%u.%u to group %u.%u.%u.%u in exclude mode on intf %s [igmp_proxy] I - Adding active src %u.%u.%u.%u to group %u.%u.%u.%u in include mode on intf %s igmp_router_create_src() returned NULL [igmp_proxy] I - Adding active src %u.%u.%u.%u to group %u.%u.%u.%u in exclude on intf %s [igmp_proxy] E - Setting timer to GMI (%d sec) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] I - Deleting active src %u.%u.%u.%u from group %u.%u.%u.%u in exclude mode on intf %s [igmp_proxy] E - Setting timer to GMI (%d sec) for group %u.%u.%u.%u on intf %s [igmp_proxy] I - Deleting host %u.%u.%u.%u from group %u.%u.%u.%u on intf %s Host %u.%u.%u.%u not found in list of group %u.%u.%u.%u on intf %s [igmp_proxy] E - Compatiblity mode for group %u.%u.%u.%u is IGMPv1; ignoring TO_IN report on intf %s includeexclude[igmp_proxy] I - Adding active src %u.%u.%u.%u to group %u.%u.%u.%u in %s mode on intf %s [igmp_proxy] E - Fast leave enabled on intf %s, deleting group %u.%u.%u.%u [igmp_proxy] I - Deleting inactive src %u.%u.%u.%u from group %u.%u.%u.%u on intf %s Group %u.%u.%u.%u not found in list of intf %s [igmp_proxy] E - Updating LMQC (%d) for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Setting timer to LMQT (%d sec) for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Compatiblity mode for group %u.%u.%u.%u is not IGMPv3; ignoring src list in TO_EX report on intf %s [igmp_proxy] E - Setting timer to group timer for active src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] E - Compatiblity mode for group %u.%u.%u.%u is not IGMPv3; ignoring BLOCK report on intf %s [igmp_proxy] E - Setting timer to group timer for src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] E - Setting src timer to LMQT (%d sec) for src %u.%u.%u.%u belonging to group %u.%u.%u.%u on intf %s [igmp_proxy] E - Updating IGMPv1 timer (%d sec) for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Switching group version to IGMPv1 for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Updating IGMPv2 timer (%d sec) for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Switching group version to IGMPv2 for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Deleting host %u.%u.%u.%u from group %u.%u.%u.%u on intf %s [igmp_proxy] E - Deleting active src %u.%u.%u.%u from group %u.%u.%u.%u in %s mode on intf %s [igmp_proxy] E - Deleting active src %u.%u.%u.%u from group %u.%u.%u.%u in exclude mode on intf %s [igmp_proxy] E - Deleting group %u.%u.%u.%u on intf %s [igmp_proxy] F - Lookup failed of mfc parent intf (%d)!! Invalid MFC msg length received (%u)[igmp_proxy] F - Cannot resolve intf from MFC msg !!! [igmp_proxy] F - MFC msg received on intf %s which is not upstream!!! [igmp_proxy] F - Src address in MFC msg is invalid !! [igmp_proxy] F - Dst address in MFC msg is non-multicast !! [igmp_proxy] F - MFC msg type not supported (%u) Unknown MFC msg type received (%u)igmp_proxy_mfc.cigmp_proxy_mgmt.cInvalid service id (%d)Unknown IGMP proxy management msg IGMP-ProxyIGMP based multicast forwardingRxTotalPacketsRxTooShortRxTooLongRxBadChecksumRxBadTTLRxNoRouteAlertRxIGMPv1QueriesRxIGMPv2QueriesRxIGMPv3QueriesRxBadQueriesRxQueriesFailRxIGMPv1ReportsRxIGMPv2ReportsRxIGMPv3ReportsRxBadReportsRxLeaveReportsRxBadLeaveReportsTxIGMPv1QueriesTxIGMPv2QueriesTxIGMPv3QueriesQueryElectionSwitchRxMRDSolicitsRxBadMRDSolicitsTxMRDAdvertiseTxMRDTerminateClearTraceConfigDebugIncludeCountExcludeCountIGMP_Proxy_Filter_Modes_listIncludeMembershipFiltermodeHostIGMP_Proxy_Version_listIGMPv1BlockedSourceAllowedSourceLMQITimeoutGSSQCountGroupTimeoutIGMPv1TimeoutIGMPv2TimeoutGQCountIndexRunningStatusFastLeaveExpTrackMRDQuerierAddressIsQuerierQITimeoutOQPTimeoutQRVMRDAdvTimeoutMRDSolicitAdvTimeoutIGMP_Proxy_Intf_Status_listInactiveDownstreamUpstreamProxyQIQRILMQIInitAdvInterInitAdvCountRequireRALocalGroupFlushIGMP%sEnd igmp_proxy_atom_get_ifr_index(), strlen(name) = 0 %s[ATOMIC_IGMP_PROXY_MBUS]%seventing for '%s' failed%s%s.%s.%s.%s.%s%s.%s.%s.%s.%s.%s.%s%sGot mbus update event(s) error.%smuaeIGMP_PROXY_MBUSmbupmbum%sCould not create update thread.%s%sPlugin socket creation failed%s%sPlugin registration failed%s%senum registration failed%s%s%s registration failed %s%s%s registration failed%sigmp_proxymcMulticast Forwarding Modulemulticastfirewall[igmp_proxy] E - Add firewall rule for intf %s %s_%s[igmp_proxy] F - ic_genioctl(GIOCPF_RULE_GET, %s) already exists 224.0.0.0/4[igmp_proxy] F - ic_genioctl(GIOCEXPR_CREATE) %s failed %s_if_%s[igmp_proxy] F - ic_genioctl(GIOCEXPR_CREATE) %s failed (%x) [igmp_proxy] F - ic_genioctl(GIOCPF_RULE_GET) %s failed [igmp_proxy] F - Dst IP expr already present in rule %s Src[igmp_proxy] F - %s intf expr already present in rule %s [igmp_proxy] E - Delete firewall rule for intf %s [igmp_proxy] F - No id available for firewall rule %s [igmp_proxy] F - ic_genioctl(GIOCEXPR_DELETE, %s) failed (%x) [igmp_proxy] F - expr %s still in use (%d) [igmp_proxy] F - ic_genioctl(GIOCEXPR_GET, %s) failed (%x) sysdep_linux.cigmpcmd_%xigmpdUnknown family identifier (%u)[igmp_proxy] E - Send IGMP packet to group %u.%u.%u.%u on intf %s [igmp_proxy] F - bind(%u.%u.%u.%u) failed on intf %s [igmp_proxy] F - sendto() failed on intf %s setsockopt(MRT_ADD_VIF) returned %d [igmp_proxy] E - Add membership %u.%u.%u.%u on intf %s [igmp_proxy] F - Add membership %u.%u.%u.%u failed on intf %s [igmp_proxy] E - Drop membership %u.%u.%u.%u on intf %s [igmp_proxy] F - Drop membership %u.%u.%u.%u failed on intf %s [igmp_proxy] E - Set src filter for group %u.%u.%u.%u on intf %s [igmp_proxy] F - Set src filter failed for group %u.%u.%u.%u on intf %s [igmp_proxy] E - Add mfc entry src %u.%u.%u.%u, group %u.%u.%u.%u from intf %s to intf %s [igmp_proxy] F - MRT_ADD_MFC(src: %u.%u.%u.%u, group: %u.%u.%u.%u, from: %s, to: %s) failed [igmp_proxy] E - Del mfc entry src %u.%u.%u.%u, group %u.%u.%u.%u from intf %s to intf %s [igmp_proxy] F - MRT_DEL_MFC(src: %u.%u.%u.%u, group: %u.%u.%u.%u, from: %s, to: %s) failed [igmp_proxy] E - IP Address %s doesn't belong to any IGMP interface ?ethi.c[%s] E - : Setting retry timer(%d secs) ethiethi_ip[%s] F : but not retrying state !! [ETHI] E - MBus request parsing failed (%s)ethicmd_%x[%s] F - : Destination %s has invalid interface type !! ETHIethi.lstate[%s] E - : ETH_STARTLINK : already OPEN [%s] E - : ETH_STARTLINK : No destination [%s] E - : ETH_STARTLINK : start failed %s_%d[--] E - : NEW : interface name %s already exists [--] E - : NEW : no more sessions available [%s] F - : Failed to delete ETH interface, interface is still in use ! EthIntfStatusReferenceWLAN.WDS.StationPhysTechnologyETHUSBWLANeth_%i%s%s: Phys stats plugin processing cmds failed: %s%sETH_MBUS/proc/net/dev%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%lu%s%s: enum types registration failed: %s%s%s%s: %s registration failed: %s%sFailed to open an management socketFailed to remove vlan interfaceFailed to add vlan interface%s.%dFailed to rename vlan interface[%s] E - : Connected succesfully [%s] F - : Unable to set up ethernet interface invalid interfaceETHPethi_phy_mon.cFailed to send message to kernelFailed to get the netlink messageFailed to bind addr to socketexsdFailed to create domain socket Failed to bind domain socket linux_expr_storaged.cSelect failed, errno = %d recvfrom socket failed with errno=%d Bad packet size received sendto socket failed with errno=%d Bad packet size send Select, more bits set than actions we are waiting for. xsm_create('expr') failed.xt_create('expr') failed.xt_start('expr') failed.Ef Ef,EfXEfxEfEfE EEE E ans_daemon.cRequest sent*** timeout = %us *** ansr[dnsc] E - DNS server channel %u closed. Out of memory in sys_init()!ansr_int[dnsc] F - corrupted packet received on external channel. [dnsc] F - corrupted packet received on external channel Response received[dnsc] F - Unrequested packet received on external channel -> %s -> type = A type = PTR type = ATMA type = CNAME type = NS type = %d (?), ans_class = IN, ans_class = CHAOS, ans_class = HS, ans_class = ANY, ans_class = %d (?), dlen = %d ip address = name = atm address = canonical name = nameserver = (?) = %u ttl = %us ------------ %s on channel %u (%d bytes) HEADER: id = %d, opcode = QUERY, opcode = IQUERY, opcode = STATUS, opcode = ?, rcode = NOERROR, rcode = FORMERR, rcode = SERVFAIL, rcode = NXDOMAIN, rcode = NOTIMP, rcode = REFUSED, rcode = %d (?) header flags: , want recursion, truncated, auth. answer, check disabled, authentic data, recursion avail., UNUSED bit set questions = %d, answers = %d, authority records = %d, additional = %d QUESTIONS: %s, type = A, type = PTR, type = ATMA, type = CNAME, type = %d (?) ANSWERS: AUTHORITY RECORDS: ADDITIONAL RECORDS: %u.%u.%u.%u.in-addr.arpaans_resolver.cansrres_%xans_packet.c.in-addr.arpa%u.%u.%u.%uParse packet error: expanded name too big0123456789Service UnavailableNot ImplementedInternal Server ErrorNot FoundUnauthorizedBad RequestNot ModifiedNo Contentdyndnsd.cdyndnsddyndcmd_%xdynd_mgrdynd_res[%s] E - Resolving service host name %s for update [%s] F - Timeout for server %s DYNDNS%s Server Timeout (%s) for client %s[%s] F - Failed to resolve service host name %s for update %s Failed to resolve host name %s for client %s[%s] F - Connect to dynamic dns server %s failed %s Connection failed to %s for client %s[%s] E - Connecting to dynamic dns server %s recvfrom netlink socket failed[%s] F - Connection failed to %s for update [%s] E - Connect completed succesfully, sending update [%s] E - Sending update to dynamic dns server with authentication %s [%s] E - Sending update to dynamic dns server %s [%s] F - No response from server %s HTTP/1.%*c %3d[%s] No HTTP reply %s Update failed to server %s for client %s[%s] HTTP %d : %s [%s] Unknown HTTP code %d [%s] F - Bad HTTP packet [%s] E - Authentication needed, renewing the connection [%s] E - MBus request parsing failed (%s)DynDNS service inherit set failedDynDNS service registration faileddynhdyngmemory allocation faileddyncdynsDynamic DNSDynDNS group registration failed[%s] E - : New dyndns client started%s client %s %snochgWarning: update changed no settingsnohostInvalid hostnamenotfqdnMalformed hostname!yoursThe hostname is not controlled by the user specifiedabuseThe hostname is blocked for update abusebadagentThis DynDNS client has been blockedbadauthAuthentication failurebadsysService not recognized by DynDNS.org!donatorA feature requested is only available to credited usersnumhostToo many or too few hosts found, please contact DynDNS.org service supportdnserrDNS error encountered, please contact DynDNS.org service support911Emergency: a serious problem detected at DynDNS.org999good[%s] F - Incomplete dynamic DNS configuration, unable to send update %s Update failed for client %s, incomplete configurationGET %s?system=%s&hostname=%s,myip=%s&wildcard=%s&YESNObackmx=%s&offline=%s HTTP/1.0 Host: %s %s:%sAuthorization: Basic %s User-Agent: %s-%s [%s] E - Dynamic DNS update sent to %s [addr=%s] [%s] F - Too many return codes received from %s [%s] E - Unrecoverable error "%s" received from %s, host %s has not been updated. %s Update failed for client %s (%s), host %s has not been updated[%s] F - Wrong update address received from %s %s Update failed for client %s[%s] F - Unable to update last_update [%s] E - Host %s has been updated successfully by %s %s Host %s has been updated successfully by %s dyndnsstatdnscustom:11 :0 :12 :9 Host not updated because it is a web redirect:2 :10 Group not found at no-ip.com:8 Host has been disabled and cannot be updated:3 Incorrect password:4 User not found at no-ip.com:6 User has been banned for violating terms of service:7 IP address is a private network address:99 This no-ip client has been blocked:1 [%s] F - Incomplete no-ip configuration, unable to send update username=%s&pass=%s&h[]=%s&ip=%sHOST: %s User-Agent: %s %s [%s] E - Dynamic DNS update sent to %s [group=%s:addr=%s] [%s] F - Unknown return code received from %s [%s] F - Too few return codes received from %s No-IPThe hostname you supplied is not validThis account has not yet been activatedAccount has not been activated at dtdnsNo password was suppliedNo PW (password) is specifiedNo hostname to update was suppliedNo ID (hostname or domainname) is specifiedThe password you supplied is not validAdministration has disabled this accountAdministration at DTDNS has disabled the accountIP field cannot be blankIP is present but no IP address was specifiedIllegal character in IPIllegal IP address specifiednow points to[%s] F - Incomplete dtdns configuration, unable to send update id=%s&pw=%s&ip=%s&client=%s_%s HTTP/1.1 Host: www.dtdns.com User-Agent: %s_%s [%s] E - Dynamic DNS update sent to %s [host=%s:addr=%s] [%s] E - Unrecoverable error "%s" received from %s, host %s has not been updated DtDNSinvalid login or other problemoffline success[%s] F - Incomplete GNUDIP configuration, unable to send update GET http://%s%s HTTP/1.0 xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:cwmp="urn:dslforum-org:cwmp-1-0"> xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap="http://schemas.xmlsoap.org/soap/encoding/" xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/" CWMP detail headerholdrequestsnomorerequestshl_stream_CwmpWriterhl_stream_cwmpwriter_poolcwmp_stream_writer.cMemm alloc error (cwmp_stream_writer)Memmory allocation error (cwmp_stream_writer)cwmp_argroup_poolCompletedNo errorFW header invalidFW verification failedFW size too large to fit in memoryCannot store UD configurationUnexpected boot flagFW flashing failedUpgrade Daemon configuration file corruptedAuthentication to FW website failedUpgrade.Image is filled inUpgrade.Image could not be filled inCWMUParameterkey : %s Configure the cwmpd as seen from the ACS.All server(ACS) commands.runtimevarRuntime variable modifications.TR69 Methods.debugDebug commands.View the current notificationstraceconfigEnable or disable tracing.Set the cmd nameSet the cmd keystarttimeSet transfer start timecompletetimeSet transfer complete timesoftwareVersionSet the build softwareversionbootstrapSet the bootstrap flagSet the cmdkeySet Parameter KeyConfigure the cwmpd towards the ACS.Set the HTTP URL used to contact the ACS server.Set the username for ACS Digest Authentication.Set the password for ACS Digest Authentication.The state of the cwmp daemon.Set the operation mode of the cwmp daemon.periodicInformSet periodicInform flag of the cwmp daemon.periodicInfIntSet the interval between two periodicInform messages in seconds.sessionTimeoutSet HTTP session-timeout in seconds.noIpTimeoutSet time (in seconds) ip may be 0 after uploading new config file.maxEnvelopesSet the maximum number of SOAP envelopes send within one http-message.connectionRequestSet connection request flag of the cwmp daemon.connectionReqPathSet the path where the cwmp daemon can be reached.connectionReqUserNameSet the username the ACS must use to log in.connectionReqPsswdSet the password the ACS must use to log in.connectionReqAuthSet the authentication type of modem CWMP server for asynchronous connects.qos-classSet the quality of service class for outgoing CWMP data.bootdelayrangeSet the delay on boot before inform is sent.am1TerminationSet if am 1 session termination is enabled.connectionReqThrotNumberSet the connection request throttling maximum number of accepted requests within period.connectionReqThrotTimeSet the connection request throttling period in seconds in which max requests is reached.read-onlyserver configdebug traceconfigSaving transfer ACS url : %s ACS username : %s ACS password : ******** Unsupported URL. The url must include %s or %s. Port is delimited to %d chars. State : %s Mode : %s Max Envelopes : %lu Session Timeout : %lu No Ip Timeout : %lu Connection Request Port : %lu Periodic Inform : %s Periodic Inform Interval : %lu s Connection Request : %s Connection Request UserName : %s Connection Request PassWord : ******** Connection Request Path : %s Connection Request Authentication : %s Connection Request Throttling Number : %lu Connection Request Throttling Time : %lu Qos class : %d Boot delay range between 0 and : %d s Amendment 1 Session Termination : %s [CWMP] NoIpTimeout must be minimum %d s. Software Version : %s yesBootstrapped : %s CmdKey : %s Fault while parsing cmds Creating transfer Level: %lu CWMP configuration error: only levels up to %d are allowed. Set the tracelevel (0-%d).InternetGatewayDevice.DeviceSummaryInternetGatewayDevice.DeviceInfo.HardwareVersionInternetGatewayDevice.DeviceInfo.SpecVersionInternetGatewayDevice.ManagementServer.ParameterKeyInternetGatewayDevice.DeviceInfo.ProvisioningCodeInternetGatewayDevice.DeviceInfo.X_000E50_SoftwareVersionInternetGatewayDevice.ManagementServer.ConnectionRequestURLnotif != ((void*)0)cwmp_notification.c(== %param_eventable 0)notifCWNOcwmp_notification_typepassiveforcedRuleNotifiedParameterReceived NULL notification rule. This should not happen.Received NULL notification param. This should not happen.CWMP.Notification.RuleCWMP.Notification.NotifiedParametera rule which defines a notificationnotifiedparametera notified parameter waiting to be sendSet the notification pathSet the type of notificationkeystringThe keystring_id of the notification ruleNot enough memory to allocate pathnotification notifiedparameterrequestdownloadresponseSRADSecure remote access daemon RADRemote access daemon PHTTPHTTP serverPhttps%s://%d.%d.%d.%d:%dRADrad_atomrad_dynstr_pool[RAD] Found portmap matching %d[RAD] unable to register http in servmgr[RAD] unable to register rad in servmgr[RAD] unable to register rad-secure in servmgrHTTPHTTPsRemoteAccessSecureElapsedTimeRandomPasswordRandomPortUsers.Userrad_modetypesPermanentTemporaryrad_statustypes[RAD_MBUS] RAD_MBUSAdminGroupDeviceConfigConfigSaveABCDEFGHIJKLMNPQRSTUVWabcdefghijkmnpqrtuvwxyz2346789!@#$%&+-=/Id(IdIdIdIdIdIdIdIdIdIdIdIdIdIdIeIeIeIe Ie IhIhIi|Ij IjIiIjIiIiIiIiIiIiIiIj IjxIjxIkpIjIjI@I0I8I@I@I@I@IIHIIII¨IIIII¨IIIIIIIIlIάIϤIЌIЌIЌIIЌIЌIЌIЌIIЌIЌIЌIʼI(IIЌI,JQ8JO(JO(JPJOJOJ{dJ{TJ{DJ{4J{(J{J{JzJzJzJzintegerPERPER Encoder/DecoderPERERRPER Error MessagesRvAsnPERchoice 0123456789constrained lengthnormally small length (1st bit)normally small lengthunconstrained length (1st byte)unconstrained length (2 bytes)normally small intQ931Q931ERRQ931 ErrorsCIConfiguration InterfaceCONFIG**BUF**rbwb# RADVISION H.323 Stack Configuration File # # Value encodings: # '' - String (and asciiz is not appended) # "" - BMP string of ASCII characters # [] - Hex octet string # <> - IP # {} - Object ID # %% - Bit string # Other - Integer CI tree!CIBITSTR!**VF**UNIVERSALAPPLICATIONEMPTYINTEGERBOOLEANENUMERATEDOBJECT IDENTIFIEROCTET STRINGBIT STRINGGeneralStringUniversalStringBMPStringIA5StringVisibleStringNumericStringPrintableStringCHOICESEQUENCESEQUENCE OFSET OF(null)[%s %d] (%d..%d) (%u..%u)or(%d..%d) FROM '%s' VTValue TreeUNREGAny non-registered user logVT treepvt_pst/pvaltree.c. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . %2d> <%d> $fid=%d$ = (%u) = %d =0x0123456789abcdef <%u.%u.%u.%u> [%s] EMAEnhanced Memory AllocatoremaUnlockemaDeleteemaReleaseemaReturnFromCallbackjstandardmember-bodyidentified-organizationrecommendationquestionadministrationnetwork-operatoritu-tjoint-iso-itu-tccittjoint-iso-ccittRAR ArrayraAdd (%s): Array full (%d elements) %19s | %11d| %10d| NA|CATCall Association TableCAT HASHCAT CALLS9!\#EEi8 E.!~L$,vKNKNKNKNKO L L LLL`LLL8L77LwLwLwLwLwLwLw\Lw@Lw$Lw LvLvLvLvLvLvLLLLLLLLLLLLLLLLLLLLLLLLL L L LLLLLLLL LLLLLLLLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLdLdLdLdLdLdLdLtLdLdLdLdLtLdL\LtLtL\LtL\L\L\L\LdLdLdLdLtLtLtLtLtLtL\LdL\LlLlLdLtLlLlLlLlLlLlLlLlLlLlLdLdLdLdLtLtLtLdLdLdLdLtLtLtLtLdL\LdLdLtLtLtLtLtLtLtLdL L(L0L8L@LHLPLXL`LhLpLxL΀LΈLΐLΘLΠLΨLΰLθLLLLLLLLLLLLL L(L0L8L@LHLPLXL`LhLpLxLπLψLϐLϘLLS>S> S>,S>8S>D01SUxSUSUSVSV@SV|SVSVSW0SWhSWSWSXSXXSXSXprc2~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~~*~@@@@@@~*~prc2~4~$$$$$$~4~prc4~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~~*~$$$$$$~*~prc4itu-t (0) recommendation (0)itu-t (0) recommendation (0) h (8) 235 version (0) 1 1itu-t (0) recommendation (0) h (8) 235 version (0) 2 1itu-t (0) recommendation (0) h (8) 235 version (0) 2 20itu-t (0) recommendation (0) h (8) 235 version (0) 1 2itu-t (0) recommendation (0) h (8) 235 version (0) 2 2itu-t (0) recommendation (0) h (8) 235 version (0) 1 9itu-t (0) recommendation (0) h (8) 235 version (0) 2 9itu-t (0) recommendation (0) h (8) 235 version (0) 1 4itu-t (0) recommendation (0) h (8) 235 version (0) 2 4itu-t (0) recommendation (0) h (8) 235 version (0) 2 22itu-t (0) recommendation (0) h (8) 235 version (0) 1 3itu-t (0) recommendation (0) h (8) 235 version (0) 2 3itu-t (0) recommendation (0) h (8) 235 version (0) 1 7itu-t (0) recommendation (0) h (8) 235 version (0) 2 7itu-t (0) recommendation (0) h (8) 235 version (0) 2 21itu-t (0) recommendation (0) h (8) 235 version (0) 1 5itu-t (0) recommendation (0) h (8) 235 version (0) 2 5itu-t (0) recommendation (0) h (8) 235 version (0) 1 6itu-t (0) recommendation (0) h (8) 235 version (0) 2 6iso(1) member-body(2) us(840) rsadsi(113549) pkcs(1) pkcs-1(1) 4iso(1) member-body(2) us(840) rsadsi(113549) pkcs(1) pkcs-1(1) 5itu-t (0) recommendation (0) h (8) 235 version (0) 2 23iso(1) member-body(2) us(840) rsadsi(113549) encryptionAlgorithm(3) 2itu-t (0) recommendation (0) h (8) 235 version (0) 3 27iso(1) identified-organization(3) oiw(14) secsig(3) algorithm(2) desCBC(7)itu-t (0) recommendation (0) h (8) 235 version (0) 3 28iso(1) identified-organization(3) oiw(14) secsig(3) algorithm(2) desEDE(17)itu-t (0) recommendation (0) h (8) 235 version (0) 3 29itu-t (0) recommendation (0) h (8) 235 version (0) 3 30joint-iso-itu-t(2) country(16) us(840) organization(1) gov(101) 3 nistAlgorithm(4) aes(1) cbc(2)itu-t (0) recommendation (0) h (8) 235 version (0) 2 40itu-t (0) recommendation (0) h (8) 235 version (0) 3 40itu-t (0) recommendation (0) h (8) 235 version (0) 2 43itu-t (0) recommendation (0) h (8) 235 version (0) 3 43itu-t (0) recommendation (0) h (8) 235 version (0) 3 44iso(1) member-body(2) us(840) 113548 10 1 2 1~*~!!!!!!~*~SECh235 Security add-onprime generation functionsetupcallProceedingalertingin:%sReceived q931 message: %ssending RAS message %s, bytesEncoded %d, messageLength size %d (with security info) (no security info, because target id is unknown)Received RAS message: %sUndefinedNoSecureRequiredNoSecurityInfoMessageErrorSendersIDMissingGeneralIDIncorrectUnknownSenderProcNotSupportedTimeStampMissingTimeStampFailTimeRandomFailIncorrectAuthEncodeCBMissingAppForceFailGeneralErrorreason unknownNoneProcedure1+1aProcedure1a+2Procedure2+3Procedure3+4Procedure4+4DHProcedure4DH+DH-512Diffie-Hellman 512+DH-1024Diffie-Hellman 1024+DH-1536Diffie-Hellman 1536SecurityOKSecurityFailedstate unknownsending Q931 message %s, bytesEncoded %d, messageLength size %d (no security info can be added to empty facility)S|S|HS|S|@S}DS}S}S}S}S}S~S~S~ S~(SSSSSST9@T9TT9hT9|T9T9T9T9T9T9T?T@T@T>T>T>T?T?T?(T?T@T@T@(T@?@A7+* B B7+* C CDEF7+* G G||||HFFFFFFFFFFFFFF F@JJJJJ"IIIJH#K#>>>>>>>>>>>>>>$?<<<<<<<<<<<<<<%=::::::::::::::&;88888888888888'966666666666666(7||||@[[[[[)YY('&%$YY#=8:<*<]||||@LLLLL+)))L('&%$))#OOOOSOOMOOOOOOOOOSSSSS-NOPPPPSPPMPPPPPPPPPSSSSS.NP@QQQQQ/IIIQH#@RRRRR0IIIRH#S1||||TGGGGG2!!!T!!!!!!!!!!!! !7+*3 U U7+*4 V V7+*5 W W7+*6 X X7+*7 Y Y+*778 Z Z29[(:(77777777777777777777777+*7777777; 7+*< \ \2=]7+*> ^ ^7+*? _ _7+*@ ` `7+*A a a2Bb2Cc7+*D d d7+*E e e7+*F f f2Ggiiii,iiii,,,,,Hhi@MMMMMIKKH#=8:<J<^7+*K j j=8:<L<\7+*M k k):Nl:)||||mGGGGGO!!!m!!!!!!!!!!!! !||||nGGGGGP!!!n!!!!!!!!!!!! !=8:<Q<P=8:<R<OSo@pppppTIIIpH#2Uq2Vr2Ws2Xt1Yu;Z;[v2\w}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}]yx2^z2_{2`|2a}777777777777777777777777777777777777777+*777777b ~ ~c2d2e2f77777777777777777777777777777777777777+*777777g ++++++++++++++h-||||111111i('&%$32j2k7777777777777777777+*77l T T@mIIIH#@nIIIH#7+*o =8:<p<N):q:)x):r:)):s:)):t:)7+*777777u 7+*777777v 77+*77777w x):y:)7777777777777777777777777777777777777777777777777777+*777777z  777777777777777777777+*777777{ 7777777777777777777777+*777777| 77777777777777777777777777+*777777} ~ """""""""""""""""""""""""""""""#"""""""""/-)::)7777777777777777777+* )::))::)||||2('&%$0077777777777777777777777+*777777 7+*77777 =8:<<V=8:<<U2777777777777+*77 z z)::)777777777777777777777+*77 w w)::)777777777777777777777+*77 u u)::)7777777777777777777+*77 r r)::)""7777777777777777777+*77   %/-)::)$7777777777777777777+*77  )::))::)+*AAAAAAAAAAAAAAAAAAAAAAAAAAAAA+*7+*777777 777777777777+*77 y y777777777777777777777+*77 v v777777777777777777777+*77 t t7777777777777777777+*77 q q+*+*+*77777777777777777777777+*7777777 SSSSSSSMSSSSSSSSSSSSSSNd1)::)77777777777777777777777777777777777777+*77777777 77777777777777777777777777777777777777+*77777777 77777777777777777777777777777777777777+*77777777 7+*  )::)7+*  +*+*+*+* +* +* +*77   """"""""""""""""""""""""""""""""""""""""#7+*   7777777777777777777+*77  """"""""""""""""""""""""""""""""""""""""0.+*77  7777777777777777777+*77 7777777777777777777+*77 77777777+*777777  BBBBBBBBBBBBBBBBBBBBBBBBBBBBB+*7+*77777 +*                                                       !  +*66"#######+*66$%iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiij&777777777777777777777777777777777777777777777777+*777777 ' '):():)):*+:)):,-:)1./1077777777777777777777777+*777777 1 177777777777777777777777777777+*777777 2 27777+* 3 37777777777777777777777777+*777777 4 477+* 5 577+* 6 6): 7:) 899999999999.:):;:)):<:)=============>>>>>>>>>>>>>@>>>>>>>>>>>>>>>>>>>>>>>>>>>>A@?>>>):B:)7777777777777777777+*77 7777777777777777777+*77 CCCCCCCCCCCCCCDCEEEEEEFEEEEEEEEEEEEEEEEEEEEEECIHGEE3+*6J6+*77 K K%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&%,):!M:)L+*"NNNOOPPPPPPP#+*77$ Q Q%,,,7777777777777777777+*77&  RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR'S):(T:))U):*V:)+W):,X:)-YZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ7777777777777777777+*77/ 7+*7777770 [ [\\\\\\\\\\\^_\\\\\\\\\\\\\\\\1]\\\\\\\\\\\\\`acdef\\\\\\\\\\\\\\\\2gb\\hj3ki\\\\\\\\\\\mn\\\\\\\\\\\\\\\\4ol\\5p6q7r08s+*77: t t7777777777777777777+*77;  7777777777777777777+*77<  =uvwA7777777777777777777+*77B xxxxxxxxxxxxxCmx+*DySSSSSSSSSSSSSSSSSSSSSSSSSSSSTS,Fz+*G{{{):H|:)+*I}}}~~7+*777777J  ):K:)'L'M+*N66+*NNNP):Q:)eeRgg):S:)7777777777777777777+*77T  7777777777777777777+*77U  7777777777777777777+*77V ! !7777777777777777777+*77W  7777777777777777777+*77X   7777777777777777777+*77Y  [+*]+*^+*_`a+*b+*c+*d+*e+*f+*g''h)+*i+*j+*k+*l+*m+*n+*o+*p+*q7777777777777777777+*77r +*77s  ):t:)>>>>>>>>>>>>>@>>>>>>>>>>>>>>>>>>>>>>>>>>>u>@?>>>>>>>>>>>>>>>>@>>>>>>>>>>>>>>>>>>>>>>>>>>>v>@?>>>wooooooooooooop7+*777777y  zFDB@WX+*V{V66ZFFFFFFFFFFFFFFFFF|+*}66M+*77~PO)::)7777777777777777777+*77  ,+*77  7777777777777777777+*77                         +*77  7777777777777777777777+*777777  7777777777777777777777+*777777  7777777777777777777777+*777777  7777777777777777777777+*777777  7777777777777777777777777+*777777  7777777777777777777777777+*777777  777+*777777  777777777+*777777  7777777777+*777777  &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&(&7777777777777777777777777777777777+*777777  7777+*777777  7777777777+*777777  7777777777777777777777+*777777  7777777777+*777777  777777777777777777777777+*777777  7777777777+*777777  7777777777+*777777  7777777777+*777777  )::)qU+*J33333333,,,,,*+*,Y7777777777777+*77 G G]]]]]]]]]]]]]]]]]]]]]]]]]]]]^+*866MDDDDDDDDDDDDDDDDD)::)7777777777777777777+*77  )::)vwu7777777777777777777+*77  r+*WX+*VV66ECA?]>r;KJJ:]8  +wv   +*66Ic[[7777777777777+*77 E E))))))))))))))))))))))))))*+*77  7777777777777777777+*77              !!!!#,s t77777777777777777777777777+*777777 ! !,+*77 " K#ZZZ######\$$$$$$$$$$$$$%o%%%%%%q&&&&&&&&&&&&&()*-+,'......./////////////,0,4132,2334,5,6,,73 89999999999999:uuu9999999999999999999999999999999 9u9999999999999:ttt9999999999999999999999999999999 9t9999999999999:sss9999999999999999999999999999999 9saaaaaaaaaaaaaaaaaaaaaaaaaaaaaba+*;;;):<:)7777777777777777777+*77  =======>?       "              @@@@@@@@@@@@@||A||||BB~CDC E!F["[GHSSSHHHHHH#[IIIIIIIWWWIIIIII$YJmJJJJJJ%pKKKKKKKdKKKKKK&f'  )  *  +  ,  -IIIIIIIGGGIIIIII/I0L 15]2= 33MNVMMMMMM4<5O6P 7-KJ8J9|Q:wv   +*;66Hc<RSSSSSSS=TTTTTTTTTTTTT>U?             AyA}{VCVWD,EX+*77F Y Y+*77G LZQQQZZZZZZHT[[[[[[[LLL[[[[[[IX\k\\\\\\Jn]]]]]]]b]]]]]]Ke,6^HSHHHHHHMU_____________N,.`,0abbbbbbbbbbbbbQb7777777777777777777+*77R  cccccccSc             TU>deVWX):Yf:)ROOORRRRRRZRMMMMMMMGGGMMMMMM[Mgigggggg\lhhhhhhh`hhhhhh]c ^7[[[[[[[L[[[[[[_N `/ a1ooooooooooooo{idjej7777777777777777777+*77f kgkkkkkkgjlllllll^llllllhai>mnj#Z######khIIIIIIIWIIIIIIl_omxnxo>pqpq>rsrs>tutu>vwvw>xyxy>z{z{:MXATNYS-DA:MTNOBCRRLT46NPASEFTORDNE$%+-0:AEGINRST0+"ETORDNERSAIT.@"\@N[DHMS\].%::46PI46PAEGINR-]%+/?~/??%-SAIL-461-DIW-PASCPABEGNPV$-$-:%+0CPVVVCPVC125LAAHR:ETACI#>MMOQM_bOfifflnM_bfQQffpQnrrMMOfwz|nrMMOwpz|nbb;%$)+<' 1-3/Son{Son{= )?Hb)@ETcgnt|'7GWgx!*3<GNQs|'Rmu{!Zdgj Q%4C6i   N P R W q ' 2 Z h t |   8 @ K U a  8 \   ? m s  ?t7?ESi4rx:AIin8<CJy <BGdQ^lv%Y&Mnv(.[bfl}.N_j%)DHcg'0SZ^wz (;@^aekq0Mj!@a28<@Yck!B]z   % I j !!=!N!e!}!!!!""":"`"x"""""# ###### ###&#)#,#/#2#5#8#<#A#T#v######$$$.$N$n$$$$$% %7%F%[%|%%%%%&&B&N&Q&^&&&&&&&&&&&&&'#'1'E'e'j''''''((((;(J(T([(i(w((((((((()))&).)6)?)M)O)R)U)X)[)^)a)d)g)))**#*)*D*Q*_*i*r*{********++ +-+9+F+X+b+r+{++++++++++++,,,, ,,D,F,k,,,,,,,,,,,,,- --&-)-3-B-D-G-V-o------------. ...".*.,.4.M.[.k.z.~............../ ///{rmjhg$>?@JKLQRWXikp%$#6789on%$#6789$>Son=<;BCDEYZ[\]^_`abcdefsS=<;STUVabdefs S=<;%$#6789Son=<;MNYSon=<;MNYSn=<;BCDE[\]^_`abcdefsSn=<;BCDE[\]^_`abcdefs{Az%$#7on1%$=<;:3%$#6789 !"=<;:3%$3%$#67893%$3%$3%$3%$3%$#67893%$#67893%$3%$3%$3%$#6789SnBC[\]^_`abcdefs=<;FGHI S=<;S=<;S=<;S=<;S=<;S=<;STabdefs =<;:S=<;STUVabdefs oYSn=<;OPSn=<;OP=<;FGHI =<;FGHI {Sn=<;BCDE[\]^_`abcdefs3%$#67893%$#67893%$#67893%$#67891%$#6789%$#678932"]Son=<;%$ #67893%$#6789323%$#67893%$#67893%$#67893%$#678932323%$#67893%$#67893%$#678932S=<;]=<;FG =<;:3%$#6789=<;:3%$#6789 !"Sn=<;BCDE[\]^_`abcdefsSn=<;BCDE[\]^_`abcdefs=<;:=<;:3%$|=<;FGHI 3232323210%$ 32S{on=<31/-+)'%$ uv32323232S{on=<31'%$ #6789S{on=<31'%$ jknyz323232S{on=<31'%$ #6789S=<; S=<;abdefs3232Sn=<;%$#6789=<;FGHI =<;FGHI 3%$#6789=<;:S{on=<31/-+)'%$  !"qS{on=<31/-+)'%$  !"S{on=<31/-+)'%$  !"S{on=<31/-+)'%$  !"%$ #6789%$ #6789]%$ #6789S{on=<31/-+)'%$ xy !"S{on=<31/-+)'%$ #6789S{on%$ #6789S{on%$ #6789S{on%$ #6789S{on=<31' olS{on=3/)'%$ |}~S{on=<31/-+)'%$ S{on=<31-+'%$ olpqrolS{on=<31-'%$ l-,) !"(S{on%$#6789S{on=<31/-+)'%$  !"S{on=<31/-+)'%$  !"S{on=<31' iSabdefsS'{on'%$ #6789%$ #6789=<;:=<;:32S{on=<31/-+)'%$ S=<;%$#6789 !"Son=<;%$#6789 !"Son=<;%$#6789 !"Sn=<;%$#6789 !"  `] S{on=<31/-+)'%$ xSn=<;%$#6789S{on=<31/-+)' ZS{on S{on ghS{on S{on=<31'%$ -,$ ) !"(S{on=3'%$ |S{on=<31/-+)'%$ S{on=<31'%$ S{on=3'%$ nyzopolS{on=3/)'%$ |}~S{on=<31-+'%$ S{on=3'%$ mswxyS{on=3'%$ jknyzS{on=<31'%$ Sn=<;%$#6789S{onSn=<;%$ !"Sn=<;%$ !"S{on=<31' %$#S'{on'  %$#%$ #6789S=<;%$#6789Son=<;%$#6789Son=<;%$#6789Sn=<;%$#6789 %$#edcba%$#78 ^%$#78]Son=<;%$ #789]Sn=<; OPS{on=<3/-+)'%$ 7:1 !"0S{on=<31'%$ #6789S{on=<31'%$ #6789S{on=<31'%$ #6789S{on 1%$#6789 !"S{on g1%$#6789S{on %$#S{on%$ #S{on%$ #S{on%$ #%$#%$#%$#6789S{on=<31'%$ %$#6789$ S{on=<31'%$ Sn=<;%$#6789S{on=3'%$ S{on=<31/-+)'%$ o/)tuv/.+*S{on<+) %$#6789Sn=<;%$#6789Sn=<;%$Sn=<;%$#6789Sn=<;%$S%$ #6789S'{on' %$#78%$ #6789%$# } S{on=<31/-+)%$  %$ #7` ]%$ #7]Son=<; S{on=<3/-+)'%$ Sn=<;%$S{on=<31/-+)'%$ #6789S{on=<31'  !"S{on=<31'  !"S{on=<31'  !"10Sn=<;%$10S{on%$ #6789S{on S{on%$ #6789S{on %$#6789S{on S{on%$ #6789%$#6789%$#6789 !"5/)$ +*S{on=<31/-+)'%$ S{on=3'%$ swxyot !" !"S S{on<+) S{on<+)%$  !"Sn=<;%$#6789Sn=<;%$#6789S ;S'{on'  "-.5%$ #47`%$#6789S{on=<31/-+)%$ ' !"&%$#78 %$#6789oMYSn=<;%$#6789S{on=<31/-+)'  !"Sn=<;%$ !"Sn=<;%$ !"Sn=<;%$S{on=<31'%$ Sn=<;%$#6789%$ #6789S{on S{on S{on Sn=<;%$/.5$ %$#6789Sn=<;%$#6789Sn=<;%$#6789S S{on<+) %$Sn=<;%$#6789S <>%$#S{on' -'&%$#78 !"%$#78*+%$ #6789 !" Sn=<;%$%$ #7`%$#78  !"S{on=<31/-+)'%$ 8 !"Sn=<;%$#6789Sn=<;%$#6789Sn=<;%$#6789Sn=<;%$#6789Sn=<;%$#6789Sn=<;%$#6789S{on=<31'%$  S{on %$#S{on%$ #S{on%$ #S{on S{on %$#%$#%$#%$#%$#%$#S{on=<%$ %$#%$#%$#%$#S{on%$ #S{on%$ #%$#%$#%$#Sn=<;%$#6789%$#6789 !"S{on<+)%$ S{on<+)%$ S{on<+) S %$ #6789S{on (%$ #7#&/S=<;%$!S{on'%$ #7)1%$#789* !" `Sn=<;%$#6789'%$#&6789Sn=<;%$#6789 Sn=<;%$%$#6789S{on<%$ #6789S{on S{on<%$ #6789S{on S{on<%$ #6789S{on<%$ #6789S{on<5%$ #6789S{on<5%$ #67895%$ #6789S5%$ #6789S<5%$ #6789S{on=< S{on<+)%$ #67895%$ #6789S<5%$ #6789S{on<%$ #6789SO5%$ #6789S{on<5%$ #6789S<5%$ #6789S<5%$ #6789S<5%$ #6789 !"S{on<+)%$  ?S{on %$#785454545454545454'&'&'&'&'&%$#78'&S=<;%$#6789S{on' S{on'%$ #7)1S=<;%$Sn=<;~S{on   !" Sn=<;%$#6789 !"S{on< S{on< S{on< S{on< S{on<5 S{on<5 5 S5 LS<5 S{on<+) 5 S<5 S{on< SO5 CDERTWS{on<5 @AS<5 S<5 S<5 Sn=<;%$#6789S{on<+)  %$#%$ #7#S{on< S{on<  S L    S{on'%$ #7%345 $S=<;%$#6789S{on %$#6789Sn=<;%$ Sn=<;%$#6789S{on< S{on<  S <S< S{on<+) %$  SS S LSS<%$ GHLQO1NXO1NS{on< '&BS{on%$ #6789'%$#&789'%$ S ' S    S '&'&54'&54'&'&'&54S{on=<31' iS{on=<31' iS{on=<31' iS{on' 3%$#78 !"Sn=<;%$#6789 S L   S LS LS SO<1%$ LMO<1%$IJK<%$FYS<%$ GHLQS GHL<%$FY ZS{on  $'%$ S'%$ ' S'   <'%$ <'%$ <'%$ <'%$ <'%$  S'%$    S{on=<31' 5S{on'%$ #7%345Sn=<;%$ S <S S HL1I O<%$P'%$&\%$#6789%$#789'%$ S'%$ ' S' '&' S '&'&S >Sn=<;%$#6789%$ _S S L<S GHL [ !"'%$ S'%$ ' S' S' S  < Sn=<;%$#6789' S' S L<' S' < S L<S L<S L<S L<S L<S L<S L/EK{?CHUdiqz )9IYs{'09CMPSy =hpx}(cfilY+:I<l   O Q T \ w * ; ` o w   ! > D N Z g  < a   A r u Fw9AJYo;u}<GMkt 9BDK| ACMjUem{+_ (Sp|-/adjp~ 1Ufp'-FLek,4X\`y| .>B`ciox6Sp#De6:>B_io 'Fi|  ! + O l !!C!T!k!!!!""("@"f"~"""""# ######"#%#(#+#.#1#4#7#:#@#C#Z#w######$ $$2$R$r$$$$$%%<%K%`%%%%%%&&G&O&S&c&&&&&&&&&&&&&'*'4'K'f'p''''''((((>(N(U(\(j(y(((((((())))')/)8)@)N)Q)T)W)Z)])`)c)f)i))**!*'*-*J*R*b*j*t*}********++ +2+<+H+Z+d+t+|++++++++++++,,, , ,,E,G,r,,,,,,,,,,,,,---(-+-5-C-F-I-X-u------------....#.+.-.6.S.].m.}...............///  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ##&(*,.024788996::::>>??@@CDDEEGHHIINNPPTUUVVBBBBBBBBBBBBJRXiKKkLLQQWqqpsvxyyufz|~A}[\]^_`abcYMOdeZ     FSS !   *++-.."(###&&$11)344%%88::7;;>><?@@@CCFIJJKKGMMMHHPPNQQNRDTTWWYYXEE\\BZ[__^`aaaaghhiijpqqrrktuuvvmssnn||}}~~yyyxzAL//////////////55555w!"          mrghj'5]O]oll'bcdeo555OO::EPARSE:TPMAP:IASM164WIDSAPCVONLYC2543PMAPNLYECVNCVONLYPMAPNLYECVTMNNASLIAS164WIDSAPFC2543$CG$$$ORTCICI:XCICICIPICIIID///323C-TP/AVP:TMFUSTOMEE:U  ("$'.49=58:%+.1'colon':'equal'='minus"-"omwspEOMEOF'.''}'proto_versionbody_fieldsmedia_descriptioncontinuebad_syntaxbad_syntax_timerepeat_lineszone_adjustmentsbad_syntax_repeatcontinuemmedia_line_or_fieldsbad_syntaxmreparserepeat_linertpmaporigin_fieldsession_name_fieldinformation_fielduri_fieldemail_fieldphone_fieldconnection_fieldbandwidth_fieldtime_fieldskey_fieldattributeother_field"CONT:""CONTM:"REPARSE PREF"REPARSE:"BAD SYNTAX PREF"BAD-SYNTAX:"'t''r'BAD SYNTAX PREFMbadsyntaxmlinebody"BAD-SYNTAXM:"field_tagUNKNOWN_TAGfield_valueLINE_TEXT'v'sdp_versionorigin_headorigin_body'o'sess_idsess_versionnet_type_addr's'session_body'i'information_body'u'uriemail_headeremail_body'e'email_addressphone_headerphone_body'p'phone_number'c''-'other_addr_typeother_addr_all'$'"IN""TN""ATM""NSAP"nsap_addr_all"E164"e164_addr_all"GWID"alias_addr_all"ALIAS"addrtype_strany_addr"IP4"ip4_addr_all"IP6"ip6_addr_all"RFC2543"tn_addr_alltn_other_typetn_other_allnettype_str"$"nsap_stre164_stralias_strother_strip4_strip6_strtn_strtnothertypexalpha'b'bwtypebandwidthtime_descriptionsession_timerepeat_fieldsstart_timestop_timerepeat_intervalactive_durationtime_offsettyped_time'z'zone_adjustment'k'sdp_keykey_typekey_dataEMAIL_SAFE"~"'a'attribute_bodysendmodeatt_fieldatt_value"RTPMAP"rtpmapbodypayload_typeencoding_nameclock_rateenc_params"SENDRECV""SENDONLY""RECVONLY"ALPHA_NUMERICmedia_linemedia_fields'm'media_bodymedia_dataformat_listmedia_data_nasmediasubportex_port"NAS"nas_access_methodfmtvcIdALPHA_NUMERIC_ATMknown_transport_protoANY_BYTE_NO_SPACEbyte_string_before_colonhexstringHEXintegerstringip4_connection_addressip4_multicast_addressip6_connection_addressmulticast_ipv6_hexpartIP6_addresspartial_IP4_addresshexseqhex1to4hex2"::"multicast_ipv6_prefixunicast_ipv6_prefix_alphaunicast_ipv6_prefixunicast_ipv6_suffixnum_of_addr"0"DIGIT9fixed_len_time_unit"D""H""M""S"emaillocal_part"@""."sub_domaindomain_refdomain_literalquoted_stringEMAIL_ATOM_ONLY"["dtextquoted_pair"]""\\"CHAR"\""qtextscheme":""?"ialphavoid"/"xpalphas"+"URI_SAFEURI_EXTRAuri_escapeALPHA"%"FQDNhex4aliasstrotherstrglobal_tnaddrlocal_tnaddr'+''X'ex_vcciex_cidex_bcgex_portidex_vpiex_vciex_vpciatm_type_addr_m"VCCI"genericU16"CID"genericU8"BCG""PORT"genericU32"VPI"genericU12"VCI""VPCI""NSAP-$""E164-$""GWID-$""ALIAS-$""0X""AAL1/"transport_list"AAL2/""AAL5/""RTP/AVP""H323C-""ATMF""ITU""CUSTOM""IEEE:"announcementtextbyte_stringtext_no_spaceemail_safe_string_no_spaceANY_BYTEField too long Parser stack overflow, line %d, column %d $TNNSAPE164GWIDALIASIP4IP6RFC2543recvonlysendrecvsendonlyField larger than 0xFFFFMissing %sUnexpected %s'%c'inputLOCALEPNSDP Parser Error - Memory allocation fail: At line %d, column %d promptbase64ParseContinue - infinte loop. parserContinueCounter is %dParseContinue - failed to save Bad-Syntax line (rv %d)SDP Parser Error : %d - %s, line %d, column %d Missing NULLUnexpectedSDP Parser Error : %s: line %d, column %d REPARSE:m=b=k=p=u=o=RTP/AVPATM/AVPAAL1/ATMFAAL1/ITUAAL1/customAAL2/ATMFAAL2/ITUAAL2/customAAL5/ATMFAAL5/ITUAAL5/customH323cvideoapplicationimageepnnasatm/avptcpH323c-inactiveVCCICIDBCGVPIVCIVPCIit >= (&((v)->data[0])) && it <= (&((v)->data[(v)->size]))util/rvstring.ci >= (&((v)->data[0])) && i < (&((v)->data[(v)->size]))X\X\XTX\X\X\X\XTX\XXXXDX\XTXTXTXTXTXTXTXTXTXTXTXTXTXTX\XXTXTXTXTXѰXXϔXhXИXXX0XTXtX Y Y \Y \Y \Y Y \Y \Y \Y Y Y \Y \Y \Y \Y \Y Y \Y \Y 0-Y&Y&Y&Y&Y%,Y&Y&Y&Y%tY%Y&Y&Y&Y&Y&Y& Y&Y&Y% YYYYY(Y4Y|YYYYYYYY,TEL:PN:%s$PUU, TEL:%s, NAME:%srvCCProviderH323SetMedia Error hApp=NULLrvIppH323ExtStackConfigCB(hCFG=%prvIppH323ExtStackConfigCBrvIppH323SendCallMessageCB(hApp=%p,msgName=%s,connHndl=%p,hsCall=%p,message=%d)rvIppH323SendCallMessageCBrvIppH323RecvCallMessageCB(hApp=%p,msgName=%s,connHndl=%p,hsCall=%p,message=%d )rvIppH323RecvCallMessageCBrvIppH323DisconnectingCB(connHndl=%p,reason=%s)rvIppH323DisconnectingCBciSetValue(system.callPropertyMode.doNotUseProperty) returned %d ciSetValue(system.maxCalls) returned %d ciSetValue(Q931) returned %dciSetValue(Q931.maxCalls) returned %d ciSetValue(h450system.maxCalls) returned %d ciSetValue(h450system.maxServices) returned %d ciSetValue(system.maxRasOutTransactions) returned %d ciSetValue(system.maxRasInTransactions) returned %d ciSetValue(system.maxChannels) returned %d RAS.maxFailRAS.allowCallsWhenNonRegRAS.registrationInfoRAS.registrationInfo.terminalTypeRAS.registrationInfo.terminalType.vendorRAS.registrationInfo.terminalType.vendor.vendorRAS.registrationInfo.terminalType.vendor.vendor.t35CountryCodeRAS.registrationInfo.terminalType.vendor.vendor.t35ExtensionRAS.registrationInfo.terminalType.vendor.vendor.manufacturerCodeRadivision IPPRAS.registrationInfo.terminalType.vendor.productId1.3.1RAS.registrationInfo.terminalType.vendor.versionIdRAS.registrationInfo.terminalType.terminalRAS.registrationInfo.terminalType.mcRAS.registrationInfo.terminalType.undefinedNodeRAS.rasMulticastAddressRAS.rasMulticastAddress.ipAddress224.0.1.41RAS.rasMulticastAddress.ipAddress.ipRAS.rasMulticastAddress.ipAddress.portRAS.rasPortQ931.callSignalingPortciSetValue(Q931.callSignalingPort) returned %d Q931.responseTimeOutciSetValue(Q931.responseTimeOut) returned %dQ931.connectTimeOutciSetValue(Q931.connectTimeOut) returned %dciSetValue(h245) returned %dh245.channelsTimeoutciSetValue(h245.channelsTimeout) returned %dh245.masterSlaveciSetValue(h245.masterSlave) returned %dh245.masterSlave.terminalTypeciSetValue(h245.masterSlave.terminalType) returned %ditu-t(0) recommendation(0) g(7) 726 generic-capabilities(1) version2003(0)g729wAnnexBg729g728g722-48kg722-56kg722-64kg7231g711Alaw64kg711Ulaw64kg722-56g722-48capabilities.terminalCapabilitySet.capabilityTablecapabilities.terminalCapabilitySet.capabilityDescriptorschannelsg729AnnexAg729AnnexAwAnnexBdataType.audioData.g7231.maxAl-sduAudioFramesdataType.audioData.%s729dataType.audioData.g7231.silenceSuppressiontelephone-event0-15SilenceSuppg711g722maxAl-sduAudioFramessilenceSuppression capabilityIdentifier.standardcapabilityIdentifier.standard not found for genericAudioCapabilitynon-implemented genericAudioCapability: %scapability.receiveRTPAudioTelephonyEventCapabilitydynamicRTPPayloadTypeaudioTelephoneEventcapability.receiveAndTransmitUserInputCapability.dtmfcapability.receiveAndTransmitUserInputCapability.basicStringcapability.receiveAndTransmitUserInputCapability.hookflashcapability.receiveRTPAudioToneCapability.dynamicRTPPayloadTypecapability.receiveRTPAudioTelephonyEventCapability.dynamicRTPPayloadTypecapabilityTablecapability.receiveUserInputCapability.generalStringcapability.receiveUserInputCapability.iA5Stringcapability.receiveAndTransmitUserInputCapability.generalStringcapability.receiveAndTransmitUserInputCapability.iA5Stringcapability.receiveUserInputCapability.basicStringG.711g.711G711G.722g.722G722G.723g.723G723g723G.726g.726G726g726G.727g.727G727g727G.729g.729G729ptimeaudioFramesno bitRate in G.726 codec %snon-implemented genericAudioCapabilityAnnexiA5Stringcapability.receiveAudioCapabilitycapability.receiveVideoCapabilityh263VideoCapability.sqcifMPIh263VideoCapability.qcifMPIh263VideoCapability.cifMPIh263VideoCapability.maxBitRateh263VideoCapability.unrestrictedVectorh263VideoCapability.arithmeticCodingh263VideoCapability.advancedPredictionh263VideoCapability.pbFramesh263VideoCapability.temporalSpatialTradeOffCapabilityg7231.maxAl-sduAudioFramesg7231.silenceSuppressioncapabilities.terminalCapabilitySetOutOfBandDtmf1.h323-IDfacilitymessage.facility.userUser.h323-UserInformation.h323-uu-pdu.h4501SupplementaryServiceserviceApdu.rosApdus.1.returnResult.result.opcode.localserviceApdu.rosApdus.1.returnResult.result.result.callIdentitymessage.%s.callingPartyNumberoctet3.presentationIndicatornumberDigitsmessage.%s.userUser.h323-UserInformation.h323-uu-pdu.h323-message-body.%spresentationIndicatorpresentationAllowedpresentationRestrictedaddressNotAvailable*.h323-IDadditionalSourceAddressesmessage.%s.userUser.h323-UserInformation.h323-uu-pdu.h323-message-body.%s.%s*.presentationIndicator*.address.e164message.%s.connectedNumberTA:%d.%d.%d.%d:%d%d 0-15fmtpmessage.information.signal.signalValuemessage.%suserUser.h323-UserInformation.h323-uu-pdu.h323-message-body.presentationIndicatorsourceAddressalertingAddressconnectedAddressserviceApdu.rosApdus.1.invoke.opcode.localserviceApdu.rosApdus.1.invoke.argument.callIdentityDialtoneRingingOfferingOnNormalRejectRemoteM/S conflictRe-openQoS reservation failureDuplexoutgoingincomming============cmEvChannelStateChanged(channel=%p,side=%s, state=%s,stateMode=%s 723registrationRequestgatekeeperRequest*.supportsAltGK323_THRDregistrationInfo.terminalAlias.*allowedrestrictednotAvaliable888300000000009Failed to create H450 callencryptionData - not supportedhaChan %p has no h323 Connction h323Conn %p has no ConnectedPartyoutMedia of connectedParty %p is NULLoutMediaDescr of connectedParty %p is NULLbasicStringgeneralStringdtmfsystem.localIPAddressRAS.manualRASRAS.manualDiscovery.defaultGatekeeper.ipAddress.portRAS.manualDiscovery.defaultGatekeeper.ipAddress.ipRAS.manualDiscoveryH323 stack failed to initialize, err=%d H450 failed to initializeH323 stack constructed, version %s ZZ Z ZhZ ZhZ Z\ZPZpZ ZPZ Z ZlYXZZ ZZZxZ Z Z Z Z Z Z Z Z Z Z Z Z Z ZYYZ YZ Z YZ YZZZ ZXZ Z ZZ ZZhZ ZhZhZhZZZ ZZZZZ xZ hZ Z Z Z \Z Z(Z0ZZZZZZZxZZZZZZZZZZZZZZZTZZZZZ$ZZZ8ZZZ\ZZZZLZZZZ@ZZZZZZZZZ(Z(Z(Z(Z(Z(Z(Z(Z(Z)Z)Z) Z),Z)8Z)DZ)PZ)\Z)hZ)tZ)Z)Z)Z)Z)Z)Z)Z)Z)Z)Z)Z*Z*Z*Z*(Z*4Z*@Z*Z,Z*Z*Z*Z*Z*Z*Z*Z*Z+Z+ Z+Z+$Z+0Z+ @_RvVectorRvMdmDigitPositionInsert_RvVectorRvMdmDigitPositionErase_RvVectorRvMdmDigitStringInsert_RvVectorRvMdmDigitStringErase_RvVectorRvStringAndIntErase_RvVectorRvStringAndIntInsert_RvVectorRvMdmObservedEventErase_RvVectorRvMdmObservedEventInsert_RvVectorRvMdmSignalExErase_RvVectorRvMdmSignalExInsert_RvVectorRvMdmSignalExListErase_RvVectorRvMdmSignalExListInsert_RvVectorRvMdmEventErase_RvVectorRvMdmEventInsert_RvVectorRvMdmRequestedEventErase_RvVectorRvMdmRequestedEventInsert_RvVectorRvMdmStreamDescriptorErase_RvVectorRvMdmStreamDescriptorInsertmindurmaxdurcadfreqd0d1d2d3d4d7d5d8d6d9dadbdcdodgbtwtdtcrrsptonegenstdltdindnetfailqualertdurjitrtppltransplrtppltypetdmcautomaticandispdwaddbpatternrplrtaserrofflriexactfailWrongstrictTrueFalseinitUnsupported or unknown PackageMedia Gateway unequipped to generate requested SignalsMedia Gateway unequipped to detect requested EventPMFMMethkdkeyidkudiscdpgsdicldnrowsncolscckpkeylistlabelkeykfindlistkssdnskeysszancirvccgalalicalleridrejectrvMdmTermMgrRegisterUserSignal::mgr=%p, pkg=%s, signal=%srvMdmTermMgrRegisterUserSignal::IGNORED! NULL parameterrvMdmTermMgrSetUserPackage::class=%p, pkg=%srvMdmTermMgrSetUserPackage::IGNORED! NULL parameterrvMdmTermMgrSetUserPackage::class=%p, Package %s already exists./rvmdmobjects.cUnexpected initial hook stateGeneralcauseNRURFTFPIWUNFailurecauseSigIDTOEVSD[$[0[[ [[~[[[0[D[X_RvVectorRvMdmMediaStreamInfoErase_RvVectorRvMdmMediaStreamInfoInsert************* Media For Connection: %pMDM Connection Constructed (%p)MDM Connection Destructed (%p), Line:%d Term: %s - Failed to Disconnect Media between: %s and %s, Line:%d (%p)Term: %s - Media Disconnected between: %s and %s, Line:%d (%p)Term: %s - Failed to Destroy RTP Media for %s, Line: %d (%p)rvCCConnMdmModifyMedia( conn=%p)rvFalservTruervCCConnMdmModifyMedia -> %sTerm: %s - Line Media Created for %s, Line:%d (%p)Term: %s - Creating RTP Media for: %s, Line: %d (%p)Failed to Connect Rtp1: %s - No Stream Id, Line:%d (%p)Failed to Connect Rtp2: %s - No Stream Id, Line:%d (%p)Connected RTP Terms: %s AND %s, Line:%d (%p)Failed to disconnect Rtp1: %s - No Stream Id, Line:%d (%p)Failed to disconnect Rtp2: %s - No Stream Id, Line:%d (%p)Disconnected RTP Terms: %s AND %s, Line:%d (%p)(Mute) Failed to Disconnect Media between: %s and %s - No Stream Id, Line:%d (%p)(Mute) Failed to Connect Media between: %s and %s - No Stream Id, Line:%d (%p)Media Connected (Mute) between: %s and %s - No Stream Id, Line:%d (%p)(Unmute) Failed to Connect Media between: %s and %s - No Stream Id, Line:%d (%p)Media Connected (Unmute) between: %s and %s, Line:%d (%p)Connected...PrivateFrom:%s********** REMOVE TERMINATION ID: %s Type: %sat/hsat/htat/hf ****** Media Caps: ****** %s ******Stream Mode: LOOPBACK******* ******Stream Mode: SEND-RECEIVE******* ******Stream Mode: RECEIVE-ONLY******* ******Stream Mode: SEND-ONLY******* ******Stream Mode: NOT-SET******* ******Stream Mode: INACTIVE******* ******Stream Mode: (other)******* ******Local Media********* %s ******Remote Media********* %s at/IPP-->Stop Signals, term(%p),atTerm(%p),termMdm(%p)IndidirIPP-->Start Signal: RINGING,term(%p),ret(%s)IPP-->Stop Signal: RINGING,term(%p),ret(%s)muhsl%03dblinkfast_blinkslow_blinkLineIdsignal parameter contains NULL pointerrvCCTerminalMdmSendCallerIdmdmadaptor/rvccterminalmdm.cIPP-->SET DISPLAY: %sdialplan0khklkckbtDial Tone Timer Expired for Termination: %s (%p)terminalMdmModifyMedia(x=%p , sdpMsg=%p)terminalMdmModifyMediaSelect Termination is NULL:%s, Line:%d (%p)IPP-->Received Event: %srvIppMdmExtPreProcessEventCB: Connection %p ConnState=%s TermConnState=%s Event=%s Reason=%s rvIppMdmExtPostProcessEventCB: Connection %p ConnState=%s TermConnState=%s Event=%s Reason=%s rvIppMdmExtCreatedCB: Connection %p ConnState=%s TermConnState=%s rvIppMdmExtDestructedCB: Connection %p ConnState=%s TermConnState=%s rvIppMdmExtMapUserEventCB: pkg=%s, id=%s, key=%s rvIppMdmExtMapUserEventCB: pkg=%s, id=%s, key=%s, Event=%s rvIppMdmExtDisplayCB: conn=%p, term=%p, event=%s, cause=%s mdmtermmgr/rvmdmmediastream.cSigId/var/tmp/ipp_msg_sock%de%de%de%d%c\\\\ \\\\\,\P\t\\\\\\\]2]2]2]2]2]3]3]3]3]3 ]3(]30]38]3@]3T]3\]3h]4]4]4]4]4]g]g]h4]h ]h ]hH]hh]h|]h]x]]h]k]k8]i]iP]i]i]i]j0]jh]j]j]k`]kt]k]k]k]k]k]l]l$]]]]l]l]m]m,]l8]lL]l`]l]lt]n]n]o]l]l]~]l]h]m4]mH]n]o(]oH]oh]o]p]pL]pl]p]p]p]q]x]]]]qL]q]q]q]r ]r4]r\]r]r]]r]r]s]s8]s]sl]]s]t@]tT]uL]u]u]u]v ]v4]v\]v]v]v]v]w$]w\]]w]w]w]w]]]]]]]{]|]{]]]]|0]|`]]|]|]x]y8]y ]yP]yh]y]y]y]y]z]z]z@]zX]zp]z]z]z]{]{<]z]z]{`]{x]{]{]g]~]]]]]]]]]~]]]}]~]~(]~@]~X]~p]~]~]~],]D]\]t]o]o]o]o]p]l]|]]]@]P]]]]<]8]8]]]]]L]]]`]]]t]X]]]]]L]x]]]8]8]8]]] ]$],]<]L]l]\]]]@]|]]]]],]@]]|]8]8]]D]]]]8]`]]l]8]8]8]]]]\]] ]H]p]8]8]]]]]]8]L]d]8]]8]]8]]]8]]P]]]]L]]8]8]8]8]]8]8]8]8]8]8]8]]8]]] ]\]]](]p]T]]]]]4]P]|]]]]],]H]d]]]H]x]]]]]]]T] ]$]8]8]8]8]8]8]8] ]8]8]|]]]]],]D]x]]]]]]]]] ]]L]|]|]|]|]T]|]|]|]|]\]d]l]t]]$^ ^^^^^^^^,^D^^dVOIP_SIP_TCPSIP over TCPVOIP_SIP_UDPSIP over UDPVOIP_SIPVoip to POTS application over SIP VOIP_MULTI_RASH323 Multicast RAS trafficVOIP_RASH323 RAS trafficVOIP_SIGH323 signaling trafficVOIP_H323Voip to POTS application over H323 ^^(^D^d^^^ ^^^^,^H^^^^^^^^^p^^d^$^^^^^^$^^^__ x__ __ _ _ _ (_ _ 0_ _ @_ _ T_ _ p_X_ 8_ __ _0__ _0__ _0_ T__ p____\_____ \__,_<_0_@_______\_8_#_T__#h_ p_!_!_)_.0_.T_0_0_0_%_%_%_%_%_%_%_%_%_%_%_'_1_1_1_1_1_1_1_0_00_._._1_._1_/_/_0_0_1_1_0 Configure the H323 general parametersh235Configure the h235 security parametersH323 RAS commandssigH323 signalling commandsConfigure the signalling parameterstunnelingEnable or disable H245 in H225 tunnelingoverlapsendOverlap sending timer value (sec)overlaprecvOverlap receiving timer value (sec)Configure the ras parametersprimgkaddrPrimary H323 gatekeeper addressprimgkportPrimary H323 gatekeeper portprimgkidPrimary H323 gatekeeper idsecgkaddrSecondary H323 gatekeeper addresssecgkportSecondary H323 gatekeeper portsecgkidSecondary H323 gatekeeper idaltgksupportEnable or disable the alternate gatekeeper supporttimetoliveRegistration time-to-live (sec) (0=unsupported)gkdiscoveryManual or automatic gatekeeper discoverymulticastipPrimary discovery H323 gatekeeper addressmulticastportPrimary discovery H323 gatekeeper portsecondmulticastipSecondary discovery H323 gatekeeper addresssecondmulticastportSecondary discovery H323 gatekeeper portmanualEnable or disable the H235 securitySet the security modesenderidSet the sender Id for h235generalidSet the general Id for h235PrimGK-PWSet the password for the primary GKSecGK-PWSet the password for the secondary GKcryptoTokenclearTokenRRQfaststartEnable or disable the H323 faststart modeLocal address : %s Fast start : %s Primary gatekeeper IP address : %s Primary gatekeeper IP port : %d Secondary gatekeeper IP address : %s Secondary gatekeeper IP port : %d Alternate gatekeeper support : %s Time to live : %d Gatekeeper discovery mode : %s Prim Gatekeeper discovery IP : %s Prim Gatekeeper discovery port : %d Sec Gatekeeper discovery IP : %s Sec Gatekeeper discovery port : %d H245 tunneling : %s Overlap sending timer : %d Overlap receiving timer : %d 00:00:00:00:00:00h323 configh323 h235h323 sig configh323 ras configipploglevel Current IP phone toolkit log level: %d dmipploglevel [lvl] Set the IP Phone log level. 4 levels are defined: Level 0: no traces Level 1: errors and exceptional conditions Level 2: level 1 + warnings Level 3: level 2 + info traces Level 4: level 3 + debug and lock-unlock traces lowmediumhighmwiclipclir3ptyforcedFXOcfucfnrcfbscallreturnccbsclironcallwaitingoncalldetect_timeoutThe time-out in seconds used to detect FAX(0 is no time-out)early-detect-faxmodemDetect fax or modem earlyThe type of fax transportudptl_redunThe number of secondary IFP packetsautofxoAutomatically make FXO calls when not registereddigitrelaySet the digit relay modeclick2dial_portsSet the click to dial portrtp_portrangeThe RTP port rangesign_internalSignalling for local calls is kept local or externalstatic_intfUse a static (configured) interface to look for the IP address or notThe name of a IP interface to be used for VOIP traffic.secondintfThe name of a backup IP interface to be used for VOIP traffic.endofnumberThe end of number chanracter for dialled number starting with a ciphercountrycodeLocal countrycodedelayeddisconnectEnable or disable the delayed disconnect featuredelayeddisconnecttimerDelayed disconnect timer (seconds)ringmutedurationEarly media mute duration (in ms)nocallsetupmsgno FXS display when CLIP: NEVER | NONUMBERneverunav-numbinternalautoinbandrfc2833signallingThe codec typeThe packet timeptime_g723vadEnable or disable Voice Activity DetectionpriorityThe codec capability priorityEnable or disable this capabilityg711ug711ag723.1g726_16g726_24g726_32g726_403020payloadtypeThe payload typeThe supplementary service typeThe supplementary service actionaction_cfaction_actservicecodeThe service activation codeactivatedeactivatemwi_phoneThe way the phone reacts on a message waiting indicationmwi_networkThe way the network protocol implements the message waiting indication serviceprefix_servcodeThe way the service codes are assignedservcode_cmdThe way the service code command is usedcfu_destThe destination for the CFU servicecfnr_timerThe CFNR timer valuecfnr_destThe destination for the CFNR servicecfbs_destThe destination for the CFBS servicehfhf_featureEnable/disable hfhf_featurenonstandardsollicitedunsollicitedimmediatedeferredbothinterdigitThe interdigit timer (in ms)interdigitOpenThe closed number interdigit timer (in ms)incfxodestSelect destination for incoming FXO callsfxodisconnectThe FXO disconnect timer (in ms)pinDECT pin codesubstimeoutDECT subscribtion timeout in seconds (0 is unlimited)clearsubsClear DECT subscriptionsThe type of traffic that needs qosqosfieldThe QOS field to be useddscpThe DSCP valueprecedenceThe precedence valuesign&controlrealtimee164numberThe telephone numbercountryLoad this country's specific settings into the DSPprefixThe prefix, identifies this entrynewprefixdefaultportThe default outgoing portfallbackportThe fallback outgoing portThe priority of the entryfallbackThe fallback mechanism status of this entryminimumdigitsThe minimum number of digitsmaximumdigitsThe maximum number of digitsposofmodifyStartposition at which a number of digits must be removedremnumdigitsThe number of digits that need to be removed from the complete numberinsertString which must be inserted at PosOfModify after removing RemNumDigitsrescanRescanning of the number needed or notThis entry is used for data calls or notAction parameterROUTE_excl_eonROUTE_incl_eonNALowHighThe e164 telephone number or h323_idType of profileIdvoiceportThe analog line numberabbrAn abbreviated number that will be mapped to the e164 telephone number or h323_iddistinctiveRingh323_idmax#portsperprofileThe maximum number of ports that can be used with a common profileonestartentryEntry to start with in the registration proceduremaxentriesMaximum nbr of used entries in a DNS responsefirstrandomringdurationRing duration (in ms)displaytextText displayed on screenStatus of ring testshow VOIP service statesConfigure the general parameterscodecCODEC capability configuration commandsConfigure general voice settingsConfigure the dialplanfaxConfigure fax settingsfxsportFXS port related commandsfxoportFXO port related commandsdectportDECT port related commandsh323H323 related configuration commandsPhonebook commandsphoneringtestConfigure phone ring test settingsProfile configuration commandsqosVoIP QOS related commandsSupplementary service configuration commandsGeneral statistics commandscacCall admission controlDebug commandsDNS list configurationConfigure DNSDebug prompt commandsDebug tracing configurationstacktraceEnable stack tracesvoiptraceEnable voip tracesstacklevelStack level tracesThe debug command (or help)Configure call admission controlShow voice statisticsReset voice statisticsThe voice port used to get/reset the statisticsType of statistics to be listed/resetdetailedgenericGeneral supplementary service configurationShow the supplementary service configurationprovisionProvision a supplementary servicewithdrawWithdraw a supplementary serviceActivate a supplementary serviceDeactivate a supplementary serviceassignAssign a servicecode to a supplementary service in standard modeassign_pxscAssign a servicecode to a supplementary service in non_standard modeFlush all supplementary servicesShow the QOS configurationConfigure the QOS parametersAdd profileDelete profileModify profileShow all profilesFlush all profilesThe e164 telephone number or h323 idConfigure the phone ring test parametersruntestStart ring testAdd phone number to the phonebookDelete phone number from the phonebookShow all entries in the phonebookConfigure the DECT port parametersConfigure the FXO port parametersConfigure the FXS port parametersConfigure the fax parametersAdd an entry in the dialplanDelete an entry in the dialplanModify an entry in the dialplanDisplay an entry or the complete dailplanDelete all user-entered dialplan entriesConfigure countryList available countriesShow the CODEC capability configurationConfigure a CODEC capabilitySet dynamic CODEC configuration parametersShow the dynamic CODEC capability configurationConfigure a dynamic CODEC capabilityActivate_Call_holdDeactivate_Call_holdActivate_Call_waitingDeactivate_Call_waitingActivate_Call_waiting_on_callDeactivate_Call_waiting_on_callActivate_Call_transferDeactivate_Call_transferActivate_3PTYDeactivate_3PTYActivate_CLIPDeactivate_CLIPActivate_CLIRDeactivate_CLIRActivate_CLIR_on_call_basisDeactivate_CLIR_on_call_basisDeactivate_CCBSInvoke_Call_returnActivate_MWIDeactivate_MWIActivate_CFUDeactivate_CFURegister_CFUActivate_CFNRDeactivate_CFNRRegister_CFNRActivate_CFBSDeactivate_CFBSRegister_CFBSHuntgroupROUTE_internalidlerunningaborted on incoming callaborted on outgoing call0...9Invalid standard service code. 0...9 * #Invalid non standard service code. 0...9 - * #Invalid prefix. Invalid value. The entry could not be added: dialplan table is full! The entry could not be added: it exists already! The entry could not be added: invalid field value! The entry could not be deleted: invalid prefix given! The entry could not be deleted: no permission! Prefix DefPort FallbPort Prior Fallback Min.Dig Max.Dig PosMod Rem.Dig ------------------------------------------------------------------------------- Insert Rescan Data Action YesNo%7s %7s %9s %5s %8s %7d %7d %6d %7d %30s %6s %4s %31s COMMON Service Status ActCode DeactCode RegCode Provisioned -------------------------------------------------------------------------------- activateddeactivated yes no%13s %s %5s %5s %5s %s Required parameter service type missing The CFU service could not be activated because no CFU destination is configured! The CFNR service could not be activated because no CFNR destination is configured! The CFBS service could not be activated because no CFBS destination is configured! This supplementary service is not provisioned! Service code already in use for another service Phone MWI type : %s Network MWI type : %s Prefix service code : %s Service code command : %s CFU destination : %s CFNR timer : %d CFNR destination : %s CFBS destination : %s HFHF feature : %s Codec Type Packet Delay Voice Act. Detection Priority Status %10s %11s %20s %8d %8s Codec information not found in configuration Codec Type Payload Type %s %d Standard inter digit timer (closed) : %d Open number interdigit timer : %d Incoming fxo destination : %s FXO disconnect timer : %d pin : %s substimeout : %d Pin can only contain digits Pin must be exactly 4 digits long Ring duration: %d Display text : %s Status : %s detect_timeout: %d early-detect-faxmodem: %s transport : %s udptl_redun : %d Traffic Type QOS field Value %12s %12s %15s Required parameter QOS traffic type missing Required parameter QOS field missing Generic statistics for %s: Total nbr of incoming calls : %d Successful nbr of incoming calls : %d Missed nbr of incoming calls : %d Total nbr of outgoing calls : %d Successful nbr of outgoing calls : %d Failed nbr of outgoing calls : %d Detailed statistics for %s: Unsuccessful outgoingOutgoing %s call from %s at %s to %s via %s registered at %s (call duration %d seconds) Mean end-to-end delay : %d ms Worst end-to-end delay : %d ms Remote packets lost (cumulative) : %d Remote packets lost (ratio) : %d.%d packets/s Remote packets lost (fraction) : %d.%d %% Remote mean jitter : %d ms Remote worst jitter : %d msMissed incoming %s call from %s via %s to %s at %s registered at %s Generic statistics: Detailed statistics: via %s call from %s %s %s to %s %s %s registered at %s Mean end-to-end delay : %d Worst end-to-end delay : %d Remote packets lost (ratio) : %d Remote packets lost (fraction) : %d Remote mean jitter : %d Remote worst jitter : %d%s statistics for %s successfully reset VOIP_H323-admin. state : %s VOIP_H323-oper. state : %s VOIP_H323-IP address : %s The entry could not be added: all entries for this port are in use. This Id already exists! The entry could not be deleted: invalid id given! This uri already exists! Port Id type PrivNumb DistinctRing RegStatus Msg Waiting ---------------------------------------------------------------------------------------------------------------------- Not Registered%-6s %-25s %-9s %-17s %-15s %-15s %-11s max#portsperprofile: %s The phonebook is full! This entry already exists! E164 number %s cannot be deleted. The number is in use by %s First remove the number from %s Entry %s cannot be deleted. Invalid entry given. Phonebook (%2d entries) ---------------------- Country : %s Available countries: Stack tracing: %s Voip tracing: %s autofxo : %s digitrelay : %s click2dial_port : %s rtp_portrange : %d-%d sign_internal : %s static_interface: %s interface : %s sec interface : %s endofnumber : %s endofnumber : %c country code : %d delayed disc : %s delayed disc tmr: %d ringmuteduration: %d nocallsetupmsg : %s Port range expected DNS start entry : %s Nbr of DNS entries : %d ss [signal] [line_id] [1=on 0=off] Send signal (to DSP) Signals: |0 - 9, *=10, #=11, A=12 B=13, C=14, D=15 |BusyTone=16, DialTone=17, Ringback=18, Ringing=19 |Warning=20, CallWait=21, Congestion=22 |ServConf=23, ServRej=24, Stutterdial=25 |DefMW=26, VMWI=27, MultiRing=28 |Relay=29 (1=connect, 0=disconnect) |fxo_offhook=30, fxo_onhook=31, ring test=32 trace [0|1] Set the VOIP tracing on or off se [event] [line_id] Send event (to app) Events: |0 - 9, *=10, #=11, A=12, B=13, C=14, D=15 |OffHook=16, OnHook=17, FlashHook=18 |Fax=19, Modem=20 sn [number] [line_id] Send complete number to app on [line] Go off-hook on of [line] Go off-hook on hf [line] Hookflash on dn [number] [line] Dial on can be a combination of: - digits 0 to 9 - * - # Sending signal %d to line %d 01/02/03/04,9876543210,abcdefghijklmnopqrstuvwxyz,O,"ring test" Signal %d is not valid Sending event %d to line %d Event %d is not valid (extended) Voip tracing is %s%s extended Enable voip %stracing Disable voip tracing Phone line %s notInterdigit timer %s running %10d %20s %15s %15s Dial State: %s RTP term Conn State Line State Call dir Syntax: se [event] [line_id] Syntax: hf Syntax: of Syntax: on dn Syntax: dn Invalid command... voicevoipcodec configcodec dynamic configservices configservices provisionservices withdrawservices activateservices deactivateservices assignservices assign_pxscfxsport configfxoport configdectport configqos configphonebook addcountry configdialplan adddialplan modifyprofile addcac configdns configfax configphoneringtest confignotsentinband_autoinband_renegt38VoIP[DIALMGR]: dialMgrStartTone - SEND_SIGNAL failed (%d) common numberVoice.Profilevst1vst2vcfgVCFT*96#96#94#43*94*43#98*43*#43**98*30#30#31*31*31*#95#31**95*01*#21*21**21*#67**61*#61*61**67*#37*67*37*69CHANNELSLIINFONAMECHANLIETIMERSELITUNNCTRLTLSIPP_UTILIPP_USERAPPRPOOLIPP_CALLCONIPP_MDMCONTIPP_SIPCONTIPP_MDMIPP_H323CONPhone ring test,O,"Starting phone ring test (%d, %s) [VOIPAPP]: startInterfaceTmr - ERROR : stopping interface timer [VOIPAPP]: startInterfaceTmr - ERROR : modifying timer params [VOIPAPP]: startInterfaceTmr - ERROR : starting interface timer [VOIPAPP]: toggleInterfaceNbr - Trying to toggle an unknown interface [VOIPAPP]: voipGetIntfInfo - Illegal interface number selected [VOIPAPP]: voipGetIntfInfo - Unable to find modem IP address!! Error scheduling TELA thread as Real Time threadvoipapp.cError opening MBus listening socketError opening communication socketvoipapp_mgmtError binding communication socketError opening netlink socketITFTDHCTrecvfrom communication socket failedCould not stop DSP driverCould not start DSP driver[VOIPAPP]: MBus request parsing failed (%s)TELAPPCommunication socket was not createdFailed to create a communication socketvoipappcmd_%pFailed to bind a communication socket voipapp: VDSP_EV_RINGTESTCOMPLETED status = %d Voice.PhoneRingTest voipapp: VDSP_EV_RINGTESTABORTED_IN AbortedIncCall voipapp: VDSP_EV_RINGTESTABORTED_OUT AbortedOutgCallvoipRegSock: no free socket%23[PHONELNK]: phoneLinkCreateDcnx - CREATE_DCNX failed (%d) [PHONELNK]: phoneLinkModifyDcnx - MODIFY_DCNX failed (%d) [PHONELNK]: phoneLinkDeleteDcnx - DELETE_DCNX failed (%d) IDT%dHFT%dFXO%dDBT%dRBT%d[PHONELINK]: dialMgrStartTone - SEND_SIGNAL failed (%d) %s@%s[PHONELNK]: phoneLinkStopFxoDisconnectTmr - ERROR : stopping fxoDisconnect-timer for %s [PHONELNK]: phoneLinkStopInterDigitTmr - ERROR : stopping interdigit-timer for %s [PHONELNK]: phoneLinkStopHookFlashTmr - ERROR : stopping hookFlash-timer for %s [PHONELNK]: phoneLinkStartInterDigitTmr - ERROR : stopping interdigit-timer for %s [PHONELNK]: phoneLinkStartInterDigitTmr - ERROR : starting interdigit-timer for %s [PHONELNK]: phoneLinkStartHookFlashTmr - ERROR : stopping hookflash-timer for %s [PHONELNK]: phoneLinkHookFlashTmr - ERROR : starting hookflash-timer for %s [PHONELNK]: phoneLinkStartFxoDisconnectTmr - ERROR : stopping fxoDisconnect-timer for %s [PHONELNK]: phoneLinkStartFxoDisconnectTmr - ERROR : starting fxoDisconnect-timer for %s [PHONELINK]: dialMgrStopTone - SEND_SIGNAL failed (%d) DTMF via RFC2833In-band DTMFDTMF via signallingG711 U-lawG.726 32 kbpsG.722 64 kbps widebandG.723 5.3 kbpsG.723 6.3 kbpsG.711 A-lawG.729AG.726 16 kbpsG.726 24 kbpsG.726 40 kbps[RTPLNK]: selectDigitRelay: Unexpected condition [RTPLINK] rtpLinkProcessLocalSdpMsg: unsupported media type %d [RTPLINK] rtpLinkProcessLocalSdpMsg: unsupported media protocol %d [RTPLINK] rtpLinkProcessRemoteSdpMsg: unsupported media type %d [RTPLINK] rtpLinkProcessRemoteSdpMsg: unsupported media protocol %d rtpLinkServEnable port %d [RTPLNK]: rtpLinkServEnable - term Id = %s service set ports failed (%d) [RTPLNK]: rtpLinkServEnable - term Id = %s serivce set state failed (%d) rtpLinkServEnable port [RTPLNK]: rtpLinkServDisable - service get state failed (%d) [RTPLNK]: rtpLinkServDisable - service set state failed (%d) [RTPLNK]: rtpLinkServDisable - service set ports failed (%d) [RTPLNK]: rtpLinkDestroyRtpTerm - MRQ_CLOSECHANNEL failed (%d) rtp/%dRTP_%dRTP traffic channel %irtp service registration failedrtplink.cRTCP_%dRTCP traffic channel %irtcp service registration failedUDPTL_%dUDPTL traffic channel %iudptl service registration failed[RTPLNK]: rtpLinkBindChannel - MRQ_BINDCHANNEL failed (%08X) [RTPLNK]: rtpLinkCreateRtpTerm - MRQ_OPENCHANNEL failed (%d) [RTPLNK]: rtpLinkCreateRtpTerm - MRQ_RESERVEPORTS failed (%d) [RTPLNK]: rtpLinkModifyChannel - MRQ_SETREMOTEDESC failed (%08X) [RTPLNK]: rtpLinkSetPortRange - MRQ_SETPORTRANGE failed (%08X) [RTPLNK]: rtpLinkBuildMediaDescr: CODEC WITH SAME PT AS TELEPHONE-EVENT PCMUPCMAG726-16G726-24G726-32G726-40WFSDREGT_VOICE_CAPABLEConnect: rtpLink->pPhoneTerm != phoneTermvoipgateway.cIn ConnectCB, Do nothing for SENDRECV if ourgoing call of h323. RAS.maxMulticastTTLRAS.manualRegistrationR1.0RAS.registrationInfo.terminalAliasRAS.registrationInfo.timeToLiveRAS.registrationInfo.endpointVendorRAS.registrationInfo.endpointVendor.vendorRAS.registrationInfo.endpointVendor.vendor.t35CountryCodeRAS.registrationInfo.endpointVendor.vendor.t35ExtensionRAS.registrationInfo.endpointVendor.vendor.manufacturerCodeRAS.registrationInfo.endpointVendor.productIdRAS.registrationInfo.endpointVendor.versionIdRAS.preGrantedArqUseRAS.preGrantedArqUse.directRAS.registrationInfo.terminalAlias.%dRAS.registrationInfo.terminalAlias.%d.h323-IDQ931.useAnnexEQ931.manualAcceptQ931.manualCallProceedingQ931.h245TunnelingQ931.earlyH245Q931.t302Q931.t304[VOIPGATEWAY]: E R R O R setting the H323 stack configuration %s.rejectReason??VOIP: Send RAS message %s (rejectReason = %s)VOIP: Recv RAS message %sregistrationConfirmregistrationConfirm.endpointIdentifierVOIP: Send RAS message %sunregistrationConfirmreleaseCompletemessage.releaseComplete.cause.octet4.causeValue(cause = %d)message.releaseComplete.userUser.h323-UserInformation.h323-uu-pdu.h323-message-body.releaseComplete.reason(reason = %s)VOIP: Recv message %s %s %smessage.%s.causeVOIP: Recv message %s (rejectReason = %s)VOIP: Recv message %sVOIP: Send message %s %s %sVOIP: Send message %s (rejectReason = %s)VOIP: Send message %sH245_%dH245 control channel %ivoip h245 service registration failedvoip group registration failedsignalling service registration failedras service registration failedMulti ras service registration failedvoip h323voip SIPvoipservcfg.c[VOIPSERVCFG]: voipServiceEnableDynamic - H245 service get state failed (%d) [VOIPSERVCFG]: voipServiceEnableDynamic - H245 service set ports failed (%d) [VOIPSERVCFG]: voipServiceEnableDynamic - H245 serivce set state failed (%d) [VOIPSERVCFG]: voipServiceDisableDynamic - H245 service set state failed (%d) [VOIPSERVCFG]: voipServiceDisableDynamic - H245 service set ports failed (%d) [VOIPAPP]: voipSecurityCallback - init failed [VOIPAPP]: voipSecurityCallback - update failed [VOIPAPP]: voipSecurityCallback - final failed [VOIPAPP]: voipSecurityCallback - hmac failed NO_CALLLINE_IDLELINE_INITIATEDLINE_HOLDLINE_CWLINE_ACTIVEVoiceCallLogOverview[CALLMGR]: callMgrCreateRtcpStats - term Id = %s MRQ_RTCPSTATS failed (%d) anonymousAnonymous"anonymous""Anonymous"l00%d[CALLMGR]: callMgrHandleSignal - SEND_SIGNAL failed (%d) [CALLMGR]: callMgrCheckDspBudget - GET_CAPABILITIES failed (%d) %02d/%02d/%02d/%02d%s,%s, '"%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xIncoming call, FXO call active but target is common DECT!! DIAL_IDLE DIAL_OFF_HOOK DIAL_ON_CLICK DIAL_COLLECT DIAL_STUTTER DIAL_END DIAL_CALL DIAL_CALL_SOC DIAL_RELEASE DIAL_ACTIVE DIAL_DELAYED_BYE DIAL_ACTIVE_SOC DIAL_ACTIVE_COLLECT DIAL_ACTIVE_CALL DIAL_ACTIVE_SEC_SOC DIAL_ACTIVE_RELEASE DIAL_FXO_SEIZE DIAL_FXO_ACTIVE l002l001[PHONELNK]: phoneLinkStartInterDigitTmr - ERROR : starting delayed bye timer for %s [PHONELNK]: dialMgrStopDelayedByeTimer - ERROR : stopping delayed bye timer for %s MACHINE_EARLYMODEMFAX[DIALMGR]: dialMgrHandleEvent - Received %s in dial state %s (line %d), hfhfAction = %d RELT[FXO]: FXOProcessFXSOnhook - Invalid state [FXO]: FXO busy, waiting %d ms [FXO]: FXOProcessFXSOffhook - Invalid state /usr/local/messages//dl/[VOIPMSG]: voipMsgStartHold: could not start hold message [VOIPMSG]: voipMsgStartWaiting: could not start message LOCIvoipMiniHandleEvent: line %d not supported [CAC]: Unexisting term %08X [CAC]: Registerd number %s on line %d 14400T38MaxBitRateT38FaxVersionT38FaxFillBitRemovalT38FaxTranscodingMMRT38FaxTranscodingJBIGT38FaxRateManagementtransferredTCFT38FaxMaxBuffer2048T38FaxMaxDatagram176T38FaxUdpECt38UDPRedundancyudptl[FAX] faxAnswer - unsupported media Portsvoice_ports_typesSenderIDGeneralIDPrimGKPasswordSecGKPasswordh323_h235_typeCryptoTokenClearTokenRRQPrimGKAddressPrimGKPortPrimGKIDSecGKAddressSecGKPortSecGKIDAltGKSupportGatekeeperDiscoveryh323_gkdiscovery_brackets_typesSigTunnelingOverlapSendOverlapRecvH323FastStartActivationCodeDeActivationCodeRegCodeProvisionedservices_service_status_typesactivatedMWIPhoneMWINetworkPrefixServCodeServCodeCommandCFUDestinationCFNRDestinationCFBSDestinationCFNRTimerHFHFservices_servcode_command_typesservices_prefix_servcode_typesservices_mwinetwork_typesservices_mwiphone_typesAllTotalInCallsSuccessInCallsMissedInCallsTotalOutCallsSuccessOutCallsFailedOutCallsFXS2FXS1PhonebookE146Number%sInvalid item for phone book !%s%sThe phonebook is full! %s%sThis entry already exists! %s%senum types registration failed (%d). %s[Voice_MBUS]%s'%s' registration failed (%d). %s%s'%s' registration failed (%d).%sNumberOfOngoingCallsCallLogCallIDCallerCalledDirectionStatusTimestampMediaNumbRxPacketsNumbRxBytesNumbTxPacketsNumbTxBytesNumbLostPacketsAvgJitterMaxJitterMediaDurationCodecVoice.CodecVoice.PortsFaxVideoDataOtherInitializingInProgressAbortedbyCallerAbortedbyCalledFinishedMarkingDSCPPrecedenceVoiceMarkingVoiceQosTypeRealtimeProfileIDTypeVoicePortAbbrNumberDistintiveRingTimestampProfileCallStateCallingInCallHoldDisconnectingProfileStatusRegisteringUnregisteringVoiceSip/H323PortH323IDDialPlanPrefixDefaultPortFallBackPortFallbackPriorityMinDigitsMaxDigitsPosOfModifyInsertStringRescanVoiceActionVoicePriorityVoiceFallBackPortVoiceDefaultPortCACMaxPortsPerProfileCountriesSelectedCountryVoice.Countries.CountryDynamicCodecPayloadTypePhoneRingTestRingDurationDisplayTextRunTestVoiceRingTestStatusRunningPTimeVADVoicePTimeInterDigitTimerIncomingFXODestDetectTimeoutEarlyDetectFaxModemUDPTLRedunVoiceFaxTransportStartDriverAutoFXODigitRelayClick2DialPortsRTPPortRTPPortRangeEndSecIPInterfaceIPInterfaceStaticEONumberCharCountryCodeRegStatusIPaddressNoCallSetupMsgnocallsetupmsg_typesVoiceRegStatusunregisteredregisteredVoiceEONumberCharVoiceClick2DialPortsVoiceDigitRelayVoiceSignalingSIPMGCPVoiceDynamicCodecType%sinput pcmd is NULL%sVOIP_H323 The entry could not be added: all entries for this port are in use. This uri already exists! %s Failed to send one add/del event on '%s' to mbusd %s%s Success to send one add/del event on '%s' to mbusd %s%s Succeed to send one event on 'Voice.Profile.%d.Status' to mbusd %s%s Failed to send the event on 'Voice.Profile.%d.Status' to mbusd %s%s Succeed to send one event on 'Voice.RegStatus' to mbusd: %s -> %s %s%s Failed to send one event on 'Voice.RegStatus' to mbusd: %s -> %s %s%sSend update event to Voice.Profile.%d.CallState = %s%s%sError sending update event to Voice.Profile.%d.CallState%sVoice.CallLog%sSending update event to Voice.CallLog.%d.Status = %s%s%sFailed sending update event to Voice.CallLog.%d.Status%sVOICE_MBUS%senum types registration failed (%d) %s%s%s registration failed (%d).%s%s%s registration failed ( %d ).%s%sSuccessfully registered '%s' objecttype!%s[VOIPCTX] VOIPCTX%svoipMbusInit: %s%s%svoipMbusDestroy: %s%s%svoipMbusSetValue get lock failed, reason: %s%s%svoipMbusSetValue: %s%s%svoipMbusGetValue: %s%s`````8`Lsntp_client.cnot usedcontacting ...try contacting again ...unable to contactsynchronization error!synchronized_SNTPPOLL_PRE_SYNC SNTP reset timeserver state as disable sntpcsntpcdns_sntp[SNTP] E - MBus request parsing failed (%s)Reply rcvd from wrong server, IP address = %s %s %s %sSNTPServer not synchronised: Invalid Reply rcvd, leap_indicator =%d Invalid response from server: Invalid Reply rcvd, mode=%d Invalid Reply rcvd, version = %d Invalid Reply rcvd, stratum==%d Invalid Reply rcvd: invalid orig Timestamp sec=%lu fraction=%lu Invalid Reply rcvd, invalid xmit time sec=%lu fraction=%lu Invalid Reply rcvd, roundtrip calculation failed, xmit time sec=%lu fraction=%lu, rec time sec=%lu fraction=%lu Roundtrip too big,discard pckt,roundtrip=%u Roundtrip exceeds limits> new time setting:%s %s %s %s %sSystemtime update: time settingSynchronised to server:%s %s (%s)Synchronised again to server%-15s %-7s %-20s %-30s IP Address%-15s %-7d %-20s %-30s _SNTPPOLL_POST_SYNCsntpc: error during rebind of SNTP socketNo Server(s) configured, check configurationNo Server(s) configured, check configuration Unable to contact server:SNTP No DNS lookup supported! SNTP Server list full Simple Network Time Protocolsuccess!SNTP: SERVMGMT initialized: %s sntp src ip semaphore creationNTPCAdd NTP serverList the NTP serversDelete NTP server from listFlush NTP server list and SNTP client configurationModify/Display configurationEnable/Disable SNTP clientpollpolling interval (1 min, ... ,10080min(=7days))pollpresyncpolling interval before first sync (1 min, ... ,60min)IP address of NTP server to be removed from listDNS name of NTP server to be removed from listIP address of NTP server to be added to listDNS name of NTP server to be added to list. If both the IP address and the DNS name are provided, the IP address is ignored.SNTP version of server (1,2,3 or 4)You need to specify an address or a name of the NTP server! Failed to add server : Named SNTP Servers not supported! Wrong family List full You need to specify either an address or a name of the NTP server! Failed to delete server : Server not in list SNTP configuration: state = %s poll interval = %d minute(s) poll interval (before first sync) = %s minute(s) Unknown dhcp client management packet dhclsntp_mgmt.csntpclientsntpclcmd_%xNTPServerSNTP_ATOMIC_statusPollPresyncNTP.Server.%s%ssntp event subcription to 'PPP.Intf.Status' failed!%s[SNTP_MBUS] ATOMIC_SNTP_PLUGIN%sStatus enum type registration failed%sa 4a Da \a ha ha ha a a a a a a a (aPa\aшaѰabbbbbbb bLmbusd_event_fire_params_1evmbusd_event_fire_params_1subb2,b:b6b:b6b:b:b:b8ccmd [%sid=%d, depth=%d, cmdlen=%d], [%s:%s, ccmd=%s]%s%s***********%s<-ccmd=%s %dms [%sid=%d, depth=%d, replylen=%d], [%s:%s, ccmd=%s] (%d,<-pcmd_sum=%s %dms,%d,ccb(%d)=%d,%d)%s%s - [#obj = %d].%s.[#pt = %d]invoke ccmdprocid=%d, mbusd_match*.%s-%d%scouldn't allocate s_keystr_new!%s%sInvalid subscription flag on GET request (%s)%sar_readar_writear_archg%sFailed to create group %s%s%sFailed to find group %s%s%sFailed to apply accessright on paramtype: %s.%s (%s)%s%sFailed to apply accessright on rootobj: error = %lu%s%sFailed to apply accessright on objtype: %s (%s)%s%sFailed to apply accessright on param: %s.%s (%s)%s%sFailed to apply accessright on object: %s (%s)%s@@-012345678901234567890123456789abcdefABCDEF%sFailed to remove cmddata item from object->childlist (%s)%s%sFailed to add cmddata item to tmplist (%s)%s%sPlugin command 'ADDOBJECT' failed - object not added in plugin (%s)%s%sPlugin didn't return a cmddata with its keystring%s%sPlugin didn't return a keystring%s%sFailed to add cmddata item to object->childlist (%s)%s%sFailed to copy 'addobject' cmddata to the object%s%sError detected for '%s.%s'%s%sRollback %d items for client '%s'%s%sFailed handle setvalue and setattribute request in one client cmd: not supported%s%sFailed to apply accessright on objtype parameter: %s.%s (%s)%sany - id=%lu, ctx=%lu, subscr='%s: %s.%s'%sError: Failed to handle the subscription (%s)%s%sError: request_item without cmddata detected%smbusd_subscriptionparam_cachedparam_eventableobjtype_cachedobjtype_writableobject_cleanobject_dynamic%sWriteunlock failed for ctx=%lu:%lu '%s' (lock owned by ctx=%lu:%lu '%s')%s%sCommit failed: '%s.%s' (%s)%s%sunbalanced ccmdctxstack pop: expected ctx=%lu:%lu '%s', but found ctx=%lu:%lu '%s'%s%sWritelock idle timeout: owner change ctx=%lu:%lu '%s' --> ctx=%lu:%lu '%s'%sinvoke ccmd2%sWritelock timeout (%d secs) for ctx=%lu:%lu '%s' (owner: ctx=%lu:%lu '%s')%s%sFailed to add delayed item '%s.%s' for ctx=%lu:%lu '%s'%s%sClient callback invocation error from ctx=%lu:%lu %s: %s!%sMBUS_WL%sLoading instances of type '%s' from parent '%s%s%s'%s%smbusd_object_loadkeys failed for %s (%s)%s-invalid id-ctx unregister%sMsg based context '%s' unregistered (%s)%s%sUnsynced/unloaded registered objtype: no dmtree->ctx%s%sUnsynced/unloaded registered objtype: no it->linked_obj%s%sUnsynced/unloaded registered objtype: %s:%s%sctx listplugin call stats%4s %-20s %-5s %-35s %-35s client call stats (avgnet=no clientcb&plugincmd)cnt: total/avg/max(msec)cnt: total/avg/max/avgnet(msec)------------------------%4lu %-20s %-5s %lu: %lu.%03lu/%lu.%03lu/%lu.%03lu%-35s %lu: %lu.%03lu/%lu.%03lu/%lu.%03lu/%lu.%03lu%-35s - default session, system=%s - session id=%lu, system=%s, gidx=%u, state=%s, idle_timeout=%u %sllist_move_byobject failed for %s%s%sPluginreg_done: sync'd %d parent objects for ctx('%s')%s%sllist_remove_at failed %s:%d%smbusd_ctx.cctx register%sre-registration of %s:%s%ssuccessfull%sMsg based (%s) context '%s' registration %s (%s)%s_root%sloc_dmtree_create failed for '%s' (%s).%s - '%s', ctx=%sWARNING: Running out of object id's, close to wrap-around%sdmtree nextobjectid: %s: %lu I/A DMTREEG DMTREEmbusd_dmtree%s_atomic%s_system%sFailed to setup datamodel trees%s - '%s, list=' + %s - %s mbusd_enumtype - id=%lu, type='%s'loc_event_append%sEVENT -- processfromplugin: %s%sNULL cmddata on event listxref conversion failed for old valuexref conversion failed for new value%sEVENT -- failed to expand the event (id = %lu) (%s)%smbusd_ev%sevent thread semaphore could not be created!%sstart_maintaskloc_event_getfirst%sEVENT -- loc_event_getfirst: No event found on eventlist%sprocess eventprocess plugin eventUnknown objtypeTODO: addobj on multi-instance parent --> use loadobjects()cannot delete/update_on rootparent object not found from subpathunknown objtypeaddobject faileddelobject failedobject not found from subpathInvalid plugin event type%sEVENT -- processfromplugin (%s '%s':'%s'): failed (%s)!%s%sevent thread: subscription missing in event ! - event skipped%sprocess & delete event*no sub->ctx*failed to send%sEVENT -- %s event(%lu:%s) to ctx(%lu:%s) for subscription(%lu) (%s)%stotal number of processed events: %ld - generated by mbusd: %ld - generated by plugins: %ld current eventlist backlog length: %ld average eventlist backlog length: %ld max eventlist backlog length: %d %sfire_perobject error: listitem with no cmddata detected%s%sfire_perobject: failed to get pointers - unable to event !%s%sfire_perobject: failed to find object - unable to event !%s%sfire_perobject: failed to process events (%s)%s%s%s: error '%s'%s%s%s: failed eventing for subscription %d%s%s.*.%s*.%s%s%s: out of resources%smbusd_eventMBUSD_EVLIST%sFailed to %s%sinit eventlist lockMBUSD_EVTASKinit eventtask lockmbusd_sevcreate mbusd_sev semaphorembevcreate event listener taskstart event listener task - '%s'%sIPC registration from '%s' (pid=%u, user='%s', gidx=%u)%s%sIPC authentication failed for '%s' (pid=%u, uid=%u, unknown user '%s') %s%sIPC authentication failed for '%s' (pid=%u, uid=%u, No user info found) %s%scancelling ctx registration; could not send reply%s%sccmd-cbmsg('%s' ctx=%s) senddata failed (%s)%s%sccmd-cbmsg-reply('%s' ctx=%s ctxid=%d txid=%d) receivedata failed (%s)%s%sexpected ccmd-cbmsg-reply('%s' ctx=%s ctxid=%d txid=%d), processing of msg(%s) failed (%s)%s%sccmd-cbmsg-reply('%s' ctx=%s ctxid=%d txid=%d) validatehdr failed ('%s' ctxid=%d txid=%d) (%s)%ssend pcmd%spcmd serialisation failed for '%s' (%s)%s%spcmd('%s' pctx=%s) addmsgheader failed (%s)%s%spcmd('%s' pctx=%s) senddata failed for (%s)%s%sexpected pcmdreply('%s' ctx=%s ctxid=%d txid=%d), receivedata failed (%s) - stop wait%s%sexpected pcmdreply('%s' pctx=%s ctxid=%d txid=%d), reconstructhdr failed (%s)%s%sexpected pcmdreply('%s' ctx=%s ctxid=%d txid=%d), processing of msg(%s) failed (%s) - waiting for pcmdreply%s%spcmdreply('%s' ctx=%s ctxid=%d txid=%d) validatehdr failed ('%s' ctxid=%d txid=%d) (%s)%smbusd_dynregenumtypembusd_dynregobjtypembusd_dynregparamtypembusd_dynregxreftype - %d '%s', list=%sERROR loc_object_free_ex: Object not flagged for deletion !%s - type='%s', curr_idx=%d%sInvalid character '%c' in keystring '%s'%s%sERROR loc_object_fireevent2: name=%s (%s)%s%*c %s (backup_id:%u inbr:%u) %c%c(creating)(deleted)%sWARNING: evented delete failed for child of %s.%s%s%smbusd_object_deleteobject failed for object with key %s%s%sWARNING: evented delete failed for %s.%s (%s)%s%smbusd_object_calloc failed to clone objecttype AR%s%smbusd_object_calloc failed to clone paramtype AR%s%smbusd_object_calloc failed to set objparam AR (%s)%s%sFailed to add new object '%s'%smbusd_objectmbusd_objectindex, dynamic(ctx=%lu, %s, %s%s%s; max %d (deleted))%s - '%s', list=%sERROR loc_objecttype_free_ex: Objtype not flagged for deletion !!%sInvalid objecttype path specified. %*c %s multisingle, cached%sdeleteobjtype (on child of '%s') failed (%s)%s%sRegister_objecttype failed: %s%s%sParent object not found - registration canceledObjecttype already registeredObjecttype allocation errorFailed to allocate mi_entriescnt_nameFailed to append child to linked listFailed to allocate paramtypeFailed to add paramtype%sLate registration of objtype in phase %d: %s:%s%smbusd_objtype - parameter='%s', value='%s'mbusd_objvalue - %d '%s'ipv4_addrmac_addrenumx-refhexblob%*c %c%c%c%c%c%c%c%c%c %-20s type: %-10s (%ld <= %lu <= <= %ld <= %lu%sRegister_paramtype: Failed to allocate %s%s%sparamtype_register failed for '%s.%s': invalid enumtype '%s'%sdynstring for xreftype%sparamtype_register failed for '%s': invalid enumtype '%s'%s%sparamtype_register failed for '%s.%s': no xref peertypes%sllistitem for xreftypembusd_paramtypembusd_xreftyperegister enumtypesregister objecttypes%sevent -- error : read-only parameter '%s.%s' (%X)%sIGDATOMIC%sXREF(%s): failed to resolve xrefvalue '%s' to types(%s)%s%sError: No context for this objecttype (%s)%s%s->pcmd [%sid=%d, cmdlen=%d], [%s:%s, pcmd=%s, objt=%s]%s%sError: Missing callback for this objecttype (%s)%s%sError: Invalid context for this objecttype (%s)%s%s<-pcmd=%s %dms [%sid=%d, replen=%d] [%s:%s, pcmd=%s, obj=%s]%sremotelylocally%sError: Plugin cmd [%s] failed (%s) for '%s:%s' (%s)%s@%sError: Anchor could not be removed from '%s' parameter%s@%s%sError: add client command without command data list%s*cached_*cached_%dAuthenticated - id=%u, state=%s, gidx=%umbusd_sessions_CUSTOVARIANT_PHYSLAYERTYPE_FIAMBUS_POTF_MULTI_INSTANCEMBUS_POTF_DEL_ADD_ALLOWEDMBUS_POTF_CACHEDMBUS_POTF_DYNAMICMBUS_POTF_PERSISTENTMBUS_POTF_DYNAMIC_NONPERSISTENTMBUS_PPT_TYPE_NONEMBUS_PPT_TYPE_INT32MBUS_PPT_TYPE_UINT32MBUS_PPT_TYPE_STRINGMBUS_PPT_TYPE_BOOLMBUS_PPT_TYPE_DATETIMEMBUS_PPT_TYPE_IPV4_ADDRMBUS_PPT_TYPE_MAC_ADDRMBUS_PPT_TYPE_ENUMMBUS_PPT_TYPE_XREFMBUS_PPT_TYPE_HEXBLOBMBUS_PPT_TYPE_BITFIELDMBUS_PPTF_READMBUS_PPTF_WRITEMBUS_PPTF_REQMBUS_PPTF_MINSETMBUS_PPTF_MAXSETMBUS_PPTF_NROFENTRIESMBUS_PPTF_KEYMBUS_PPTF_MAPPEDMBUS_PPTF_CACHEDMBUS_PPTF_NOTEVENTABLEMBUS_PPTF_PERSISTENTMBUS_PPTF_DELAY_SET_ONLOADMBUS_PPTF_NONPERSISTENTMBUS_PPTF_REFERENCE%*c<%s>%s %*c<%s %s="%s"/>%s%*c%sconstraint%*c<%s %s="%s">%d%s%*c<%s %s="%s">%s%sobjecttype %*c<%s %s="%s">%sconstraints%*c<%s %s="%s" %s="%s">%sminmaxrefpeertype %*c%s%s<%s>%sdatamodelmeta <%s name="%s">%s%sXML dump <%s>%s <%s %s="%s">%s <%s %s="%s"/>%s %s %s%s=%s [MBUSDB] Saving to %s failed (error=%d) locking_modecount_changessynchronousquery_traceignore_param_savetemp_storePRAGMA user_version=109;CREATE TABLE Registry ( Key STRING PRIMARY KEY, Value STRING NOT NULL );INSERT INTO Registry VALUES ('population_completed','0');CREATE TABLE ObjectType ( ObjectTypeID INTEGER PRIMARY KEY AUTOINCREMENT, ObjectTypeParentID INTEGER, ObjectTypeDMtree INTEGER NOT NULL, ObjectTypeName STRING NOT NULL, ObjectTypeParams STRING, ObjectTypeAR STRING, ParamTypeAR STRING );CREATE TABLE Object ( ObjectID INTEGER PRIMARY KEY AUTOINCREMENT, ObjectParentID INTEGER, Depth INTEGER NOT NULL, ObjectTypeID INTEGER NOT NULL, ObjectName STRING NOT NULL, LocalIdx INTEGER NOT NULL, ObjectValues STRING, Flags INTEGER, Inbr INTEGER, NullVal INTEGER, ObjectAR STRING, ParamAR STRING );CREATE INDEX Object_idx1 ON Object (ObjectTypeID);CREATE INDEX Object_idx2 ON Object (ObjectParentID);CREATE INDEX Object_idx3 ON Object (Inbr);CREATE TABLE LocalIndex ( ObjectID INTEGER NOT NULL, ObjectTypeID INTEGER NOT NULL, LocalIdx INTEGER NOT NULL, PRIMARY KEY (ObjectID,ObjectTypeID) );CREATE INDEX LocalIndex_idx1 ON LocalIndex (ObjectID);CREATE INDEX LocalIndex_idx2 ON LocalIndex (ObjectTypeID);CREATE VIEW MBUS AS SELECT o.Depth AS Depth, t.ObjectTypeDMtree AS DMtree, t.ObjectTypeID AS TypeID, t.ObjectTypeName AS TypeName, t.ObjectTypeParentID AS TypeParentID, o.ObjectID AS ObjectID, o.ObjectName AS ObjectName, o.LocalIdx AS LocalIdx, l.LocalIdx AS MaxLocalIdx, o.ObjectParentID AS ParentID, p.ObjectName AS ParentName, t.ObjectTypeParams AS TypeParams, o.ObjectValues AS ObjectValues, o.Flags AS Flags, o.Inbr AS Inbr, o.NullVal AS NullVal, t.ObjectTypeAR AS ObjectTypeAR, t.ParamTypeAR AS ParamTypeAR, o.ObjectAR AS ObjectAR, o.ParamAR AS ParamAR FROM ObjectType AS t, Object AS o LEFT OUTER JOIN Object AS p ON p.ObjectID=o.ObjectParentID LEFT OUTER JOIN LocalIndex AS l ON l.ObjectID=o.ObjectParentID AND l.ObjectTypeID=o.ObjectTypeID WHERE o.ObjectTypeID=t.ObjectTypeID ;DROP VIEW MBUS;UPDATE sqlite_sequence SET seq=(SELECT MAX(ObjectID) FROM Object) WHERE name='Object';UPDATE sqlite_sequence SET seq=(SELECT MAX(ObjectTypeID) FROM ObjectType) WHERE name='ObjectType';SELECT name FROM sqlite_master WHERE TYPE IN ('table','view') AND name NOT LIKE 'sqlite_%';SELECT * FROM MBUSALTER TABLE Object ADD LocalIdx INTEGER NOT NULL; UPDATE Object SET LocalIdx=0; PRAGMA user_version=101;VACUUM;CREATE TABLE LocalIndex ( ObjectID INTEGER NOT NULL, ObjectTypeID INTEGER NOT NULL, LocalIdx INTEGER NOT NULL, PRIMARY KEY (ObjectID,ObjectTypeID) );PRAGMA user_version=102;DROP TRIGGER ObjectTypeInsertConstraint;DROP TRIGGER ObjectTypeUpdateConstraint;DROP TRIGGER ObjectTypeDeleteConstraint;DROP TRIGGER ObjectTypeParamInsertConstraint;DROP TRIGGER ObjectTypeParamUpdateConstraint;DROP TRIGGER ObjectTypeParamDeleteConstraint;DROP TRIGGER ObjectInsertConstraint;DROP TRIGGER ObjectUpdateConstraint;DROP TRIGGER ObjectDeleteConstraint;PRAGMA user_version=103;ALTER TABLE Object ADD ObjectValues STRING;ALTER TABLE ObjectType ADD ObjectTypeParams STRING;VACUUM;UPDATE Object SET LocalIdx=0; PRAGMA user_version=104;DROP TABLE ObjectTypeParam;DROP TABLE ObjectValues;VACUUM;PRAGMA user_version=105;ALTER TABLE Object ADD Flags INTEGER;VACUUM;UPDATE Object SET Flags=0; PRAGMA user_version=106;ALTER TABLE Object ADD Inbr INTEGER;VACUUM;UPDATE Object SET Inbr=0; PRAGMA user_version=107;CREATE INDEX Object_idx3 ON Object (Inbr);PRAGMA synchronous=FULL;CREATE TEMPORARY TABLE ObjectCopy ( ObjectID INTEGER PRIMARY KEY AUTOINCREMENT, ObjectParentID INTEGER, Depth INTEGER NOT NULL, ObjectTypeID INTEGER NOT NULL, ObjectName STRING NOT NULL, LocalIdx INTEGER NOT NULL, ObjectValues STRING, Flags INTEGER, Inbr INTEGER, NullVal INTEGER );INSERT INTO ObjectCopy (ObjectID,ObjectParentID,Depth,ObjectTypeID,ObjectName,LocalIdx,ObjectValues,Flags,Inbr) SELECT ObjectID,ObjectParentID,Depth,ObjectTypeID,ObjectName,LocalIdx,ObjectValues,Flags,Inbr FROM Object;UPDATE ObjectCopy SET NullVal=0;DROP TABLE Object;CREATE TABLE Object ( ObjectID INTEGER PRIMARY KEY AUTOINCREMENT, ObjectParentID INTEGER, Depth INTEGER NOT NULL, ObjectTypeID INTEGER NOT NULL, ObjectName STRING NOT NULL, LocalIdx INTEGER NOT NULL, ObjectValues STRING, Flags INTEGER, Inbr INTEGER, NullVal INTEGER );INSERT INTO Object SELECT * FROM ObjectCopy;DROP TABLE ObjectCopy;CREATE INDEX Object_idx1 ON Object (ObjectTypeID);CREATE INDEX Object_idx2 ON Object (ObjectParentID);CREATE INDEX Object_idx3 ON Object (Inbr);VACUUM;PRAGMA user_version=108;ALTER TABLE ObjectType ADD ObjectTypeAR STRING;ALTER TABLE ObjectType ADD ParamTypeAR STRING;ALTER TABLE Object ADD ObjectAR STRING;ALTER TABLE Object ADD ParamAR STRING;VACUUM;UPDATE ObjectType SET ObjectTypeAR='',ParamTypeAR=''; UPDATE Object SET ObjectAR='',ParamAR=''; PRAGMA user_version=109;^EXCLUSIVEFULLtracingwaiting for locklocalized synctree searchadding objectget paramset param handleset param processsorting cmddata'slocalidx savelocalidx loadregistry saveregistry loadrestoresqlite3_open()sqlite3_close()sqlite3_mprintf()sqlite3_free()sqlite3_exec()statements preparestatements clearstatement executesqlite3_get_table()sqlite3_free_table()sqlite3_vacuum()%20s %6s %12s %10s %10s %10s Min (ms)NrMax (ms)Tot (ms)Avg (ms)%20s %6lu %8lu.%03lu %6lu.%03lu %6lu.%03lu %6lu.%03lu Total%[^=]=%[^ ] [MBUSDB] Loading from %s failed (error=%d) /etc/config/ppp.cfgPPP.Intf.ppp_0/etc/config/cwmp.cfg/etc/config/cwmp_server.cfgCWMP.Server[MBUSDB] query: %4lu.%03lu ms - %s INSERT OR REPLACE INTO Object (ObjectID,ObjectParentID,Depth,ObjectTypeID,ObjectName,LocalIdx,Flags,Inbr) VALUES (?,?,?,?,?,?,?,?)UPDATE Object SET ObjectAR=?,ParamAR=? WHERE ObjectID=?INSERT INTO ObjectType (ObjectTypeParentID,ObjectTypeDMtree,ObjectTypeAR,ParamTypeAR,ObjectTypeName) VALUES (?,?,?,?,?)UPDATE ObjectType SET ObjectTypeAR=?,ParamTypeAR=? WHERE ObjectTypeID=?INSERT OR REPLACE INTO LocalIndex (ObjectID,ObjectTypeID,LocalIdx) VALUES (?,?,?)SELECT LocalIdx FROM LocalIndex where ObjectID=? AND ObjectTypeID=? LIMIT 1UPDATE ObjectType SET ObjectTypeParams=?||? WHERE ObjectTypeID=?UPDATE Object SET ObjectValues=?||?,NullVal=? WHERE ObjectID=?INSERT OR REPLACE INTO Registry VALUES (?,?)SELECT Value FROM Registry WHERE Key=?SELECT ObjectTypeID FROM ObjectType WHERE (ObjectTypeParentID IS NULL OR (ObjectTypeParentID IS NOT NULL AND ObjectTypeParentID=?)) AND ObjectTypeName=? LIMIT 1SELECT ObjectID FROM Object WHERE (ObjectParentID IS NULL OR (ObjectParentID IS NOT NULL AND ObjectParentID=?)) AND ObjectTypeID=? AND ObjectName=? LIMIT 1SELECT ObjectTypeAR||'#'||ParamTypeAR FROM ObjectType WHERE ObjectTypeID=? LIMIT 1[MBUSDB] Error binding integer %d to statement %d[MBUSDB] Error binding string '%s' to statement %dSELECT Value FROM Registry WHERE Key='%q';[MBUSDB] Error in registry_load: %s [MBUSDB] Error in statement %d: %s Failed to obtain writelock for '%s' (action aborted)! Failed to release the writelock! [MBUSDB] Error while executing query %s: %s [MBUSDB] Error in query: %s profilingextended_profilingload_orderSELECT MIN(MAX(Inbr),MAX(ObjectID)) FROM Object;[MBUSDB] Instance-based load configured in registry, but no instance numbers stored in DB -> fallback to model-based load [MBUSDB] Instance-based load activated [MBUSDB] Model-based load activated [MBUSDB] Error in query_by_id: %s Query:%s [MBUSDB] %s executed when transaction ongoing DELETE FROM Object;DELETE FROM ObjectType;DELETE FROM LocalIndex;DELETE FROM sqlite_sequence;[MBUSDB] Error: out of memory DROP TABLE %s;[MBUSDB] Error in drop_table: %s [MBUSDB] Indicate that data model is up to date dm_updated[MBUSDB] Upgrading database schema (v1.0.0 -> v1.0.1) [MBUSDB] Database schema upgraded to v1.0.1) [MBUSDB] Upgrading database schema (v1.0.1 -> v1.0.2) [MBUSDB] Database schema upgraded to v1.0.2) [MBUSDB] Upgrading database schema (v1.0.2 -> v1.0.3) [MBUSDB] Database schema upgraded to v1.0.3) [MBUSDB] Upgrading database schema (v1.0.3 -> v1.0.4) UPDATE ObjectType SET ObjectTypeParams='%s%%s' WHERE ObjectTypeID=%%dSELECT ObjectTypeID,ObjectTypeParamName FROM ObjectTypeParamUPDATE Object SET ObjectValues='%s%%s' WHERE ObjectID=%%dSELECT ObjectID,ParamValue FROM ObjectValues[MBUSDB] Database schema upgraded to v1.0.4) [MBUSDB] Upgrading database schema (v1.0.4 -> v1.0.5) [MBUSDB] Database schema upgraded to v1.0.5) [MBUSDB] Upgrading database schema (v1.0.5 -> v1.0.6) [MBUSDB] Database schema upgraded to v1.0.6) [MBUSDB] Upgrading database schema (v1.0.6 -> v1.0.7) [MBUSDB] Database schema upgraded to v1.0.7) [MBUSDB] Upgrading database schema (v1.0.7 -> v1.0.8) >>> Phase %d, attempt %d (%s) >>> Phase %d, attempt to execute '%s' (%s) [MBUSDB] Database schema upgraded to v1.0.8) [MBUSDB] Upgrading database schema (v1.0.8 -> v1.0.9) [MBUSDB] Database schema upgraded to v1.0.9) [MBUSDB] Population of the database did not complete correctly -> enforce new importERROR: database check failed in phase %d (current version: %d): %s [MBUSDB] Error in schema_check: %s %s%s%lx[MBUSDB] Out of memory - objectindex pool depleted [MBUSDB PROF] ADD/SET: %8lu.%03lu ms - %3d set commands on path %s [MBUSDB PROF] * %s=%s (%s) [MBUSDB PROF] * add returned key %s (%s) [MBUSDB] Error: parameter list and value list have mismatching lenght! [MBUSDB] (bug) Object tree corrupted! Object with backup_id %d and name '%s' has no type! [MBUSDB] (bug) Bug detected in backup/restore! [MBUSDB] No memory! Set %s.%s=%s [MBUSDB] loc_dmtree_createobject: %s (%s) [MBUSDB] Adding object %s.%s failed (%s)! cmddata calloc()object_getpathstr() failedllist_addobject() failed[MBUSDB] Creation of object %s failed (%s) Object %s.%s created [MBUSDB] Error: no resources available for set commands! set commandsset commands on pathpreviously failed[MBUSDB PROF] SET : %8lu.%03lu ms - %3d %s %s [MBUSDB PROF] SET : set command on path %s [MBUSDB] Setting %s.%s='%s' failed (%s) %s [MBUSDB] Error: no resources available for rescheduling set command! [MBUSDB] Error: query result has unexpected format DELETE FROM Object WHERE ObjectID IN (%q)[MBUSDB] Error in dellist_process: %s BEGIN TRANSACTION saveasync; Saving IGD tree --------------- Saving ATOMIC tree ------------------ backup - savingEND TRANSACTION saveasync;MBUS configuration saved BEGIN TRANSACTION saveidx;END TRANSACTION saveidx;BEGIN TRANSACTION save;ar_zones[MBUSDB] Error binding blob '0x%08x-0x%08x' to statement %d ### STARTING TO SAVE TO THE DATABASE ### ### FINISHED TO SAVE TO THE DATABASE ### [MBUSDB] Indicate that the population of the new database did complete population_completedEND TRANSACTION save;backup - loadingverbose Loading IGD tree ---------------- Loading ATOMIC tree ------------------- SELECT * FROM MBUS WHERE DMtree=%d ORDER BY Depth,TypeID,ParentID;SELECT * FROM MBUS WHERE DMtree=%d ORDER BY Inbr;[MBUSDB] Error in dbtree_walk: %s [MBUSDB] Re-trying %d failed 'set' command%s for the last time [MBUSDB] %d 'set' command%s still failed after the last retry [MBUSDB] All 'set' commands successfully applied MBUS configuration loaded backup - exportingstdoutError: could not open %s for writing! Exporting IGD tree ------------------ Exporting ATOMIC tree --------------------- MBUS configuration exported backup - importing Importing %s ----------Error: could not open %s for reading! MBUS configuration imported PRAGMA schema_version;PRAGMA integrity_check;PRAGMA user_version;SELECT count(*) FROM ObjectType;SELECT IFNULL ((SELECT Value FROM Registry WHERE Key='population_completed'), '1');/etc/config/dbcheck.txt[MBUSDB] Error in init: %s DB check failed %d:%s =========================================== Corrupted configuration detected (NOK) =previous configuration =factory defaults ===================================== New configuration detected (OK) =/usr/bin/bootmode get/etc/config/mbus.dat[MBUSDB] Version of rescue firmware is %s 7.20.0.[MBUSDB] From rescue v7.2 onwards, no database is used anymore -> remove /etc/config/mbus.dat [MBUSDB] Deleted rescue database /etc/config/mbus.dat [MBUSDB] Could not delete rescue database /etc/config/mbus.dat [MBUSDB] Version of rescue firmware could not be determined (error: %x) [MBUSDB] Initializing backup/restore to use %s backup file backup-restore[MBUSDB] Rewind configuration lock_per_object%s%u[MBUSDB] Objects in model %d queued for deletion: %s AutoSaveConfigLoadFileNameConfigLoadConfigLoadedConfigSaveFileNameConfigSaveAsyncConfigSavedFactoryDefaultsRebootDelayUpgradeShutdown/dev/random%s[DEVCONF] Digest authentication failed!%s%s[DEVCONF] %s%s%s[DEVCONF] WARNING: sending plugin event on DeviceConfig.%s update failed!%s%s[DEVCONF] WARNING: system reboot triggered!!!%s/bin/sleep %2d && /usr/sbin/reset_button.sh && /bin/ledctrl All FastBlinkContinues && /sbin/halt &/bin/sleep %2d && /usr/sbin/reset_button.sh && /etc/init.d/rc 6 &/bin/sleep %2d && /sbin/halt &/bin/sleep %2d && /etc/init.d/rc 6 &%s[DEVCONF] executing '%s'%s%sError: reboot failed!%s%d-journal/bin/rm -f %s%sError: backup failed!%s%s[DEVCONF] Signal %d catched in process with pid %d %smbusd_devconf%s[DEVCONF] plugin registration failed%s%s[DEVCONF] type registration failed%s%s[DEVCONF] Signal handler for signal %d installed on pid %d %s/dev/button2%s[DEVCONF] No device or driver available for factory defaults button %s%s[DEVCONF] Subscription on reset to factory defaults button succeeded %s%s[DEVCONF] Subscription on reset to factory defaults button failed - events will be dropped (%s) %s/usr/bin/bootmode set system && /bin/rm -f %s && ((/usr/bin/test -f %s_pre && /bin/mv %s_pre %s && /sbin/reboot) || /sbin/reboot)%sError: rewind failed!%s%s.dec%sError: illegal type or currupted file uploaded!%s/usr/bin/test -f %s && /bin/rm -f %s_pre && /bin/mv %s %s_pre && /bin/mv %s %s%sError: restore failed!%s%s[DEVCONF] WARNING: BOOTP mode triggered!!!%s/usr/bin/bootmode set bootp%sError: BOOTP mode failed!%s%simport - MBus exec failed: %s on %s%s%s%s%s (%s)%s[MBUS_IMEX] %c - EXEC (%s)/etc/config/pathtype.cfg[MBUS_IMEX] %c - %s (%s)%simport - parsing failed on line %d (%s)%sOBJECT %s.%s.()%sOBJECT %s%s%sF - export: object path construction failed%s PARM %s=%s%s%sF - export: parameter error (%s)%sdeladdupdenable_after_load%sloc_trigger_signal_handler: create local receive socket failed%s[MBUS_TRIG] %sloc_trigger_signal_handler: bind local receive socket failed%s%s[TRIGSIG] Error: select returned %lx%s%sChild process with proc_id=%d died.%schild_signal%sChild process for fire_id=%d running.%s%sloc_trigger_signal_handler: received unknown message%slistobjects%4s %-15s %s U%4d %-15s flags=%s%s%s%s%s%s%s, state=%s, subid=%d %4s %-15s path=%s, param=%s, depth=%d %4s %-15s value_filter='%s', action='%s' Flags: (E)nable, sub_(A)ddobj, sub_(D)elobj, sub_(U)pdate, (R)eq_all, allow_(M)ultiple, fire_on(S)ubscribe new triggertrigger_%luenable trigger%sError mbus_trigger_enable(): state change failed (incomplete trigger configuration)%s%sTrigger '%s': delaying subscription after load%s%sError enable(1): mbus_ccmd_add_subscribe_request failed (%s)%s%sError enable(1): mbus_invoke_ccmd_subscribe failed (%s)%s%sError enable(1): Subscription failed (no cmddata)%s%sError enable(1): Subscription failed (cmddata error: %s)%s%sError enable(1): Already subscribed%s%sError enable(0): mbus_ccmd_add_unsubscribe_request failed (%s)%s%sError enable(0): mbus_invoke_ccmd failed (%s)%s%sError enable(0): Not subscribed%s%s(%s load completed) Trigger '%s': creating trigger subscription%s%sTrigger not fired '%s' (no resources)%sPATHNEWVALUEOLDVALUE%sTrigger not fired '%s' (cmd construction failed)%s-c%sStarting trigger '%s' fire_id=%d --> child proc_id=%d%s%sEvent: Trigger not found for subscrid = %lu%s%sEvent: Not firing trigger '%s' for subscrid = %lu (state=%s)%s%sTrigger '%s': firing event on subscription%smbus_trigger%sFailed to allocate triggers buffer %sMBUS_TRIGsigt%sFailed to allocate signal semaphore %smbus_trigsignal%sFailed to allocate signal task %s%sFailed to start signal task %strigger_NumberOfEntriesupdobjsubscr_pathsubscr_pathtypesubscr_paramsubscr_depthallow_multiplefire_onsubscribevalue_filterrequire_allsubscr_idproc_idkill_actionenabletriggerstatestriggerpathtypesobjidxkeystrX_000E50_triggersmbustriggerX_000E50_triggers.trigger_atomic%sPlugin context creation failed (%s) %s%sPlugin context setdatamodel() failed (%s) %s%sPlugin socket creation failed (%s) %s%sPlugin registration failed (%s) %s%sRegistration enum 'triggerstates' failed (%s) %s%sRegistration 'triggerroot' failed (%s) %s%sRegistration 'trigger' failed (%s) %s/tmp/.updated.confconfig_data_read_errorHard system reboot triggered by upgrade daemonMaximum attempt to upgrade FW reachedServer gives an unexpected FW typeFW verification failedFW flashing failedFW download failureFW size too large to fit in memoryFW header invalidUnexpected boot flagAuthentication to FW website failedWebsite for getting FW connection failureUpgrade Daemon configuration file corruptedCannot store UD configurationInformation from ACS not validInternal errorNo error authentication failedmemory allocation failedconnect or transfer errorinternal errorSUCCESSFAILEDErrorDescErrorCodeErrorCompletedOngoingIdleDisabledInitialisingupgrade_statusUPGRADE_CLIENTUPGRADE_PLUGINKeyServiceChkPasswordUsernameURLImageDebugAttemptEnableStatusUpgradeinfdbgwrnerr[UPGD]mbusd_atomicremote_upgradedled_ctrl Upgrade Status Off Offled_ctrl Upgrade Status Off FastBlinkContinuesled_ctrl Upgrade Status Off SlowBlinkContinuesinvalid UPGRADE_STATUS!image URL server ip = %d.%d.%d.%dboot_flag is an invalid value!loc_cb_disabled: upgraded disabled...mv -f /etc/config/updated.conf %smv configfile to /tmp/.updated.confhttp_get_filetype start http_get_filetype %s http_get_filetype stop loc_upgrade_register, step_def=%x=,maxstep=%x=RescueNORMAL_MODERESCUE_MODEloc_select_scenario: filetype=%s ,bootmode=%s The current scenario [%d] is invalid!loc_select_scenario done! loc_register_state_machine, scenario = %d Invalide scenario!loc_set_bootflag : system will reboot to %s Try to reboot to rescue failed.Current scenario is NORMAL_U_NORMALTry to reboot to normal failed but upgrade finished.Invalid scenario.Scenario : RESCUE_U_RESCUEloc_cb_kick_step_0 start to save step&image&http info to flash image_config_data_write_image %s image_config_data_write_http %s loc_cb_kick_step_0 doneloc_check_attempt startconfig_data_read_attempt_%s (attempt = %d)loc_check_attempt : %s (upgraded_lbi.attempt = %d)read trace_level = %dloc_check_expected_valueloc_check_expected_value : get bootmode %s loc_check_expected_value %sconfig_data_read_expectedboot_%s (expected_boot = %d)loc_check_expected_value: %s (upgraded_lbi.boot_flag = %d, expected_boot = %d)loc_sda_ramdisk_start /etc/init.d/ramdisk start/etc/init.d/rc 6Upgrade completedUpgrade stop/etc/init.d/ramdisk stoprecalculating version numbersREBOOT TIMER EXPIRED WITHOUT PPP CONNECTION ==> REBOOTrm -f /etc/config/ppp.cfgloc_reboot_timer: in (%d)loc_reboot_timer: ppp channel found (%d)loc_reboot_timer: ppp channel %d info found (%d %d)loc_reboot_timer : get params failed for %dloc_reboot_timer: %d connecting ==> start reboot timerloc_reboot_timer: %d connecting ==> start reboot timer %sloc_reboot_timer: waiting for credentialsloc_reboot_timer: waiting for credentials - start timer %sloc_reboot_timer: %d connected ==> stop timerloc_reboot_timer: waiting for connection timed out ==> rebootplatform_appl_init: NONE Stand_alone, flags 0x%04xplatform_appl_init:hco_upgrade_init failedplatform_appl_init: create reboot timer %splatform_appl_init: start ad timer %splatform_appl_init: reboot timer startedplatform_appl_init: sslapi_registerTask failedplatform_appl_init: SSL is supported%2x/etc/config/updated.confConfig_data_write %s %s (%s=%d)Config_data_read %s %s : %s is not saved in config file!Config_data_read %s %s : (%s=%d)+config_data not presentconfig_data is presentupgraded.stepupgraded_lbi.attemptmax_attemptupgraded_lbi.expected_bootmodeupgraded_lbi.file_typeupgraded.error_asc%s : error->code_asc = %s %s: NO ERROR now !upgraded.error_desc%s : error->desc = %s %s: %s!config_data_write_error%s : error->code_hex verify %s%s : %s (code_asc=%s, desc="%s")config_data_read_imageimage.url%s : read %s = %s image.usrimage.pwimage.keyconfig_data_write_image%s : %s = %s config_data_read_httphttp.ipaddrhttp.port%s : %s=%s, %s=%sconfig_data_write_http%s: %s,rv=%dtrace_leveltrace_level is not saved in config file!config_data_read_trace_level: trace_level = %dDo not need to write upgraded_level! level = %dWrite trace_level to the config file ! level =%d http_download_image(): starthttp_download_image(): invalid buf/size/fphttp_download_image():attempts=%x=connect_to_server failedhttp_download_image 1: %shttp_download_image:to buffer...... http_download_image:to file......http_download_image 2:%sdownload filetype failed!http_download_image 3: %shttp download image failed!http_download_image 4: %shttp_download_image(): %s upgrade_image():start url=%s=,ur=%s=,pw=%s=/mnt/ramdisk/rd1/imagea+upgraded_verify_image: startupgraded_verify_image: opening image or key file failed. upgraded_verify_image: %s upgrade verify image failedupgraded_write_image: startupgraded_write_image: %s upgrade write image failedupgraded_image: %s upgrade_get_fileinfo: start upgrade_get_fileinfo: invalid parametersENV._BOARD_NAMEupgraded_get_fileinfo : get _BOARD_NAME failed upgraded_get_fileinfo : board_name = %s http_get_filetype: LBI_get_header_size for to_get_hdrlen %shttp_get_filetype: malloc to_get_hdrlen %s http_get_filetype: LBI_get_header_size for hdr_len %shttp_get_filetype: malloc hdr_len %s http_get_filetype: header CRC32 validation %s http_get_filetype: LBI_get_image_type %s CANT-CTHOMSON_BOARD UPGRADING with the compatible image ...SAGEM_BOARD UPGRADING with the compatible image ...http_get_filetype: invalid image typerescue imagenormal imageINVALIDupgrade_get_filetype %s : filetype=%s, board_name=%s upgrade_get_filetype : filetype=%d,parameters->param=%dupgrade exit.... upgrade process exitstep into upgraded_runcreated mbus_listen_socketupgrade running ...Failed parsing/processing the mbusd request (%s). %ld unprocessed socket events SET ERROR 0x%02x 0x%02x (%d): %supgraded_set_error: step %d dedicated error handlerwrite error to config data failed!!!!!error not written to config dataerror set (code=%s, desc="%s")error cleared (code=%s, desc="%s")upgraded kicked 0x%02xupgraded kicked UPGRADE_STATUS_ERRORupgraded kicked UPGRADE_STATUS_IDLEupgraded kicked kick errorupgraded kicked start worker errorerror already set, ignore new set requestupgraded_tagp_done 0x%04xThread upgraded_wait_stage %d is started...Thread upgraded_wait_stage state %d reachedupgraded_system_reboot %s: %d (%d %d %s))upgraded.cupgraded_acc_enable %d %d (0x%02x 0x%02x)upgraded_acc_enable LOCKED (0x%02x)upgraded_acc_enable ERR_COM_INV_STATE (0x%02x - %d)upgraded application disabledupgraded application disabled: %serror during loc_upgraded_disabled.main_disabled: %s %s[%s] %s - %supgraded_get_error_code: %xupgraded_get_error_desc_dynstr: %supgraded_acc_attempt: %d %d %dattempt counter can not be written after config loadupgraded_acc_trace_level: %d %dUPGDThread '%s' creation failed.Thread '%s' start failed.Thread '%s' has been started .loc_config_data_read error info: %sread config data %s: code %s, desc %s, flags 0x04xconfig data read %s (step %d)image data save %simage data read %sutil_system("%s") %s : rv = %dwaiting for lock '%s'mbus context '%s' registration %s )mbus context '%s' registration %sThomson Gateway443connect_to_server() inloc_http_create_socket() create SSL socket useing UPGRADED CTX FAILED! rv=%dloc_http_create_socket() SSL fcntl failedloc_http_create_socket() create socket failedloc_http_create_socket() fcntl failedconnect_to_server() socket failedconnect_to_server() ip=%d.%d.%d.%d port=%dhttp_ssl_connect: SSL connect with IO_ERRORhttp_ssl_connect: SSL connect IO_ERRORhttp_ssl_connect: SSL connect SUCCESShttp_ssl_connect: SSL connect TIMEOUTconnect_to_server() http_ssl_connect failedconnect_to_server() hl_connect failedconnect_to_server() out failed: %dhttp_download: invalid range specification: %d - %dhttp_download: invalid type: 0x%02xhttp_download: data_type 0x%02x but no bufferhttp_download: invalid data_type: 0x%02xhttp_download: add range requesthttp_download: sending range request %shttp_download: connection error or timeouthttp_download: hl_Call_event(HLEvent_READ) %s (state=%d)http_download: authentication failed (no access)http_download: unexpected http status: %d (%d)http_download: invalid response content-length: %dhttp_download: content-length ok: expecting rangehttp_download: content-length too big (%d), expecting complete filehttp_download range: content read (offset=%d, length=%d, skip=%d)loc_read_data unexpected NbOfBytes: %dloc_read_data getIncommingData %sconnection error or timeouthl_Call_event(HLEvent_READ) %s (state=%d)http_download full: content readloc_read_data start (type 0x%02x - data type 0x%02x)loc_read_data unhandled type 0x%02xloc_read_data memory %s: %d %dloc_read_data file write %sloc_read_data unhandled data type 0x%02xread_data end %d (type 0x%02x - data type 0x%02x - received %lu - stored %luhttp_download: reading data %shttp_ssl_send: SSL send IO_ERRORhttp_ssl_send:SSL send TIMEOUThttp_ssl_send: SSL send NOKhttp_ssl_recv: SSL recv read 0 on readable sockethttp_ssl_recv: SSL recv IO_ERRORhttp_ssl_recv: SSL recv TIMEOUTimage URL parsed : (%s,%s,%s,%s)invalid url: %shttp_init() %shttp_init_xfer() %shttp_xfer hl_Call init %shttp_xfer: SSL hl_Call_setWriteFunction & hl_Call_setReadFunction INITserver name resolving failedwait for server name resolving (left=%d sec)tcp connect starting (timeout=%d)tcp connect fcntl failedtcp connect in progresstcp connect %swait for server tcp connect (left=%d sec)persistent_data_read_http %spersistent_data_write_http %s%s(%s): tracing initializedCORECOREFSROOTFSEXTENDEDRESCUERESCUE_INI%s action START%s action %d start (flags 0x%04x)%s action %d done%s action %d PROCESS TERMINATOR %d%s action %d %s: %d - type %d - id %d%s action STOP%s action NULLWORKER START: start flags=0x%02x - step=0x%02xWORKER error detectedundefined statemachine in step %dWORKER start (step %d):WORKER step %d:WORKER set next step %dWORKER set next step %d %sWORKER stop (step %d):WORKER FINISHED step %dloc_wait_for_check check start (left %d - wait %d)loc_wait_for_check pollloc_wait_for_check check finished (event)loc_wait_for_check check poll result: %dloc_wait_for_check check polling error: %sloc_wait_for_check check finished (poll)loc_wait_for_check timeoutstarting worker taskUPGWCRITICAL ERROR: worker task already started!CRITICAL ERROR: worker task not created!loc_stop_worker: worker busy, go to sleep (%d - %d)loc_stop_worker result %dUPSCstatemachine_init could not create service check semaphoreWORKER start: call init functionstatemachine_servicechk_event parse %s %sstatemachine_servicechk_event new value %lustatemachine_servicechk_event edge 1 => 0statemachine_sda_cb_servicechk service check disabledstatemachine_sda_cb_servicechk check %serror during service check: %d %sSignal status change %d => %d %s (0x%08x)Change status: %d => %dmbus enum types registration %s (%s)mbus enum types registration %smbus object types registration %s (%s)%s mbus_invoke_pluginreg_done %s: %s mbus object types registration %sclient loc_worker_process: startclient loc_worker_process: error %sclient loc_worker_process: mbus_msg_parse error 0x%08xclient loc_worker_process: %ld unprocessed socket eventsloc_client_lock_get OKMBUS client %s to obtain lock (%lu)loc_client_lock_free OKMBUS client %s to free lock (%lu))no errorMBUS loc_client_parse_reply_list %s %s %d %sMBUS client reply list error (%u)(%s - %s)MBUS loc_client_parse_reply_list value %sMBUS client reply list copy value %s (%s - %s)MBUS loc_client_setvalue %s.%s to %sMBUS client invalid value (%s - %s)MBUS client failed to add setvalues req (%lu)(%s - %s - %s)MBUS client failed to invoke setvalues req (%lu)(%s - %s - %s)MBUS client failed to clean command (%lu)MBUS loc_client_setvalue %s.%s result %dMBUS client subscribe %s to alloc dynstrMBUS client subscribe %s to add subscribe req (%lu)(%s - %s)MBUS client subscribe %s to invoke subscribe (%lu)(%s - %s)MBUS client subscribe %s to get valueMBUS client %s to clean command (%lu)MBUS client unsubscribe %s for %s (%lu)MBUS loc_client_getvalue %s.%sMBUS client failed to add getvalues req (%lu)(%s - %s)MBUS client failed to invoke getvalues req (%lu)(%s - %s)MBUS loc_client_getvalue %s.%s: %s result %dMBUS client checkd_eventMBUS client checkd_event %s: %sMBUS client checkd_paramMBUS upgraded_client_checkd_stop %s to alloc dynstr statusNO DATAMBUS upgraded_client_checkd_stop %s to alloc dynstr errorCompleteTimedOutMBUS client upgraded_client_checkd_stop unexpected %s state %s: get error %sMBUS client upgraded_client_checkd_stop unexpected %s state %s: %supgraded_client_checkd_start start...MBUS client try to undo checkd_start (%d)MBUS client undo checkd_start %supgraded_client_reboot waiting %dupgraded_client_save startupgraded_client_save: wait_interval should not be 0 (%d). Set to %d)MBUS client upgraded_client_save %s to alloc dynstrMBUS client upgraded_client_save dynstr_getulong %s for %sMBUS client upgraded_client_save timedoutupgraded_client_save finished %dMBUS client upgraded_client_get_uint %s to alloc dynstrMBUS client upgraded_client_get_uint %s to parse dynstr: %sMBUS client upgraded_client_set_param %s to alloc dynstrCRITICAL ERROR: upgraded_client_init util_init_mbus_ctx %s!UPGCCRITICAL ERROR: upgraded_client_init mbus_getcommandlistensocket %s!CRITICAL ERROR: upgraded_client_init task not created!checkd client create %sarchfs trying to close archfile '%s' but still in use!! can't be closed yet (useCount>0)! archfs: embedded archfile %s : filesize seems not to be correct, some topics may be lost archfs opened %s offset %d archfsarchfarch_decode_stream : NULL parameters aren't very usefull... OSI2ee$ee$ePeeexee0fDf df xf df f 0fufv|fvfvfwmenu Displays this help informationmenuDisplays menuExits this shell.Exits group selection.Command not allowed. no more parameter type contexts available tagptagparser.cno more parameter type contexts available |-=%.*sInvalid cli specified => groupInvalid parameter specified => group/cmdInvalid cli specified => paramWarning: %s not found, parameter %s ignored. Internal Error: Illegal Type %d %s=%c %s=%-*.*sunknown type[[%c] [%c]= <%s>Syntax : %s Parameters : Following commands are available : %-*s : Following command groups are available : %-*s Command: %s Unknown command. %c[K %s %s= [%s] %s= %s = [%s] = Please retype for verification.Values did not match ! Please try again.%c[K Bad value for parameter '%s' printcb%s option required Option '%s' not allowed := Please retype %s for verification. Values did not match. Try again Required parameter (use ctrl-c or ctrl-g to abort) Command not authorized Option specified twice => %s Option not allowed => %s Missing parametervalue at the end of command : :%s %s Value required for parameter '%s' %s option has no default value Invalid option => %s [%s]not enough group contexts availableWARNING: Unknown Parameter Type %s %senabled for %s%s[CLI-on-MBus] SESSIONTIMEOUT120COLUMNS80ROWS24PS1%userx{}%groupx[]=>%groupx%userx%group%user%time%env(SESSION TIMEOUT Timeout! (after %d sec)CONSOLE%s %-*s %s%-*s TAGPTGHUroutineflashflash-overrideCRITIC-ECPinternetwork-controlnetwork-controlaf11af12af13af21af22af23af31af32af33af41af42af43cs0cs1cs2cs3cs4cs5cs6cs7ahegpespggpgrehmppuprdprsvpvinesxns-idp6to4ipipat-echoat-nbpat-rtmpat-zisbgpbiffbootpcbootpschargenclearcasedaytimediscarddoomfingerftpftp-datagopherhttpproxyikeilsimap2imap3ingres-netipcserveripxirc-oirc-ukerberosldaploginnetbios-dgmnetbios-nsnetbios-ssnnetwallnetware-ipnew-rwhonfdsnicnamenntpntalkntppcmail-srvpop2pop3printerqotdrealaudioriprtelnetrtspsipsmtpsnmpsnmptrapsnppsql*netsql-netsqlservsunrpcsyslogsystattalktimedtftpulistservuucpuucp-rloginwhowww-httpwhoamixwindowsUTC format dd/mm/yyyy hh:mm:ssUTC format yyyy/mm/dd hh:mm:ssNo spaces allowed for '%s' Value for '%s' limited to %d characters quoted stringtr(No end found in translatable string.translated stringparameter %s has wrong setting. wrong setting. %hu or number[+/-]flag[+/-flag...]{%ld %[0123456789]Value for '%s' is a port name or port number (0-65535) Value for '%s' is a protocol name or protocol number (0-255) %ld-%ldInvalid portrange (%s) specified. Format of portrange (%s) is wrong. Value for '%s' is a port number (0-65535) Value for '%s' is a port number (1-65535) Invalid portrange (%s) start > end specified. port-range%lu-%luInvalid IP address specified [%s] ip-address%lu%nInvalid IP mask specified [%s] ip-mask(dotted or cidr)Invalid ipv6-address specified [%s] ipv6-addressInvalid hardware address specified [%s] hardware-address%2.2x:%2.2xInvalid masked hardware address specified [%s] masked-hardware-address**:Illegal value [%s] for boolean type. {%s|%s}ip-rangeValue of parameter %s is wrong type. wrong parameter value. Value of parameter %s out of range Value of parameter %s [%ld,%ld] out of range number{%ld-%ld}Wrong parameter value. {hex-word}[:{hex-word}] ex: 'a12:c30f'Value for '%s' is a dscp name or number (0-63) %ld [0123456789]Value for '%s' is a precedence name or number (0-7) %u/%u/%u %u:%u:%uInvalid date/time specified. %.2d/%.2d/%.4d %.2d:%.2d:%.2d%.4d/%.2d/%.2d %.2d:%.2d:%.2derror: filter creation failed: missing parameter error: filter creation failed (%08x) error: custom path construction failed %sMask%sExcludembus error: add 'set value' request for parameter '%s' failed (%s) %sfailed to obtain mbus writelock%s[TP-MBUS] %sfailed to release mbus writelock%smbus error: (%s) error for parameter '%s.%s': %s (%s) mbus error: (%s) error for object '%s': %s (%s) add objecterror: path construction failed mbus error: add 'delete object' request for '%s' failed (%s) mbus error: object deletion failed (%s) delete objectmbus error: error for parameter '%s': %s (%s) mbus error: add 'get values' request for '%s' failed (%s) mbus error: parameter(s) get failed (%s) mbus error: parameter(s) construction failed (%s) mbus error: parameter(s) set failed (%s) set objectget object listerror: object list retrieval failed %*s%*cerror: out of resources %%save objecterror: error: command path too long (%d > %d) mbus error: object get failed (%s) CLI%sfailed to allocate client context%sinetipc%sfailed to set up MBus %s client context. (%s)%sInternal Error: out of memory for %d Error: invalid IP address for %d Error: invalid range %d Error: invalid value for %d Error: invalid masked MAC %d Invalid parameter value. mbus error: add get request for '%s' failed (%s) mbus error: filter creation for '%s' failed (%s) mbus error: add 'add object' request for '%s' failed (%s) mbus error: parameter construction failed (%s) mbus error: object creation failed (%s) %*dHISTLOGOUT User %s%slogged out on %s (%u.%u.%u.%u)LOGOUT User %s%slogged out on %sLOGOUT %s session of user %s%skilled (%u.%u.%u.%u)LOGOUT %s session of user %s%skilledLOGIN User %s%slogged in on %s (%u.%u.%u.%u)LOGIN User %s%slogged in on %sLOGIN User %s%stried to log in on %s (%u.%u.%u.%u)LOGIN User %s%stried to log in on %sUsername : Password : Login not allowed (%s) Invalid username/password. ______ %s ___/_____/\ / /\\ %s _____/__ / \\ _/ /\_____/___ \ %s // / \ /\ \ _______//_______/ \ / _\/______ / / \ \ / / / /\ __/ / \ \ / / / / _\__ / / / \_______\/ / / / / /\ /_/______/___________________/ /________/ /___/ \ \ \ \ ___________ \ \ \ \ \ / \_\ \ / /\ \ \ \ \___\/ \ \/ / \ \ \ \ / \_____/ / \ \ \________\/ /__________/ \ \ / \ _____ \ /_____\/ \ / /\ \ /___\/ /____/ \ \ / \ \ /___\/ \____\/ THOMSON multimedia%s MODEMADSLVersion Copyright %s2002 Copyright %sf˼fffffnot-connectedlisteningretryingresolvingconnectingrecoveringphysicalisdnpppWirelessBluetoothTelephonyifmIFM/proc/net/wirelessULIntfLLIntfPhysTypePhysNmbrWLANWDSBridgePortUsePhysSpeedinterface_physical_typeWLinterface_typePhysical%sEventing for '%s.%s' failed.%s[INTF_MBUS]%s.%s.ULIntf%sEventing for '%s.%s.ULIntf.%s' failed.%s%s.%s.LLIntf%sEventing for '%s.%s.LLIntf.%s' failed.%sINTF_MBUS%s%s registration filed.%s%s_if_%d%s_sv_%d%s_ip_%dsrcipaclipaclifaclifgroup[SERVMGR] %s : Service with bidirectional transparent map. Only one map allowed. [SERVMGR] %s : Service map already exists. peersystem_serviceSystem Service Moduleservmgr already initializedservservmgr.cSERVservd netlink socket create failed srvdservmgrd.cRecvfrom failed xt_create('srvd') failed.xt_start('srvd') failed.IFGRPACLIPIntfGroupIFACLIPACLIPAddressRangeStartIPAddressRangeEndPortmapPortRangeStartSystemServicesServiceGroupAttributesInheritedAttributesParamsModifierBitMaskStateUpOperationalStateUpAdministrativeStateUpSourcePortDestinationPortDefaultSourcePortDefaultDestinationPortLoggingForwardingOperationalForwardingAdministrativeForwardingSrcIPIntfSrcIPEventFlag%sMbus plugin processing cmds failed for servmgr_root_mbus_handler.%s[SERVMGR_PLUGIN]%sMbus plugin processing cmds failed for servmgr_portmap_mbus_handler.%s%sMbus plugin processing cmds failed for servmgr_ipacl_mbus_handler.%s%sMbus plugin processing cmds failed for servmgr_ifacl_mbus_handler.%s%sMbus plugin processing cmds failed for servmgr_ifgroupacl_mbus_handler.%sSystemServices.%sSERVMGR_PLUGINevtppbBAD_CTD_REFBAD_QOSB_REFqosbCompleteGUISelectedLanguageFileNameVersionLanguageCodeLanguage.PackLanguagegհgՠgՐgՀgtgdgTgDg4g$glanguage (SelectedLanguage) : %0 complete (CompleteGUI) : %1 Translation record string "number,text"langLanguage code : OSI language code (2 chars) for language (en=English)charsetCharacterset Code (used on host setup wizardFilename : name of language archive to deleteDeletes all languages archives.Filename : name of file to exclude from translationlanguageEnable translation for expert pages.Select a language.Get language configuration.List available languages archives.Delete one or all language archives.langdefSetting language defenition contextAdd a translation record.Exclude a file from translationFlush list of files excluded from translationCODE LANGUAGE VERSION FILENAME %0 %[-19]1 %[-21]2 %3 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ%s%c[TR] Translation file '%s(%s)' truncated at pos %d %s/%s/etc[TR] No translations in translation file '%s(%s)' trans_msg????????????????????[ERROR] Unable to read header from translation file '%s' xx.lng.lng[translator] E - failed to open %s !! lngUnable to load language %s. iso-8859-1utf-8charset.cgideftrstr(): Out of memory!transltranslator.cRemoving %s ... Garbage collection ... Flushing language files... Expected : 'file' or 'all' EnglishPackFileNameSelectedLanguageCompleteGUILanguage.PackLANGUAGE_MBUS[LANGUAGE_MBUS] ---> Conditional expression check VAR=%s VALUE=%s %s CONF_TPVERSIONCONFIG %s%s WARNING: invalid configuration CONFIG :%s CONFIG :%s %s ---> ERROR OCCURED IN CONDITONAL EXPRESSION: stop loading this topic [%s.ini]! config.cini/activeactive/[ [[config] E - Failed to open %s !! tpl.gztplConfigurations file(s): %-10s No configuration files present Template file(s) %-10s No template files present Factory template file(s) : No factory template(s) present. value=\"\")"wizardenvvar=CONFIGURATION: WARNING: invalid configuration file (too long line in topic:%s, further loading cancelled)! ) def CONF_REGIONCONF_PROVIDERCONF_DESCRIPTIONCONF_SERVICE:%s ---> unknown command CONFIGURATION (template definition loading): no configuration commands[%s topic] ('config') are taken into account! /dl/user.tplCONF_TEMPLATETPVERSIONCONFIGURATION: ERROR: FILE IS INCOMPATIBLE WITH TPVERSION BOARD_NAMECONFIGURATION: ERROR: INCORRECT BOARD MNEMONIC CONFIGURATION: ERROR: Problem while parsing script file header CONFIGURATION: WARNING: invalid configuration file (too long line in topic:%s): further loading cancelled for this topic! ) endifelseif elif [check if variable exists]CONFIG: Problem in getting description of template: %s CONFIG: region/provider/description/service string not configured in %s CONFIG: TP_version of template %s not valid CONFIG: Template '%s' file is not valid!!Starting forced GC ....%u < %u Starting forced GC .... there should be enough space on disk available afterwards (%dbytes after recovery) => Starting forced GC .... there should be enough space on disk available afterwards (%dbytes after recovery) YES!NO!After forced GC .... check_ok? %s GC was not the solution!! => GC was not the solution!! /dl/user.iniRemoving user.tpl file .... Removing user.ini file .... => %s There seems to be not enough space on diskOperation cancelledfull table%s_[ %s.%s ][ endofarch ][config] configuration autosaved after delayCONFIGURATION SAVE disabled by %s CONFIGURATION SAVE enabled by %s mbus saveSaving to database failed! Configuration may be corrupt! CONFIGURATION backup by user to file %sCONFIG: File %s doesn't exist. CONFIG: Active IP settings were already flushed (in config flush)! 1.1.0CONFIGURATION [%s] upgraded to version [%s] *** Configuration [%s] upgraded to version [%s] *** Use "saveall" to make the conversion persistent. endofarchmlpCONFIGURATION: WARNING: Too long comandline detected! CONFIGURATION: WARNING: Invalid commands in the template [env.ini] section! Template update failed... configuration is not done!CONFIG: %s (%s) Template file update failed ...!=> %s : %s Template is updated, settings set by user are stored in templateCurrent configuration is flushed (ALSO the ip topic)Non-persistent ENV Variables will be createdCONFIG: non-persistent ENV Variables will be created CONFIG: -> var=%s value=%s => %s : %s Configuration file is loaded ... CONFIG Current configuration is flushed CONFIG (Debugging) Loaded Commands (from template) will be displayed (command results NOT!!) Configuration set by Embedded WizardCONF_DATECurrent Configuration is saved toCONFIG Current Configuration is saved to %s CONFIGURATION saved after running Embedded Setup Wizard (%s deduced from %s)Wizard runs a factory template_tplUnable to create a copy of the template file on disk: diskspace problem?'Variables set by embedded wizard Configuration created by Embedded Wizard (profile:%s)CONF_USR_COMMENT=> %s (%s) %s (%s) %s... where settings will be includedTemplatewill be duplicatedWizard runs a template from diskProblem: template file can't be updated, diskspace problem?CONFIG: using template (%s) again, file will be updated with new settings => %s (%s), %s ... using template againfile will be updated with new settingsCONFIG: a copy of the template (%s) will be created (user.tpl) => %s (%s) %s a copy of the templatewill be created, user.tplisp.defapptimer create failedhhh,h|h8hmbus_invoke_get_client_writelockmbus_invoke_free_client_writelockmbus_invoke_ccmdhTh@h@hhhh(h> %sintfgroup=%s%d %sbrigeport=%s%d %saddr=%s%s %smac=%s%.2x:%.2x:%.2x:%.2x:%.2x:%.2x %sproto=%s%d %stos=%s%d %sprec=%s%d %sdscp=%s%d %sicmp-type=%s%d %sicmp-code=%s%d %ssrc-prt=%s%d->%d %sdst-prt=%s%dmacMACAddressMaskMACAddressExcludeMACExpr_TypeServTOSTOSExcludeIPPrecedenceIPPrecedenceExcludeDSCPExcludeProtocolExcludeSourcePortRangeEndSourcePortExcludeDestPortDestPortRangeEndDestPortExcludeICMPCodeICMPCodeRangeEndICMPCodeExcludeICMPTypeICMPTypeExcludeTCPFlagTCPOptionTCPOptionExcludeExpr_TCPFlagSYNACKFINRSTURGPSHIPAddressMaskIPAddressExcludeIPADDRIPIntfExcludeExpr_%s_%dExpr.IPADDRExpr.ServExpr.MACExpr.IntfATOMIC_EXPR_PLUGIN%sExpr enum type registration failed%s[EXPR_MBUS] %s'%s' registration failed in expr_atom_mbus_init()%s%s'%s.%s' registration failed in expr_atom_mbus_init()%s%s%s: %s failed: %s. %s[EXPR_MBC] %s: %s reply%s%s: %s reply failed; %s. %s%sexpr_atom_mbc_find_name: mbus_ccmd_add_getvalues_request command failed (%s) %s%sexpr_atom_mbc_getvalues: %s %sExpr.%sexpr_atom_mbc_getvalues.Expr%sexpr_atom_mbc_getvalues: mbus_ccmd_add_getvalues_request command failed (%s) %sexpr_atom_mbc_getvalues: Illegal Expression Type%ssubexpr_atom_mbc_getvalues: mbus_ccmd_add_getvalues_request command failed (%s) %ssubexpr_atom_mbc_getvaluesIPIntfGroupExcludesubexpr_atom_mbc_setvalues: illegal expressionIP.Intf.IP.IntfGroup.expr_atom_mbc_setvaluesexpr_atom_mbc_addsubexpr_atom_mbc_add: expr_atom_mbc_find_namesubexpr_atom_mbc_add: mbus_ccmd_add_addobject_request%s%s: %s. %ssubexpr_atom_mbc_addsubexpr_atom_mbc_removesubexpr_atom_mbc_remove: subexpr_atom_mbc_get_keypathsubexpr_atom_mbc_remove: mbus_ccmd_add_delobject_requestexpr_atom_mbc_getfirst: illegal typeexpr_atom_mbc_getfirst: expr_atom_mbc_get_keypathexpr_atom_mbc_getfirst: subexpr_atom_mbc_get_keypathexpr_atom_mbc_createexpr_atom_mbc_create: Illegal type_idexpr_atom_mbc_create: mbus_ccmd_add_addobject_request%s%s. %sexpr_atom_mbc_create: mbus_invoke_ccmd (set):expr_atom_mbc_create: mbus_ccmd_add_getvalues_requestexpr_atom_mbc_deleteexpr_atom_mbc_delete: expr_atom_mbc_get_keypathexpr_atom_mbc_delete: mbus_ccmd_add_delobject_requestsubexpr_atom_mbc_modify: illegal keyexpr_atom_mbc_get: illegal keysubexpr_atom_mbc_get: subexpr_atom_mbc_get_keypathexpr_atom_mbc_getnext: illegal typeexpr_atom_mbc_getnext: expr_atom_mbc_get_keypathexpr_atom_mbc_getnext: subexpr_atom_mbc_get_keypathsubexpr_atom_mbc_getfirst: illegal typesubexpr_atom_mbc_getfirst: subexpr_atom_mbc_get_keypathsubexpr_atom_mbc_getnext: illegal typesubexpr_atom_mbc_getnext: subexpr_atom_mbc_get_keypathexpr_clientrule_setobjectDropAcceptDenyResetSourceIntfExprSourceIntfExcludeSourceIPExprSourceIPExcludeDestIntfExprDestIntfExcludeDestIPExprDestIPExcludeServExprServExprExcludeSourceMACExprSourceMACExprExclude[PFM_MBC] %s%s: %s reply failed: %s. %sFirewall.ChainFirewall.Chain.%schain_getobject: mbus_ccmd_add_getvalues_requestchain_getobject.%lu%srule_findindex: mbus_ccmd_add_getvalues_request command failed (%s) %s%srule_findindex: %s %srule_findindex%srule_getobject: mbus_ccmd_add_getvalues_request command failed (%s) %s%srule_getobject: %s %srule_getobjectTargetTargetChainPacketCountByteCountrule_setobject: mbus_ccmd_add_addobject_requestrule_modifychain_createchain_addobject: mbus_ccmd_add_addobject_requestchain_addobjectchain_delete: illegal keychain_deletechain_delobject: mbus_ccmd_add_delobject_requestchain_delobjectchain_get: illegal keyrule_createrule_deleterule_delobject: mbus_ccmd_add_delobject_requestrule_delobjectrule_get: illegal keypfm_clientINPUTFORWARDOUTPUTInitial System Firewall RulesfireFirewall AdministrationtimeofdayTimeofDay Access ControlCustom Firewall RulesFinal System Firewall Rulesfwm_module_register while fwm not initialized.fwm fwm.cfwm_module_unregister while fwm not initialized.fwm_module_get while fwm not initialized.fwm_module_getfirst while fwm not initialized.fwm_module_getnext while fwm not initialized.fwm_module_register_hook while fwm not initialized.fwm_module_unregister_hook while fwm not initialized.fwm_hook_get while fwm not initialized.fwm_hook_getfirst while fwm not initialized.fwm_hook_getnext while fwm not initialized.xm_alloc failed.FIREWALL level changed to %s.FIREWALL level %s unset.fwmlfwm_level.cLevel ModuleSystemReadOnlyUDPTrackModeSystemServiceProxyAllowedDefaultPolicyStrickLooseFirewallSelectedLevelFirewall.LevelFirewall_Chain_NameInputOutputForwardUserDefined%sGIOCPF_RULE_MODIFY, error = 0x%2.0x, s_pf_rule.err : '%s'%s[FIREWALL_MBUS] ATOMIC_FW_PLUGIN%sFirewall enum type registration failed%s%s'%s' registration failed in Firewall_atom_mbus_init()%s%.2x%.2x%.2x%.2xservice map detach failed. service add failed, service %s already exists. service add failed, maximum of %u services reached. service delete failed: service %s not found. service delete failed: service %s in use. service get failed: service id=%u not found. service get failed: service %s not found. service rename failed: service id=%u not found. service attach failed: no ip address.service attach failed: service id=%u not found. service attach failed: could not detach from current host. map_%x_%x-%x>%smap_%x_%x-%x>%x_%sservice map attach failed. service attach failed: internal error. service detach failed: service id=%u not found. service detach failed: internal error. service map add failed: service not found. service map add failed: service %s in use. service map add failed, maximum of %u service maps reached. service map add failed: service map already exists. service map delete failed: service not found. service map delete failed: service map not found. service map set failed: service not found. service map set failed: service %s in use. service map set failed: service map not found. **** SERVICE ALLOCATION Number services %d Number service maps %d svcsservice.c Allocating %d byte/service Allocating %d byte/service map Allocating %d bytes service init, alloc failed. host_serviceHost Service ModuleTriggerPortOutboundPortOutboundPortRangeEndInboundPortTriggerProtocolRuleProtocolHostIPAddressServiceModeNATAppList%sPlugin processing cmds failed.%s[NATApLst_MBUS]%d_%lu_%huNATAppList_MBUSX[SGW] ERR: Socket creation error! No resources [SGW] ERR: Socket bind error! No resources [SGW] ERR: Socket fcntl get error ! [SGW] ERR: Socket fcntl set error ! sgwd_dnssgwd_mgmtsgwd[SGW] ERR: SGW resolver creation failed. [SGW] ERR: SGW resolver start failed. [SGW] ERR: Failed to notify resolver! [SGW] WARN: Can't delete umagw %s, waiting for DNS response! [SGW] WARN: Deleted umagw %s [SGW] ERR: Maximum number of FQDNs already reached ! [SGW] ERR: mbus client context unregistration failedsgw_atom[SGW] ERR: mbus context creation failed (%s)[SGW] ERR: mbus context setdatamodel failed (%s)[SGW] ERR: mbus context setflags failed (%s)[SGW] ERR: mbus context registration failed (%s)[SGW] ERR: create mbus atomic context failed. [SGW] ERR: failed to add subscription request [SGW] ERR: failed to invoke subscription cmd[SGW] ERR: Subscription failed (no cmddata)[SGW] ERR: Subscription failed (cmddata error: %s) [SGW] ERR: Failed to subscribe PPPStatus. [SGW] ERR: mbus_ccmd_add_getvalues_request(ctx, &ccmd, "%s", "%s") failed: %s[SGW] ERR: mbus command failed: %s[SGW] ERR: mbus command error: %s[SGW] ERR: Failed to get PPPStatus ! [SGW] ERR: gethostbyname(%s) failed. [SGW] ERR: Fatal error: receive mgmt message ! [SGW] ERR: Ignore corrput mgmt message ! [SGW] ERR: Ignore invalid mgmt message ! [SGW] ERR: Dns request for (%s) failed. [SGW] ERR: select error: %s [SGW] ERR: failed to add unsubscription cmd request[SGW] ERR: failed to invoke unsubscription cmd[SGW] ERR: Stopping Resolver because of fatal error ! OutsideAddressOutsideAddressEndInsideAddressInsideAddressEndAccessListEndForeignAddressForeignAddressEndOutsidePortOutsidePortEndInsidePortInsidePortEndWeightPortmapFlagCreatorTypeUPNPServiceManagerALGPortmapModeinboundoutboundPortmapProtocolAnyAHEGPESPGGPGREHMPPUPRDPRSVPVINESXNS-IDP6TO4IPIPPortmapTypenaptNatIntfStatusNATNAT_MBUS[NAT_MBUS]ENVDeviceInfo_Type%sshould not set the system env!%s[DEVINFO_MBUS] %scan not add/del system env%sATOMIC_DEVINFO_PLUGIN%sDeviceInfo enum type registration failed%s%s'%s' registration failed in deviceinfo_atom_mbus_init()%sPeerAuthenticationCheckCertDateCheckCertDomainCertificatePrivateKeyApplication(UTC-12:00) International Date Line West(UTC-11:00) Midway Island, Samoa(UTC-10:00) Hawaii(UTC-09:00) Alaska(UTC-08:00) Pacific Time (US&Canada), Tijuana(UTC-07:00) Arizona(UTC-07:00) Mountain Time (US&Canada)(UTC-07:00) Chihuahua, Mazatlan(UTC-06:00) Central America(UTC-06:00) Central Time (US&Canada)(UTC-06:00) Guadalajara, Mexico City, Monterrey(UTC-06:00) Saskatchewan(UTC-05:00) Bogota, Lima, Quito(UTC-05:00) Eastern Time (US&Canada)(UTC-05:00) Indiana (East)(UTC-04:00) Atlantic Time (Canada)(UTC-04:00) Caracas, La Paz(UTC-04:00) Santiago(UTC-03:30) Newfoundland(UTC-03:00) Brasilia(UTC-03:00) Buenos Aires, Georgetown(UTC-03:00) Greenland(UTC-02:00) Mid-Atlantic(UTC-01:00) Azores, Cape Verde Is.(UTC) Casablanca, Lisbon, Monrovia(UTC) GMT: Dublin, Edinburgh, London(UTC+01:00) Amsterdam, Bern, Rome, Stockholm(UTC+01:00) Belgrade, Berlin, Budapest, Ljubljana(UTC+01:00) Brussels, Copenhagen, Madrid, Paris(UTC+01:00) Bratislava, Prague, Vienna(UTC+01:00) Sarajevo, Skopje, Warsaw, Zagreb(UTC+01:00) West Central Africa(UTC+02:00) Athens, Istanbul, Minsk(UTC+02:00) Bucharest, Cairo(UTC+02:00) Harare, Pretoria(UTC+02:00) Helsinki, Kyiv, Riga, Sofia, Tallinn, Vilnius(UTC+02:00) Jerusalem(UTC+03:00) Baghdad, Kuwait, Riyadh(UTC+03:00) Moscow, St. Petersburg, Volgograd(UTC+03:00) Nairobi(UTC+03:30) Tehran(UTC+04:00) Abu Dhabi, Muscat(UTC+04:00) Baku, Tbilisi, Yerevan(UTC+04:30) Kabul(UTC+05:00) Ekaterinburg(UTC+05:00) Islamabad, Karachi, Tashkent(UTC+05:30) Chennay, Kolkata, Mumbal, New Delhi(UTC+05:45) Katmandu(UTC+06:00) Almaty, Novosibirsk(UTC+06:00) Astana, Dhaka(UTC+06:30) Rangoon(UTC+07:00) Bangkok, Hanoi, Jakarta(UTC+07:00) Krasnoyarsk(UTC+08:00) Beijing, Chongqing, Hong Kong, Urumqi(UTC+08:00) Irkutsk, Ulaan Bataar(UTC+08:00) Kuala Lumpur, Singapore(UTC+08:00) Perth, Taipei(UTC+09:00) Osaka, Sapporo, Tokyo(UTC+09:00) Seoul, Yakutsk(UTC+09:30) Adelaide, Darwin(UTC+10:00) Brisbane(UTC+10:00) Canberra, Melbourne, Sydney(UTC+10:00) Guam, Port Moresby(UTC+10:00) Hobart, Vladivostok(UTC+11:00) Magadan, Solomon Is., New Caledonia(UTC+12:00) Auckland, Wellington(UTC+12:00) Fiji, Kamchatka, Marshall Is.(UTC+13:00) Nuku'alofaDSTStartWeekdayStartHourStartWeekStartMonthEndWeekdayEndHourEndWeekEndMonthTIME_ATOMIC_weekMondayTuesdayWednesdayThursdayFridaySaturdaySundayDateDateTimeLocalTimeZoneLocalTimeZoneNameDaylightSavingsUsedDaylightSavingsStartDaylightSavingsEndDaylightSavingsEnableDaylightSavingsModeAbsoluteTimeSystemUpTimeWeekDayRealTimeClockDST_modeAbsoluteRelativeDST_statusDisable%u:%u%c%u%c%u/%u/%u%c%d-%.2d-%.2dT%.2d:%.2d:%.2d%d%c%u%cInvalid timezone specified. %c%.2ld:%.2ld[TIME_MBUS] [TIMEDST_MBUS] ATOMIC_TIME_PLUGIN%sWeek enum type registration failed%sColorsColorSupportedStatesledstatesSolidFlashSlowFlashFastledcolorsGreenBlueOrangeRedlednamesPower LedInternet LedVoIP LedLan LedWifi LedUpgrade Ledmbusled_atomicencryptEncrypt a clear text password using an internal device-independent key.Clear text password._ENC__DEV_Illegal encrypted password value (truncated ?) %8lx%8lx%nCleartext password too long (max %d chars) ""%8.8lX%8.8lXIllegal encrypted password value ERROR: unable to encrypt password. _CYP__CYP_%sCONF_COND_ENCRYPT0l/dl/seed.dat/etc/passwd/etc/.tmppasswd/bin/shLinux User[PASSWD] failed to delete user (%s) from linux file [PASSWD] failed to set user: (%s) %lu:%lu:%spasw[PASSWD] failed to allocate user database PASWmdapserial%lx:%lx:%lx[PASSWD] failed to open %s for write: %s [PASSWD] failed to open %s. for read: %s [PASSWD] failed to modify linux user %s: unknown group %s [PASSWD] failed to modify linux user %s: gid = %d does not exist [PASSWD] failed to write %s: %s [PASSWD] failed to find name for gid %s: %s [PASSWD] failed to open %s for read: %s [PASSWD] failed to read first entry %s : %s [PASSWD] failed to create user %s: unknown group %s [PASSWD] failed to open %s: %s [PASSWD] failed to create user: gid = %d does not exist [PASSWD] failed to create user %s: login already in use [PASSWD] failed to create user: illegal uid or no uids left [PASSWD] failed to open %s. for append: %s jyjy jy4jyjyar_grpnamelist2mask: failed to construct grpmask for grpname=%s argroup_name2bitnr: failed to find grpname=%s /etc/.tmpgroupargroup_getallgroups: failed to set bitnr=%d related to name=%s in mask argroup_delmember_fromgroups: failed to delete member %s from group zone/etc/group[GROUP] failed to open %s. for write:%s [GROUP] failed to write %s:%s [GROUP] failed to write %s: %s [GROUP] failed to open %s. for read: %s [GROUP] failed to open %s: %s [GROUP] %s: groupname already in use [GROUP} %d: gid has already been allocated [GROUP] failed to open %s. for append: %s [GROUP] failed to sync member=%s for group=%s IPAddressDNS.Server.HostNameCreatormn4mndmn4mnLmnLmnLmnmnLmnmmmmmmm mmmmmm m$mLm8InternetGatewayDevice.X_000E50_OnePhone.UMAGW.nXHnW\nXHnXdnXdnXHnXHnt0ntnu|nv(nv(nt0nt0X_000E50_TimeOfDay.Action.{-5}.SetValue.{-3}.Param.{-1}.Value.ParamName.Object.IDToD.Action.{-5}.SetValue.{-3}.Param.{-1}ParamNumberOfEntriesParamX_000E50_TimeOfDay.Action.{-3}.SetValue.{-1}.OnToD.Action.{-3}.SetValue.{-1}SetValueNumberOfEntriesInactive.Activetod_setvalueSetValueX_000E50_TimeOfDay.Schedule.{-5}.Day.{-3}.TimeRange.{-1}.Action.EndMinute.EndHour.StartMinute.StartHourToD.Schedule.{-5}.Day.{-3}.TimeRange.{-1}TimeRangeNumberOfEntriesInternetGatewayDevice.X_000E50_TimeOfDay.Action.TimeRangeX_000E50_TimeOfDay.Schedule.{-2}.TimeOut.Remaining.NrOfMinutes.ExpireTime.CountToD.Schedule.{-2}.TimeOutX_000E50_TimeOfDay.Schedule.{-3}.Day.{-1}.WeekDayToD.Schedule.{-3}.Day.{-1}TimeOutNumberOfEntries.TimeOutDayNumberOfEntriestod_weekday.DayX_000E50_TimeOfDay.Action.{-1}ToD.Action.{-1}X_000E50_TimeOfDay.Schedule.{-1}.Enable.Mode.FriendlyName.Reference.ScheduleTypeToD.Schedule.{-1}ActionNumberOfEntriesScheduleNumberOfEntriestod_schedmodeInternetGatewayDevice.LANDevice.Hosts.HostAccessControlNonetod_schedtype.ScheduleFAILEDErrorDisabledEnabledtod_statusX_000E50_TimeOfDay.StatusToD, WiFiLAN:1, USBLAN:1, QoS:1, IPPing:1, VoiceService:1.0[1](Endpoint:1, TAEndpoint:1)InternetGatewayDevice:1.3[](%sBaseline:1, EthernetLAN:1, ADSLWAN:1, EthernetWAN:1, Bridging:1, Time:1, DeviceAssociation:1%s%s%s%s)%s%s%sDeviceSummary(== Technology USB)IPPing/dl/pathtype.cfgIGD_plugin%sIGD %s ctx create+register failed %s[IGD-MBUS] IGD_client%sigd objecttype registration failed %s%sigd services registration failed %sWANConnectionNumberOfEntriesWANDeviceWANDeviceNumberOfEntriesATM.Intf.{-1}DSL%smbus object type WANConnectionDevice registration failed%s%smbus object type WANCommonInterfaceConfig registration failed%s%smbus object type WANDSLInterfaceconfig registration failed%s%smbus object type WANDSLLinkConfig registration failed%s%smbus object type WANPPPConnection registration failed%s%smbus object type WANIPConnection registration failed%sHostnameHostNumberOfEntriesdyndns_host_statesClientNumberOfEntriesHiddenInternetGatewayDevice.Services.X_000E50_DynamicDNS.ServiceInternetGatewayDevice.WANDevice.WANConnectionDevice.WANPPPConnectionInternetGatewayDevice.WANDevice.WANConnectionDevice.WANIPConnectiondyndns_errorsdyndns_statesServiceNumberOfEntriesStatDNSCustomDNSGNUDIPX_000E50_DynamicDNSDynDNS.Service.{-1}.Name.Request.ServerPort.UpdateInterval.RetryInterval.MaxRetriesDynDNS.Client.{-1}.Enable.LastError.Offline.UserName.Password.Interface.ServiceDynDNS.Client.{-3}.Host.{-1}.LastUpdateDynDNS.Service.%s.@LowerIntfIP.Intf.(== LowerIntf PPP.Intf.%s)%smbus enum registration failed%s%smbus object type DYNDNS registration failed%s%smbus object type DYNDNS SERVICE registration failed%s%smbus object type DYNDNS CLIENT registration failed%s%smbus object type DYNDNS HOST registration failed%sPPP.Intf.{-1}(== LowerIntf ATM.Intf.{-3}).PPPStatus.UptimeNAT.Intf.(== IPIntf IP.Intf.(== LowerIntf PPP.Intf.{-1})).Status.LastConnectionError.ReceivedLocalAddressENV.(== Name _MACADDR).Value.MRU.PPPoEACName.PPPoEServiceName.DNSMetric.ReceivedRemoteAddress.IdleTimeout.AuthenticationPortMappingPortMappingNumberOfEntriesPortMappingEnabledPortMappingLeaseDurationX_000E50_PortMappingCreatorRemoteHostExternalPortX_000E50_ExternalPortEndInternalPortX_000E50_InternalPortEndPortMappingProtocolInternalClientPortMappingDescriptionwanppp_portmap_protocolwanppp_portmap_creatorLiveZoomWANPPPConnectionNumberOfEntriesConnectionStatusNATEnabledMaxMRUSizeCurrentMRUSizeDNSEnabledDNSOverrideAllowedDNSServersX_000E50_DNSMetricPossibleConnectionTypesConnectionTypeRemoteIPAddressTransportTypeConnectionTriggerIdleDisconnectTimeRSIPAvailablePPPAuthenticationProtocolwanppp_auth_modeMS-CHAPX_000E50_Autowanppp_connection_triggerAlwaysOnManualwanppp_transport_typePPPoEL2TPPPTPwanppp_connection_typeIP_Routedwanppp_lasterrorsERROR_NONEERROR_USER_DISCONNECTERROR_ISP_DISCONNECTERROR_IDLE_DISCONNECTERROR_ISP_TIMEOUTERROR_UNKNOWNERROR_AUTHENTICATION_FAILUREERROR_IP_CONFIGURATIONwanppp_connection_statesNAT.Template.{-1}(or (== IPIntf IP.Intf.(== LowerIntf PPP.Intf.{-3})) (== IPIntfGroup IP.IntfGroup.(== Name wan))).ForeignAddress.OutsidePort.OutsidePortEnd.InsidePort.InsidePortEnd.Protocol.InsideAddress.Description(== IPIntf IP.Intf.(== LowerIntf PPP.Intf.%s))DNS.Server.Route(and (and (and (== IPIntf IP.Intf.(== LowerIntf PPP.Intf.%s)) (== DNSServer %s)) (== Domain )) (== Flags 1))%s,%s%s.IntfPPP.RelayInternetGatewayDevice.WANDevice.%s.WANConnectionDevice.%s.WANPPPConnection.%sInternetGatewayDevice.WANDevice.DSL.WANConnectionDevice.%s.WANPPPConnection.%sPPP.Intf.%s(and (== IPIntf IP.Intf.(== LowerIntf PPP.Intf.%s)) (== Flags 0))IP.Intf.(== LowerIntf PPP.Intf.%s)IP.IntfGroup.(== Name wan)PPP.Intf.%s.Route65535NAT.Template.%s0.0.0.1%swanppp_portmapping_mbus_handler loc_process_portmapfilewall ERR=%d, action type=%d%s[IGD_WANPPPPORTMAP] %swanppp_portmapping_mbus_handler, wancom_add_timerdata failed, ERR=%d%s%swanppp_portmapping_mbus_handler: wancom_pmfw_ttinit failed ERR=%lu%s%swanppp_portmapping_mbus_handler: wancom_delete_timerdata failed ERR=%lu%sWPPS%sWANPM_PPPSEM create failed!%s%smbus wanppp enum registration failed%s%smbus object type Portmapping registration failed%s%swan_pppoaconn_obj_map event register failed%sLANDeviceLANDeviceNumberOfEntriesIP.Intf.{-1}(and (and (!= IntfGroup IP.IntfGroup.(== Name wan)) (!= IntfGroup IP.IntfGroup.(== Name local))) (== Bridged 0))%slandev registration failed%sHosts.Host.{-1}(== IPIntf IP.Intf.{-4})LANDevice.{IPIntf[-1]}.Hosts.Host.{-1}.IPAddress.AddressSource.DHCP.LeaseTimeRemaining.MACAddress.HostName.Type.Active.UserFriendlyName.DHCP.VendorClass.DHCP.ClientID.DHCP.UserClass.LastConnection.CacheControl.DeviceType.DeviceSubType.OSAddressSourceLeaseTimeRemainingHostNameX_000E50_DNSNameInterfaceTypeX_000E50_UserFriendlyNameX_000E50_InterfaceX_000E50_TypeVendorClassClientIDUserClassX_000E50_LastConnectionX_000E50_CacheControlX_000E50_DeviceTypeX_000E50_DeviceSubTypeX_000E50_OSX_000E50_IconX_000E50_MediaRendererCapabilitiesX_000E50_BlackListedX_000E50_InternetAccessScheduleX_000E50_Categoryhost_categoryComputingCommunicationGamesMultiMediaHomeControlMiscellaneousInternetGatewayDevice.X_000E50_TimeOfDay.ScheduleInternetGatewayDevice.UserInterface.X_000E50_RoomInternetGatewayDevice.UserInterface.X_000E50_Servicehost_typeLayer2-FXSLayer2-USBLayer2-BluetoothLayer3-IPLayer7-UPNPhost_intftype802.11HomePNAHomePlugHostsL2-FXSL2-USBL2-BluetoothL3-IPL7-UPNPHosts.Host.%s(and (== Creator 0) (== IPAddress %s))DNS.Server.HostName,CreatorBTLANDevice.%s.Hosts.Host%sHost eventing for '%s' failed%s%sIP address update for DNS server host entry failed, rc is %s%s%sobjecttype '%s' registration failed%s%sobjecttype addition of event mapping failed%sHosts.HostLANEthernetInterfaceConfig.{-1}LANEthernetInterfaceNumberOfEntriesMACAddressControlEnabledDuplexModeIGD_lanEthCfg_DuplexModeHalfFullIGD_lanEthCfg_MaxBitRate1001000IGD_lanEthCfg_StatusNoLinkETH.Phys.{-2}.Stats.BytesSent.BytesReceived.PacketsSent.PacketsReceivedETH.Phys.%s(== Name _MACADDR)IP.Intf.%sBridge.%s'%s' enum type registration failed%s[IGD_LANETHCFG_MBUS]%s'%s' addition of event mapping failed%s.AutoSave.ConfigLoadFileName.ConfigLoad.ConfigLoaded.ConfigSaveFileName.ConfigSave.ConfigSaveAsync.ConfigSaved.FactoryDefaults.RebootDelay.Reboot.UpgradeX_000E50_AutoSaveX_000E50_ConfigLoadFileNameX_000E50_ConfigLoadX_000E50_ConfigLoadedX_000E50_ConfigSaveFileNameX_000E50_ConfigSaveAsyncX_000E50_ConfigSavedX_000E50_RebootDelayX_000E50_Upgrade%s%s type registration failed%s%s%s addition of event mapping%sDHCPStaticAddressDHCPStaticAddressNumberOfEntriesChaddrYiaddrDHCPOptionDHCPOptionNumberOfEntriesDHCPConditionalServingPoolDHCPConditionalServingNumberOfEntriesChaddrMaskMinAddressMaxAddressDomainNameIPRoutersDHCPLeaseTimePoolOrderLANHostConfigManagementDHCPServerEnableDHCPRelayDHCPConditionalServingDHCPServerConfigurableReservedAddressesAllowedMACAddressesUseAllocatedWANUseAllocatedSubnetPassThroughDHCP.Server.@Instance.@TemplateName.OptionIDDHCP.Server.Pool.{-1}(== IPIntf IP.Intf.{2}).MinAddress.MaxAddress.SubnetMask.DomainName.LeaseTimeDHCP.Server.Pool.{-3}.Option.{-1}DHCP.Server.Lease.{-1}(and (and (== Reserved 1) (== ExpirationTime 0)) (or (== DHCPServerPool DHCP.Server.Pool.{-3}) (== PoolReference DHCP.Server.Pool.{-3})))IP.Intf.{-3}%s.ACL.MACPermissionallowdenyUCIRuleName%s_default%s.RuleRuleTypeMACExcludeoptionDHCP.Rule(clientid)%s(ascii)%sMatchExactSubstringDHCP.Rule.%s%sigd dhcpservp processing cmds failed.%s_defaultDHCP.Server.Pool.%sMACMaskDHCP.Server.Lease.(and (or (== MACAddress %s) (== IPAddress %s)) (and (== Reserved 1) (== ExpirationTime 0)))DHCP.Server.Lease.(and (and (and (== MACAddress %s) (== IPAddress %s)) (or (== DHCPServerPool DHCP.Server.Pool.%s) (== PoolReference DHCP.Server.Pool.%s))) (or (== Reserved 0) (!= ExpirationTime 0)))ReservedExpirationTimeDHCP.Server.Lease(or (== MACAddress %s) (== IPAddress %s))(and (and (== Reserved 1) (== ExpirationTime 0)) (or (== DHCPServerPool %s) (== PoolReference %s)))%sigd lanhostcfgmgmt DHCPStaticAddr processing cmd (%s) failed.%s%sigd dhcpservp DHCPStaticAddr processing cmd (%s) failed.%sDHCP.Server.Option.TemplateOptionIDDHCP.Server.Option.InstanceTemplateNamebyte_arrayInstanceEnterpriseSubOption8-bit16-bit32-bitasciiclientid%s.FieldDHCP.Server.Option.Instance.%s%s.Option.%s.Option.{-1}%sigd lanhostcfgmgmt DHCPOption processing cmd (%s) failed.%sDHCP.Server.Pool.%s.Option.%s%sigd dhcpservp DHCPOption processing cmd (%s) failed.%s%sRegistering LANHostConfigMgmt enum type failed.%s%sRegistering LANHostConfigMgmt failed.%s%sRegistering LANHostConfigMgmt.DHCPOption failed.%s%sRegistering LANHostConfigMgmt.DHCPStaticAddress failed.%s%sRegistering DHCPConditionalServingPool failed.%s%sRegistering DHCPConditionalServingPool.DHCPOption failed.%s%sRegistering DHCPConditionalServingPool.DHCPStaticAddress failed.%sIPInterfaceNumberOfEntriesIPInterfaceIPAddressIPInterfaceSubnetMaskIPInterfaceAddressingTypeStaticAutoIPIP.Intf.{2}.Addr.{-1}%sigd ipintf processing cmds failed.%s%sRegistering ipintf enum type failed.%s%sRegistering ipintf_obj failed.%sInternetGatewayDevice.WANDevice.DSL.WANCommonInterfaceConfig.UpstreamMaxRate.DownstreamMaxRateActiveConnectionDeviceContainerActiveConnectionServiceIDInternetGatewayDevice.WANDevice.WANConnectionDeviceEnabledForInternetWANAccessTypeLayer1UpstreamMaxBitRateLayer1DownstreamMaxBitRatePhysicalLinkStatusMaximumActiveConnectionsNumberOfActiveConnectionsETHERNETPOTS(== ConnectionStatus Connected)WANDevice.%s.WANConnectionDevice.%s.%s%s-%s-%s%sigd WANCommonIntfCfg processing cmds failed.%sTotalPacketsSentTotalPacketsReceivedWANDevice.%s.WANConnectionDeviceUnlinked%s.WANConnectionDevice%s.WANConnectionDevice.%s.WANIPConnection%s.WANConnectionDevice.%s.WANPPPConnection%s.WANConnectionDevice.%s%s.WANConnectionDevice.%s.WAN%sConnection.%s%sRegistering wan_common_intf enum type failed.%s%sRegistering wan_commintf_obj failed.%s%sRegistering wan_commintfconn_obj failed.%s%sRegistering wan_commintfconn_obj event mapping failed.%sIP.FIB.{-1}(!= Interface IP.Intf.(== IntfGroup IP.IntfGroup.(== Name local)))Forwarding.{-1}.DestIPAddress.DestSubnetMask.GatewayIPAddress.ForwardingMetricForwardNumberOfEntriesInternetGatewayDevice.LANDeviceLayer3ForwardingDefaultConnectionServiceInternetGatewayDevice.LANDevice.%sIP.FIB.(== DestIPAddress 0.0.0.0)IP.FIB.%s%smbus object type 'Layer3Forwarding' registration failed%s%smbus object type 'Forwarding' registration failed%s%smbus object type addition of event mapping%sManagementServer.Server.URL.Server.Username.Server.Password.PeriodicInform.PeriodicInformInterval.PeriodicInformTime.RunTimeVar.ParameterKey.ConnectionRequestURL.ConnRequestUsername.ConnRequestPassword.UpgradesManaged.SessionStatus.ConnRequestThrottleNumber.ConnRequestThrottleTime.RequestDownloadFileType.RequestDownloadArgName.RequestDownloadArgValue.RequestDownloadTriggerPeriodicInformEnableConnectionRequestUsernameConnectionRequestPasswordX_000E50_StatusX_000E50_ConnReqThrotNumberX_000E50_ConnReqThrotTimeX_000E50_ReqDownFileTypeX_000E50_ReqDownArgNameX_000E50_ReqDownArgValueX_000E50_ReqDownTriggercwmp_requestdownload_filetypescwmp_session_statustypes%sRegistering Enum types failed.%s%s%s registration failed (%s) %s[ManagementServer] %s%s addition of event map failed (%s) %sManageableDevicePreSharedKeyKeyPassphraseAssociatedDeviceMACAddressWEPKeyAssociatedDeviceTotalAssociationsAssociatedDeviceIPAddressAssociatedDeviceAuthenticationStateLastRequestedUnicastCipherLastRequestedMulticastCipherLastPMKIdLANWLANConfigurationNumberOfEntriesPairingTimeChannelX_000E50_ChannelModeBeaconTypeStandardWEPKeyIndexWEPEncryptionLevelBasicEncryptionModesBasicAuthenticationModeWPAEncryptionModesWPAAuthenticationModeIEEE11iEncryptionModesIEEE11iAuthenticationModePossibleChannelsBasicDataTransmitRatesOperationalDataTransmitRatesPossibleDataTransmitRatesInsecureOOBAccessEnabledBeaconAdvertisementEnabledRadioEnabledAutoRateFallbackEnabledLocationDescriptionTotalPSKFailuresTotalIntegrityFailuresChannelsInUseDeviceOperationModeDistanceFromRootPeerBSSIDAuthenticationServiceModeTotalBytesSentTotalBytesReceivedwlancfg_WPAAuthenticationMode_typesPSKAuthenticationEAPAuthenticationwlancfg_WPAEncryptionMode_typesTKIPEncryptionAESEncryptionTKIPandAESEncryptionwlancfg_basicAuthenticationMode_typeswlancfg_basicEncryptionMode_typesWEPEncryptionwlancfg_standard_typesb+gwlancfg_beacon_typesBasicWPA11iWPAand11iwlancfg_channelmode_typewlancfg_status_typeWLAN.Intf.{-1}.BSSID.PairingTime.Channel.ChannelMode.SSID.InteropMode.BasicRateSet.RateSet.AnySSID.Stats.TotalBytesSent.Stats.TotalBytesReceived.Stats.ValidPacketsSent.Stats.ValidPacketsReceivedWLAN.Intf.wl0.Station.{-1}WLANConfiguration.{-3}.AssociatedDevice.{-1}WLAN.Intf.{-3}.Station.{-1}.MACAddressWLAN.Intf.{-3}.Station.{-1}.FlagsWLAN.Intf.{-3}.Station.{-1}.RSSIWLAN.Intf.{-3}.Security.WEP.WEPKeyWLAN.Intf.{-3}.Security.WPAPSK802.11a802.11b802.11g802.11b/gWPA-PSK.Security.WPAPSK.WPAVersion.Security.WPA.WPAVersion.Security.ModeWPA+WPA2.ACL.ControlunlockDisabled,40-bit,104-bit.Security.WPAPSK.Encryption.Security.WPAPSK.PSK.Security.WPA.EncryptionTKIPAES.LocaleUSAUSALow1,2,3,4,5,6,7,8,9,10,11ThailandJapanJapanHigh1,2,3,4,5,6,7,8,9,10,11,12,13,141,2,3,4,5,6,7,8,9,10,11,12,13InfrastructureAccessPointRadiusClientTKIP+AESdummy%ddummyx%s%s: mbus enum registration failed%s%smbus object type '%s' registration failed%s%smbus event mapping registration failed%s(and (== IPIntf IP.Intf.%s) (== Flags 0))Unconfigured, IP_RoutedDHCPClientwanip_portmap_protocolwanip_portmap_creatorWANIPConnectionNumberOfEntriesAddressingTypeDefaultGatewayRouteProtocolRxwanip_route_protocolrxRIPv1RIPv2wanip_connection_triggerwanip_lastconnection_errorwanip_connection_typewanip_addressingtype_statuswanip_connection_statusDSL.UptimeNAT.Intf.(== IPIntf IP.Intf.{-1}).Status.Addr.(!= IPAddress 0).IPAddress.Addr.(!= IPAddress 0).SubnetMaskIP.FIB.(== DestIPAddress 0.0.0.0).GatewayIPAddress.Addr.(!= IPAddress 0).PointToPointDHCP.Client.Intf.(== IPIntf IP.Intf.{-1}).StatusDHCP.Client.Intf.(== IPIntf IP.Intf.{-1}).Uptime(or (== IPIntf IP.Intf.{-3}) (== IPIntfGroup IP.IntfGroup.(== Name wan)))INITREBOOTREBOOTINGSELECTINGREQUESTINGIP.Intf.%s.AddrDHCP.Client.IntfDHCP.Client.Intf.(== IPIntf IP.Intf.%s)IP.FIB.(and (== DestIPAddress 0.0.0.0) (== Interface IP.Intf.%s))(== IPIntf IP.Intf.%s)%s.TxOptions(== Option %d)606177%smbus_ccmd_add_getnames_request return error!%s[IGD_DHCP_CLIENT]%sloc_dhclient_set_and_get_object, rc = %d%s[IGD_WANIPPORTMAP] DHCP.ClientWANConnectionDevice.%s.WANIPConnection.%s%s.@IntfGroupIP.Intf.(== LowerIntf ATM.Intf.%s)%smbus object type WANIPConnection subobjects registration failed%sDestinationIterfaceExcludeFirewall.Chain.{-1}InternetGatewayDevice.X_000E50_Firewall.Chain.{-1}RuleNumberOfEntriesSourceIPDestinationIPDestinationIPMaskDestinationIPExcludeSourceInterfaceSourceInterfaceExcludeDestinationInterfaceDestinationInterfaceExcludeDestinationPortRangeEndDestinationPortExcludeSourceMACAddressSourceMACMaskSourceMACExcludeInternetGatewayDevice.X_000E50_Firewall.ChainIGD_Firewall_Rule_TargetUserChainIGD_Firewall_Rule_statusChainNumberOfEntriesIGD_Firewall_Chain_TypeLevelNumberOfEntriesRespondToPingIGD_Firewall_DefaultPolicyX_000E50_FirewallInternetGatewayDevice.X_000E50_Firewall.LevelIGD_Firewall_UDPTrackModeStrictIGD_Firewall_TCPCheckFast.SelectedLevelFirewall.Level.{-1}.Index.ReadOnly.DefaultPolicyFirewall.Chain.{3}.Rule.{-1}Firewall_IGD_ClientInternetGatewayDevice.X_000E50_Firewall.Chain.(== Name FORWARD_level)Firewall.Level.%sFirewall.Chain.%s.Rule.%sFirewall.Chain.%s.Rule%s.Expr%sloc_rule_addobj, loc_rule_atomicpath failed%s%sloc_rule_delobj, loc_rule_atomicpath failed%s[IGD_FW_MBUS]%sloc_rule_getobj, loc_rule_atomicpath failed%s%sloc_rule_setobj, loc_rule_atomicpath failed%s%s'%s' registration failed in Firewall_igd_mbus_init()%s%sigd_subscribe_1to1_firewall failed !, error = %s%sNATAppList.App.{4}.Rule.{-1}Services.X_000E50_NATApplicationList.Application.{2}.Rule.{4}.InboundPort.OutboundPort.OutboundPortRangeEndNATAppList.App.{-1}Services.X_000E50_NATApplicationList.Application.{-1}.HostIPAddressExternalPortRangeEndApplicationNumberOfEntriesX_000E50_NATApplicationList%sigd Application processing cmds failed.%s%sigd Application->Rule processing cmds failed.%s%sRegistering X_000E50_NATApplicationList object failed.%s%sRegistering Application object failed.%s%sRegistering Application->Rule object failed.%s%sRegistering event mapping failed.%sWANDSLLinkConfigATMPeakCellRateATMMaximumBurstSizeATMSustainableCellRateAutoConfigwandsllc_modulationtypeADSL_G.dmtADSL_G.liteADSL_G.dmt.bisADSL_re-adslADSL_2plusADSL_fourADSL_ANSI_T1.413G.shdslIDSLHDSLSDSLVDSLwandsllkcfg_conformancewandsllkcfg_encapstypeIGD_wandsllc_linkStatuswandsllkcfg_linktypeEoACIPATM.Intf.{-2}InternetGatewayDevice.WANDevice.DSL.WANConnectionDevice.{-1}.WANDSLLinkConfig.LinkType.DestinationAddress.ATMEncapsulation.MultiPriorityQueues.FCSPreservedDSL.ModulationTypePVC: %s[IGD_DSL_LINKCONFIG] %sWANDSLLinkConfig registration failed%sVendorConfigFileVendorConfigFileNumberOfEntriesDeviceInfoManufacturerManufacturerOUIModelNameProductClassSerialNumberHardwareVersionModemFirmwareVersionAdditionalHardwareVersionSpecVersionProvisioningCodeUpTimeX_000E50_CountryX_000E50_SIMLockedX_000E50_SIMUnLockX_000E50_FTSoftwareVersionX_000E50_RescueVersionX_000E50_RescueActiveDeviceInfo_CountryfruknlbeENV.(== Name _COMPANY_NAME).ValueENV.(== Name _OUI).ValueENV.(== Name _PROD_MODEL_NAME).ValueENV.(== Name _PROD_DESCRIPTION).ValueENV.(== Name _PROD_CLASS).ValueENV.(== Name _PROD_SERIAL_NBR).ValueENV.(== Name _HW_VERSION).ValueENV.(== Name _SoftwareVersion).ValueENV.(== Name _MODEMLABEL).ValueENV.(== Name _PROD_ID).ValueENV.(== Name CONF_PROVIDER).ValueTime.SystemUpTimeENV.(== Name FT_COUNTRY).ValueENV.(== Name _FTSoftwareVersion).ValueENV.(== Name _RescueVersion).ValueENV.(== Name _RescueActive).ValueENV.(== Name CONF_SERVICE).ValueENV.(== Name CONF_VERSION).ValueENV.(== Name CONF_DATETIME).ValueENV.(== Name CONF_DESCRIPTION).Value(== Name _VARIANT_ID)(== Name _RescueVersion)(== Name _SoftwareVersion)AANT-C(== Name CONF_PROVIDER)w+Z=%s%sigd deviceinfo enum type registration failed%s[IGD_DEVINFO_MBUS]%s'%s' registration failed in devinfo_mbus_init()%sNTPServer1NTPServer2NTPServer3NTPServer4NTPServer5CurrentLocalTimeX_000E50_WeekDayX_000E50_EnableX_000E50_NTPRequestIntervalTIME_IGD_weekNTP.Server.{i}.NTPServer.DateTime.WeekDay.LocalTimeZone.LocalTimeZoneName.DaylightSavingsEnable.DaylightSavingsStart.DaylightSavingsEndNTP.EnableNTP.PollIntervalNTP.Server%sWeek enum type registration failed%s%s'%s' registration failed in time_mbus_init()%sUsers.Group.{-3}.User.{-1}X_000E50_AccessRights.Group.{-3}.User.{-1}.UserUsers.Group.{-1}X_000E50_AccessRights.Group.{-1}.GID.MaskPos.ParentUsers.User.{-1}X_000E50_AccessRights.User.{-1}.Hash2.AdminGroup.UID.Crypt.HomeDir.LoginShellInternetGatewayDevice.X_000E50_AccessRights.UserInternetGatewayDevice.X_000E50_AccessRights.GroupX_000E50_AccessRights%smbus event mapping for '%s' registration failed%sCellsSentCellsReceivedLANUSBInterfaceConfigLANUSBInterfaceNumberOfEntriesEnumLanUsbIntfConfPowerSelfBusEnumLanUsbIntfConfRateEnumLanUsbIntfConfTypeHubEnumLanUsbIntfConfStatus.StatsIP.Intf.(== LowerIntf ATM.Intf.%s).Addr.(!= IPAddress 0)IPPing.Test.IGDPing.IPIntf.Count.Timeout.Size.SuccessCount.FailureCount.AvgResponseTime.MinResponseTime.MaxResponseTimeIPPingDiagnosticsNumberOfRepetitionsDataBlockSizeSuccessCountFailureCountAverageResponseTimeMinimumResponseTimeMaximumResponseTimeInternetGatewayDevice.LANDevice.LANHostConfigManagement.IPInterfaceIppingDiagnosticsStatusError_CannotResolveHostNameError_InternalError_OtherIPPing.Test.(== Name IGDPing)SrcIPAddressIP.Intf.%s.Addr.(== IPAddress %s)InternetGatewayDevice.LANDevice.%s.LANHostConfigManagement.IPInterface.%sPPP.Intf.(== LowerIntf PPP.Relay.%s)PPP.Intf.(== LowerIntf ATM.Intf.%s))PPP.Intf.(== LowerIntf ETH.Intf.(== LowerIntf ATM.Intf.%s))IP.Intf.%s.Addr.%sIPPing.Test192.168.1.64%sigd ippingdiagnostics processing cmds failed.%s%sRegistering ippingdiagnostics object failed.%s%sRegistering ippingdiagnostics event mapping failed.%sX_000E50_RemoteAccessrad_igd_modetypesrad_igd_statustypes.URL.Secure.Port.ElapsedTime.Mode.RandomPassword.RandomPort.Group.Start%s%s enumtypes registration failed (%s) %s[RAD] WANEthernetInterfaceConfigMaxBiteRateWANETHIntfDulxModeWANETHIntfMaxBitRateWANETHIntfStatETH.Phys.{2}InternetGatewayDevice.WANDevice.{-1}.WANEthernetInterfaceConfig.@Reference.Type.Stats.BytesSent.Stats.BytesReceived.Stats.PacketsSent.Stats.PacketsReceivedBaseTFDBaseTHD%sRegistering WANEthernetInterfaceConfig enum type failed.%s%sRegistering WANEthernetInterfaceConfig object failed.%s%sRegistering WANEthernetInterfaceConfig.Stats object failed.%sUserInterface[UserInterface] %sloc_set_firewallrule_parameter, loc_create_portmapfilewall_expr ERR=%d%s%sloc_set_firewallrule_parameter, loc_update_firewallrule_expr ERR=%d%s%sloc_set_firewallrule_parameter, loc_set_portmapfilewall_expr ERR=%d%sPMTSPMTMpm_timerExpr_FWSIFExpr_FWSRVExpr_FWDSTIPExpr_FWSRCIPFORWARD_portmapping_ruleINPUT_portmapping_ruleINPUT_portmappingFORWARD_upnpDSLTypeVDSL2(== Technology DSL)(== LowerIntf %s)%s.Intf.%sBridge.%sPPP.Relay.%s%sfailed to get %s.%s (%s)%s%sinvalid value %s.%s='%s' (%s)%s%sloc_create_portmapfilewall_expr, INPUT PARAMATERS ERR%s[IGD_WANCOMPORTMAP] %sloc_create_portmapfilewall_expr, ERR enParamType=%d%s%sloc_create_portmapfilewall_expr, mbus_ccmd_add_addobject_request ERR=%d%s%sloc_create_portmapfilewall_expr, mbus_invoke_ccmd ERR=%d%s%sloc_create_portmapfilewall_expr, tmp_data->error=%d%s%sloc_set_portmapfilewall_expr, INPUT PARAMATERS ERR%s%sloc_set_portmapfilewall_expr, mbus_ccmd_add_setvalues_request ERR=%d%s%sloc_set_portmapfilewall_expr, mbus_invoke_ccmd ERR=%d%s%sloc_search_firewallrule_expr, input parameters error%sExpr.IPADDR.(== Name %s_%s)Expr.Serv.(== Name %s_%s)Expr.Intf.(== Name %s_%s)%sGo out loc_search_firewallrule_expr, type error=%d%s%sloc_search_firewallrule_expr, NOT found firewall rule expr for PMkey=%s%s%sloc_update_firewallrule_expr, input parameters err%s%sloc_update_firewallrule_expr, mbus_ccmd_add_setvalues_request ERR=%d%s%sloc_update_firewallrule_expr, mbus_invoke_ccmd add ERR=%d%s%sloc_update_firewallrule_expr, add tmp_data->error=%d%s%sloc_update_firewallrule_expr, type error=%d%s%sloc_create_portmapfilewall_rule, INPUT PARAMATERS ERR%s%sloc_create_portmapfilewall_rule, enChainType type ERR enChainType=%d%s%sloc_create_portmapfilewall_rule, mbus_ccmd_add_addobject_request ERR=%d%s%sloc_create_portmapfilewall_rule, mbus_ccmd_add_setvalues_request ERR=%d%s%sloc_create_portmapfilewall_rule, mbus_invoke_ccmd ERR=%d%s%s.Rule.%s%sloc_create_portmapfilewall_rule, tmp_data->error=%d%s%sloc_search_portmapfilewall_rule, INPUT PARAMATERS ERR%s(== Description %s_%s)%sloc_search_portmapfilewall_rule, ChainRuleDesc=%s%s%sloc_search_portmapfilewall_rule, NOT found pcFWChainRulePath%s%sloc_delete_portmapfilewall_obj, INPUT PARAMATERS ERR%s%sloc_delete_portmapfilewall_obj, mbus_ccmd_add_delobject_request ERR=%d%s%sloc_delete_portmapfilewall_obj, mbus_invoke_ccmd delete ERR=%d%s%sloc_set_firewallrule_parameter, INPUT PARAMATERS ERR%s%sloc_set_firewallrule_parameter, ERR enParamType=%d%s%sloc_set_firewallrule_parameter, loc_search_firewallrule_expr ERR=%d%s%sloc_update_portmapfilewall_rule, INPUT PARAMATERS ERR%s%sloc_search_portmapfilewall_chain, INPUT PARAMATERS ERR: pointer is null%sFirewall.Chain.(== Name %s)%sloc_create_portmapfilewall_chain, INPUT PARAMATERS ERR: pointer is null%s%sloc_create_portmapfilewall_chain, mbus_ccmd_add_setvalues_request(Firewall.Chain.Name) ERR=%d%s%sloc_create_portmapfilewall_chain, mbus_invoke_ccmd ERR=%d%s%sloc_create_portmapfilewall_chain, tmp_data->error=%d%s%sloc_create_portmapfilewall_chain, chain not founded name=%s%s%sloc_create_portmapfilewall_chain, mbus_ccmd_add_addobject_request ERR=%d%sFor NAT portmapping%sloc_create_portmapfilewall_chain, mbus_ccmd_add_setvalues_request INPUT,FORWARD ERR=%d%s%sloc_create_portmapfilewall_chain, mbus_invoke_ccmd INPUT,FORWARD ERR=%d%s%sloc_process_portmapfilewall, INPUT PARAMATERS ERR: pointer is null%s%sloc_search_portmapfilewall_chain, enChainType=%d return ERR=%d%s%sloc_create_portmapfilewall_chain, enChainType=%d, return ERR=%d%s%sloc_create_portmapfilewall_rule, return ERR=%d%s%sloc_update_portmapfilewall_rule, return ERR=%d%s%sloc_search_portmapfilewall_rule, return ERR=%d%s%sloc_process_portmapfilewall loc_delete_portmapfilewall_obj, return ERR=%d%s%swancom_pmtimer_compare, parameter ERR%s%swancom_add_timerdata: INV PARAM%sWPTN%swancom_add_timerdata xm_alloc NORESOURCES%s%swancom_add_timerdata xm_alloc ERR=%d%s%swancom_add_timerdata, llist_addobject to Timer list, ERR=%d%s%swancom_delete_timerdata: INV PARAM%s%swancom_delete_timerdata, Timer list llist_remove_byobject, ERR=%d%s%swancom_delete_timerdata, Timer xm_dealloc, ERR=%d%s%swancom_get_timerdata: INV PARAM%s%swancom_get_timerdata, GET llist_searchobject TimerData NOT FOUND%s%swancom_pmleasetime_timerinit: timer %s create failed!%s%swancom_pmleasetime_taskinit: task %s create failed!%s%swancom_pmleasetime_taskinit: %s task event create failed!%s%swancom_pmleasetime_taskinit: task %s start failed!%s%swancom_pmfw_taskdelpm: INV PARAM%sInternetGatewayDevice.WANDevice.%s.WANConnectionDevice.%s.%s.%s.PortMapping.%s%swancom_pmfw_taskdelpm, mbus_ccmd_add_delobject_request ERR=%d%s%swancom_pmfw_decrement: INV PARAM%s%swancom_pmfw_decrement: ADD del request %s PortMapping failed, ret=%lu%s%swancom_pmfw_leasetimetask: wancom_pmfw_decrement WANPPPConnection, ERR=%d!%s%swancom_pmfw_leasetimetask: wancom_pmfw_decrement WANIPConnection, ERR=%d!%s%swancom_pmfw_leasetimetask: get writelock failed ERR=%lu%s%swancom_pmfw_leasetimetask: xev_receive ERR=%d!%s%swancom_pmfw_ttinit: IGD Ctx %s creating failed!%s%swancom_pmfw_ttinit, wancom_pmleasetime_taskinit failed, ERR=%d%s%swancom_pmfw_ttinit, wancom_pmleasetime_timerinit failed, ERR=%d%sdhcp_base64_option_dataIGDPLUGIN (DHCP option base64)dhcpoption_base64.coption data pool allocation faileddhcp_base64_enterpriseenterprise item pool allocation faileddhcp_base64_packetpacket pool allocation failedUMAGWumagw_statusunresolvedresolvedX_000E50_OnePhone%smbus object type OnePhone registration failed%s%smbus object type OnePhone UMAGW registration failed%s%smbus object type OnePhone UMAGW IP registration failed%s%smbus object UMAGW successfully registered%s.IP%sUMAGW: eventing for '%s' failed%s%sUMAGW: eventing for status failed.%sX_000E50_PhoneRingTestIGD_Service_Voice_Ringtest_Status.RingDuration.DisplayText.RunTestPhyPortInterfaceIDVoice.Ports.{-1}.NumberVoice.CallLog.{-1}InternetGatewayDevice.Services.VoiceService.1.X_000E50_SessionLog.{-1}.CallID.Caller.Called.Direction.Media.StartTime.Duration.StatusTimestamp.NumbRxPackets.NumbRxBytes.NumbTxPackets.NumbTxBytes.NumbLostPackets.AvgJitter.MaxJitter.MediaDuration.CodecX_000E50_SessionLogSessionStartTimeSessionDurationLineInternetGatewayDevice.Services.VoiceService.Capabilities.CodecsInternetGatewayDevice.Services.VoiceService.PhyInterfaceH235AuthenticationMethodsIGD_Service_Voice_Capabilities_Mgcp_H235_AuthTBDVoice.Profile.{-2}.IDX_000E50_SecGatekeeperX_000E50_SecGatekeeperPortX_000E50_SecGatekeeperIDTimeToLiveH235AuthenticationAuthPasswordSendersIDDSCPMark.H323.RAS.PrimGKAddress.H323.RAS.PrimGKPort.H323.RAS.PrimGKID.H323.RAS.SecGKAddress.H323.RAS.SecGKPort.H323.RAS.SecGKID.H323.RAS.TTL.H323.H235.Enable.H323.H235.PrimGKPassword.H323.H235.SenderID.QoS.(== Type Signaling).DSCPInternetGatewayDevice.Services.VoiceService.1.PhyInterface.%sVoice.Ports.%sInternetGatewayDevice.Services.VoiceService.1.Capabilities.Codecs.%sVoice.Codec.%s%sigd mbus object type VoiceProfile.MGCP registration failed%s%sigd mbus object type Line.H323 registration failed%s%sigd mbus object type Capabilities.H323 enumeration registration failed%s%sigd mbus object type Capabilities.H323 registration failed%s%sigd mbus object type Line.Session registration failed%s%sigd mbus X_000E50_SessionLog enumeration registration failed%s%sigd mbus object type X_000E50_SessionLog registration failed%s%sigd mbus event mapping X_000E50_SessionLog failed%s%sigd mbus object type VoiceService.PhyInterface registration failed%s%sigd mbus VoiceService.X_000E50_PhoneRingTest enumeration registration failed%s%sigd mbus object type VoiceService.X_000E50_PhoneRingTest registration failed%sCodecsEntryIDBitRatePacketizationPeriodSilenceSuppressionG.711MuLawG.711ALawG.729aG.729eG.728G.723.1G.722.1G.722.2GSM-FRGSM-HRGSM-EFRiLBCCapabilitiesMaxProfileCountMaxLineCountMaxSessionsPerLineMaxSessionCountSignalingProtocolsRegionsRTCPSRTPRTPRedundancyDSCPCoupledEthernetTaggingCoupledPSTNSoftSwitchOverFaxT38FaxPassThroughModemPassThroughToneGenerationRingGenerationDigitMapNumberingPlanButtonMapVoicePortTestsX_000E50_CodecOfferIGD_Services_VoiceService_Capabilities_X_000E50_CodecOfferAutoFRAutoUKIGD_Service_Voice_Signaling_Protocol.Services.Service.(== Name 3pty).StatusENV.(== Name _BOARD_NAME).Value.SignalingVoice.Codec.{-1}.PTimeetsiaustraliaAUbelgiumBEdenmarkDKfrancefrance1france2france3italynetherlandsNLnorwaynorthamericaspainESswedenBANT-SBANT-RBANT-8Voice.CountriesVoice.Countries.Country.%d%svoicecap enum types registration failed%s%svoicecap root objecttype registration failed%s%svoicecap protocol objecttype registration failed%s%svoicecap codec objecttype registration failed%s%smbus igd object type VoiceServices.Capabilities successfully registered%sVoiceServiceX_000E50_VOIPAAD%smbus object type VoiceServices registration failed%s%svoiceserv X_000E50_SessionLog objecttype registration failed%s%smbus object type VoiceServices successfully registered%sVoice.Countries.Country.(== Name %s)InternetGatewayDevice.Services.VoiceService.1.VoiceProfile.1.DigitRelay.Countries.SelectedCountry.AutoFXOVoice.Profile.{-1}InternetGatewayDevice.Services.VoiceService.1.VoiceProfile.1.Line.{-1}.CallState.Timestamp.VoicePortVoice.DialPlan.{-1}InternetGatewayDevice.Services.VoiceService.1.VoiceProfile.1.NumberingPlan.PrefixInfo.{-1}.Prefix.MinDigits.MaxDigits.RemNumDigits.PosOfModify.ActionVoiceProcessingEchoCancellationEnableEchoCancellationTailCallingFeaturesCallerIDEnableCallerIDNameEnableCallWaitingEnableMaxSessionsCallForwardUnconditionalEnableCallForwardUnconditionalNumberCallForwardOnBusyEnableCallForwardOnBusyNumberCallForwardOnNoAnswerEnableCallForwardOnNoAnswerNumberCallTransferEnableMWIEnableAnonymousCalEnableCallReturnEnableDirectoryNumberX_000E50_TimestampPhyReferenceListLineCallStateLineStatusTestingQuiescentHighSpeedRedundancyLowSpeedRedundancyPrefixInfoPrefixInfoNumberOfEntriesPrefixRangePrefixMinNumberOfDigitsPrefixMaxNumberOfDigitsNumberOfDigitsToRemovePosOfDigitsToRemoveFacilityActionPrefixInfoMaxEntriesRTPLocalPortMinLocalPortMaxVoiceProfileVoiceProfileNumberOfEntriesNumberOfLinesSignalingProtocolDTMFMethodDTMFMethodG711RegionPSTNFailOverIgdVoiceSignalingProfileEnableConferenceCallingStatusSecondaryRingingSecondaryConnectingSecondaryConnectedInConferenceCallCallWaitingStatusLineEnableSIPServer.InternalUA.{-1}.AORSIPServer.ExternalUA.{-1}SIPServer.RTPPort.RTPPortRangeEndVoice.QoS.(== Type Realtime).DSCPSIPServer.DialPlan.{-1}.MinimumDigits.MaximumDigitsVoice.Fax.Transport.UDPTLRedunVoice.Services.Service.(== Name clir).Status.Service.(== Name waiting).StatusVoice.Profile.{7}.VoicePort.Service.(== Name cfu).Status.CFUDestination.Service.(== Name cfbs).Status.CFBSDestination.Service.(== Name cfnr).Status.CFNRDestination.Service.(== Name transfer).Status.MWIPhone.Service.(== Name callreturn).Status.VAD.PriorityInBandRFC2833SystemServices.(== Name VOIP_H323) t38Voice.Profile.%sdefault_id%svoiceprof enum types registration failed %s%svoiceprof root objecttype registration failed%s%svoiceprof rtp objecttype registration failed%s%svoiceprof numberplan objecttype registration failed%s%svoiceprof numberplan prefix objecttype registration failed%s%svoiceprof faxt38 objecttype registration failed%s%svoiceprof lineroot objecttype registration failed%s%svoiceprof protocol objecttype registration failed%s%svoiceprof line callfeatures objecttype registration failed%s%svoiceprof line voiceprocessing objecttype registration failed%s%svoiceprof line codec objecttype registration failed%s%svoiceprof line codeclist objecttype registration failed%s%svoiceprof line session objecttype registration failed%s%smbus object type voiceprofile successfully registered%sLinkRetrainATUCFECErrorsATUCHECErrorsATUCCRCErrorsWANDSLInterfaceConfig.ModulationType.DataPath.InterleaveDepth.UpstreamCurrRate.DownstreamCurrRate.UpstreamNoiseMargin.DownstreamNoiseMargin.UpstreamAttenuation.DownstreamAttenuation.UpstreamPower.DownstreamPowerLineEncodingDataPathInterleaveDepthLineNumberUpstreamCurrRateDownstreamCurrRateUpstreamMaxRateDownstreamMaxRateUpstreamNoiseMarginDownstreamNoiseMarginUpstreamAttenuationDownstreamAttenuationUpstreamPowerDownstreamPowerATURVendorATURCountryATURANSIStdATURANSIRevATUCVendorATUCCountryATUCANSIStdATUCANSIRevShowtimeStartwandslic_datapathInterleavedwandslic_lineencodingDMTCAP2B1Q43BTPAMQAMwandslic_modulationtypewandslic_linkstatusEstablishingLinkNoSignalDSL.Stats.LinkRetrain.FECErrors.ATUCFECErrors.HECErrors.ATUCHECErrors.CRCErrors.ATUCCRCErrors%s[WANDSLIC] mbus enum %s registration failed%s%s[WANDSLIC] mbus object type %s registration failed%s%swandslic portmap event map registration failed%sFilterFilterNumberOfEntriesFilterKeyFilterEnableFilterStatusBridgeReferenceFilterInterfacelayer2br_statusAvailableInterfaceAvailableInterfaceNumberOfEntriesAvailableInterfaceKeyInterfaceReferenceInternetGatewayDevice.LANDevice.LANEthernetInterfaceConfigInternetGatewayDevice.LANDevice.WLANConfigurationLayer2br_avintf_intftypeLANInterfaceWANInterfaceLANRouterConnectionWANRouterConnectionBridgeNumberOfEntriesBridgeKeyBridgeEnableBridgeStatusBridgeNameLayer2BridgingMaxBridgeEntriesMaxFilterEntriesBridge.{-1}%s.%i%s.%lu(== Technology ETH)LANEthernetInterfaceConfig_%s(== Technology WLAN)WLANConfiguration_%sWANConnectionDevice_%sLANEthWLANCoWANCon%s*%sBridge.%s.Intf.%sLANEthernetInterfaceConfig_WLANConfiguration_WANConnectionDevice_Bridge.%s.IntfETH.Phys.ATM.Intf.[IGD_LAY2BR_MBUS]%sBridge enum type registration failed%smotuwesu%s[TOD (err)] %s %s (%s)%smbus enum types registrationmbus object types registration%s[TOD (err)] %s %s: %d (0x%08x)%stod_mbus_event_initnnPnPnnPn(==X_000E50_VoiceProvisioningFCPEAddressProvisioningServerConnectionRequest%smbus object type VoiceProvisioning registration failed%sX_000E50_MaLigneVisioX_000E50_MaLigneTVAutoConfigmodeVoDZapTV1TV2TV1InterfaceTV2InterfaceTV1InterfacePreviousBridgeTV2InterfacePreviousBridgeLayer2Bridging.BridgeIGD_maligne_statusINProgressPVCVisioInterfaceVisioInterfacePreviousBridge%sMaLigneTV&Visio enumtype registration failed%s%sMaLigneTV&Visio objtype registration failed%sAdaptiveATMQoSDownstreamRateUpstreamRateInternetPeakCellRateX_000E50_UPnP_IGDX_000E50_ScreenX_000E50_FirmwareUpgradeX_000E50_InternetWANConnectionLANConnectionVoiceConnectionSearchNowDownloadURLDefaultHomePageURLSleepTimeDeepSleepModeTimeSleepModeScheduleBeginSleepModeScheduleEndContrastSoundVolumeThrobberDelayscreen_statusWANPPPConnection.%sWANIPConnection.%sServiceURLServiceURLNumberOfEntriesX_000E50_UserNumberOfEntriesX_000E50_ServiceNumberOfEntriesX_000E50_RoomNumberOfEntriesIconX_000E50_LanguageX_000E50_PossibleLanguagesX_000E50_ConfirmActionsX_000E50_DefaultAdministratorX_000E50_RemoteAdministratorPortX_000E50_DefaultRoomX_000E50_DisplayConnectedDevicesOnHomepageX_ORANGE-COM_WiFiButtonTimeoutOffX_ORANGE-COM_WiFiButtonTimeoutOnInternetGatewayDevice.UserInterface.X_000E50_User.SelectedLanguage(== Code %s)X_000E50_LEDLED.{-1}.Colors.Color.SupportedStates.StateHosts.Host.{-5}.UPnPDevice.{-3}.Icon.{-1}Hosts.Host.{-5}.X_000E50_UPnPDevice.{-3}.Icon.{-1}.MimeType.Width.Height.DepthIconNrOfEntriesMimeTypeWidthHeightDepthHosts.Host.{-5}.UPnPDevice.{-3}.Service.{-1}Hosts.Host.{-5}.X_000E50_UPnPDevice.{-3}.Service.{-1}.ServiceType.ServiceID.SCPDURL.ControlURL.EventSubURLServiceNrOfEntriesServiceTypeSCPDURLControlURLEventSubURLHosts.Host.{-3}.UPnPDevice.{-1}Hosts.Host.{-3}.X_000E50_UPnPDevice.{-1}.URLBase.FriendlyName.Manufacturer.ManufacturerURL.ModelDescription.ModelName.ModelNumber.ModelURL.SerialNumber.UDN.UPC.PresentationURLX_000E50_UPnPDeviceX_000E50_UPnPDeviceNrOfEntriesURLBaseDeviceTypeManufacturerURLModelDescriptionModelNumberModelURLUDNUPCPresentationURLUPnPDevice%ssubscription for object '%s' failed%sHosts.Host.{-5}.USB.{-3}.Interface.{-1}Hosts.Host.{-5}.X_000E50_USB.{-3}.Interface.{-1}.InterfaceClass.InterfaceSubClassUSBInterfaceNrOfEntriesInterfaceClassInterfaceSubClassHosts.Host.{-3}.USB.{-1}Hosts.Host.{-3}.X_000E50_USB.{-1}.USBVersion.DeviceClass.DeviceSubClass.DeviceVersion.ProductID.VendorID.ProductX_000E50_USBX_000E50_USBNrOfEntriesUSBVersionDeviceClassDeviceSubClassDeviceVersionProductIDVendorIDProductX_000E50_WiFiCommwificomm_statusPending^[ ]*%s[ ]*=[ "]*%sPPP has not been configured!%s%sThe UserName of PPP is NULL!%s/etc/config/wifi-community/wfc-persistent.confHS-activation-status/etc/adsld.confADSL_PPP_NAME%s.tmp.%d%s=%.*s wacd-mgt enablewacd-mgt disableHS-provisionedgoa/var/run/hotspot_client_status%s %s %u%sWIFICOMM-----there are no file -/var/run/hotspot_client_status%s%sWIFICOMM-----there are no file of /var/run/hotspot_client_status%s%smbus object type WIFICOMM registration failed%s%smbus object type WIFICOMM HOSTS registration failed%s%smbus object type WIFICOMM HOSTS HOST registration failed%s%smbus object type WIFICOMM successfully registered%soTo\odoloto|oadsl_testALBLOVQLNdsl_data_pathadsl_modulation_typeadsl_link_status_PRL%sUnable to read from Env%s[DSL_MBUS]disable%sUnable to %s the adsl connection%s%sUnable to get connection info from adsl driver%s%sUnable to get statistics from adsl driver%s%sinput p_cmd is NULL%sDSL_MBUS[ADSL PLUGIN] Plugin '%s' Plugin successfully registerd ! [ADSL PLUGIN] Plugin '%s' Enum Registration failed ! %sadsl enum type registration failed (%d)%s[ADSL PLUGIN] Plugin '%s' Registration objects failed ! %s'%s' registration failed in adsl_stats_atom_mbus_init() err=%d%s%s'%s' registration failed in adsl_stats_atom_mbus_init()%s[ADSL PLUGIN] Plugin '%s' Successfully registered ! %sUnable to open ADSL API device %s[ADSL PLUGIN] Plugin '%s' Unable to open the ADSL API device ! [ADSL PLUGIN] Plugin '%s' ADSL API device char successfully open! %sEventing for DSL Status failed.%soooooooo oo$oHo0o [] : Restart readers of vs-traces. fvt : Flush contents of vs-traces. svt [on | off] [cycl | nocycl] [check | nocheck] [disc | nodisc] : Set vs-trace mode. qvtcyclnocyclchecknocheckdiscnodiscparameter error disc nodisc Current default trace mode = %s,%s,%s,%sdbgTRCPRNTERROR : type[%d], class[%d], name[%s], file[%s], line[%d] info[%s] Execute a 'Trace & Debug' command. For qualified personnel only.dmesgShow the Linux kernel messages. For qualifies personnel only.Quoted 'Trace & Debug' command stringExecute a 'Trace & Debug' command. For qualified personnel only.Switch to 'Trace & Debug' prompt. For qualified personnel only.Switch to Linux shell. For qualified personnel only.tasksShow user space tasks.alg vpnip dtip ltip ctip +tip -tsea bstatssea istatssea pstatssea clearsea sqeth statseth bstatseth pstatseth cleareth traceeth tlensachem get_configsachem get_statesachem activate_performancesachem deactivate_performancesachem get_datasachem doatm otraceatm sxtatm sttatm svtatm tvcatm tlenatml statsatml pstatsatml gstatsatml istatsatml dstatsatml clearpptp ctracepptp dtracedbg sptdbg rvtdbg fvtdbg spodbg cpuloaderr statsedm ctrl edm sitedm situationedm startedm stopedm otherrxfedm getliedm ssedm setstatsedm rsedm resetstatsedm gsedm getstatsedm saedm setaddrupnp searchupnp advertiseupnp statsupnp traceupnp devicesupnp statemdap tracemdap searchvoip tracevoip ssvdsp fxooffhookvdsp tracecodecvdsp hcivdsp infomdgvoip infovdsp norevlfusbhost devsusbhost poskru st =====================DISCLAIMER====================== Access to expert commands is intended for qualified personnel only. ==================END=OF=DISCLAIMER================== Command not allowed Subcommand denied Unable to execute command: %s Sorry, changing into a topic no longer supported here. Only available via serial port Idx%3s %-16s %-16s %-8s %-8s %-16s %-8s%3u %-16s %-16s %-8s %-8s %-16s %-8s %8s Description................ %s %8s Properties................. unknown service type, group member, shared service, no fw, no natbidirectional , %stransparent map%8s Attributes................. %s %8s User Managed Attributes.... %s %8s Inherited Attributes....... %s %8s Attribute Values : (administratively) (operationally) %8s State...................... %s%s %8s Port....................... %hu %8s Source Ip Selection........ %s %8s Ip Access List............. %8s Interface Access List...... %8s Map List................... [%hu-%hu]%8s Logging.................... %s linksmapsacl ifacl ifgroupacl ipDisplay system service statistics.Display services.Modify a service.mapaddAdd a port map for a service.mapdeleteDelete a port map for a service.ifaddAdd an interface to the access list.ifdeleteDelete an interface from the access list.Add an ip address (range) to the access list.Delete an ip address (range) from the access list.The name of the service for this access list.The ip address (range) for this access list.The interface for this access list.The name of the service for this map.The interface for this map.The port for this map.The name of the service.Disable/Enable this service.The port of the service.The primary ip interface for this service.Disable/Enable service logging.dynamicsDisplay dynamic sevices.membersDisplay sevice group members.Invalid service name: %s. No permission to modify this service: %s. Invalid interface name specified cipCIP interface name not allowed SrcPortDstPortFailed to retrieve configuration for unknown service. Source IP interface can only be configured for services with client behaviour. Port change conflict with existing service. .Failed to add port map to %s service. Failed to delete port map from %s service. Failed to add interface to %s service access list. Failed to delete interface from %s service access list. Failed to add ip address (range) to %s service access list. Failed to delete ip address (range) from %s service access list. %-16s %5s %5s %8s Object%-16s %5u %5u %8u Total Memory Allocation: %u bytes service systemservice system debugDYNAMIC BUNDLE RELAY BRIDGE CONFIG %-*c Flags....: %s%s%s%s%s%s %-*c Phys.....: failed to get physical interface parameters bpskbpsMbpsusbwlpanfxsctpdectPhys.....: type %s call_active: %s Phys.....: intf: %u type %s speed: %lu %s wds: %s Phys.....: intf: %u type %s speed: %lu %s Eth......: failed to get ethernet interface parameters Eth......: port: %u ip_cid: %u arp_cid: %u Atm......: failed to get atm interface parameters Atm......: cid: %u atm_cid: %u llc_cid: %u ppp_cid: %u Isdn.....: failed to get isdn interface parameters Isdn.....: cid: %u Ip.......: failed to get ip interface parameters Ip.......: dest: %s Ppp......: failed to get ppp interface parameters Ppp......: cid: %u ip_cid: %u Bridge...: failed to get bridge interface parameters Bridge...: port: %u portstate: %u Display interfaces.reverseReverse listing (lower layer iso. upper layer).LL InterfacesUL Interfaces%-*s %-20s %-16s %-4s %-s %-*s %s%-20s %-16s %-4d Invalid interface name. o~o~o~o~o~o~o~o~o~Sets an environment variable.Define an environment variablegetGets an environment variable.unsetDeletes an environment variable.List all environment variables.Remove all non-system environment variables.varThe name of the variable.A translated quoted string defining the variable value.Invalid environment name. Failed to set variable: can't set/change system variable. Failed to set variable: out of memory. Failed to unset variable: can't remove system variable. Failed to get variable: not found. saveallSaves current configuration.saveStore current configuration to backup fileLoad saved or default configuration.Delete a user configuration file.Flush the loaded configuration.Show the current configuration setShow the saved configuration filelist template filesflush_ipFlush IP settings or not.filenameuser_conf_fileconfiguration file to eraseload_ipLoad IP settings or not.defaultsLoad default instead of saved configuration.Flush current configuration before loading new one.Make this configuration persistent.Echo each command string when loaded.Configuration filename.Filename for backupfile of current configurationInvalid name (too long) for configuration file. Bad format for configuration file. user configuration filenameSyncing MBUS data models... mbus debug loadobjects dmtree=atomicmbus debug loadobjects dmtree=igdSyncing of atomic data model failed! Save aborted! Saving to database... Syncing of igd data model failed! Save aborted! Done Failed writing file. File can not be opened for write. File (%s) doesn't exist! User configuration is deleted Unable to erase file %s User configuration file not found, save your configuration using "saveall" Create a new PPP interface.Delete a PPP interface.Attach a PPP interface.ifscanScan a PPP interface for available interfaces.ifscanlistList ifscan results.Detach a PPP interface.Modify a PPP interface.Display the PPP interfaces.Add a route to the routing table when PPP link comes up.Delete the route for a PPP link.Flush all PPP interfaces.simlockShow allowed listList of allowed isp domaines%dynamicThe PPP interface name for which to delete the route settings.Disable route.The name of a PPP interface.Enable route.The IP destination address specification for the route to be added when the link comes up.The IP destination mask. Special values : 1 = remote net; 32 = remote host;srcThe IP source address specification. i.e. who can use this link.srcmskThe IP source mask.The route metric.%0: %56{from}{dest} : %1 %2 [%3] Retry : %4 mode = IP %5{unnumbered + DHCP [-> %5]}{routing} flags = %36{ echo}%46{ magic}%26{ pcomp}%27{ passive}%47{ accomp}%48{ neg_accomp}%49{ passive}%28{ silent}%50{ mschap}%29{ restart}%51{ trace}%52{ mru} %53{addr}%54{ route}%30{ savepwd}%31{ demanddial}%32{ unnumbered}%56{ cloned}%55{ incoming}%1{%21{ ac}} %34{%16}%33{ [/]}{ [.]} dns metric = %6%7{ ip = %7}%8{ rem = %8}%35{%33{/%35}{ mask = %9}}%36{ echotolerance = %37}%52{ mru = %10}%12{ %11 inactivity = %12s left = %38s} %31{%13{ dod delay : %13s %20{left : %39s} }}%54{ route : dst=%58/%59 - %61{label}{src}=%61{%61}{%62/%63}(metric %60) }%14{ primary dns = %14 secondary dns = %15 } auth = %16 user = %17 password = %18 admin state = %19 oper state = %34 link state = %20 LCP : state = %40 retransm = %41 term. reason = %42 IPCP: state = %43 retransm = %44 term. reason = %45 %1{ acname : %22{%22}{%23{%23}{---}} service : %24{%24}{%25{%25}{---}} %57{ [PPP %21{AC}{client} session id = %57] }}The name of the PPP interface to configure.The destination interface for this PPP interface.userThe username for remote PAP/CHAP authentication.The password for remote PAP/CHAP authentication.acnameThe access concentrator name for a PPP session.servicenameThe service name for a PPP session.Try to negotiate PPP protocol compression (LCP PCOMP).Try to negotiate PPP address & control field compression (LCP ACCOMP).Enable verbose console logging.concentratorThe access concentrator is on this side of the PPP connection.Authentication protocol to be used.restartAutomatically restart when LCP link goes down.retryintervalThe number of seconds between retries.When LCP times out, put link in a listening state.silentDo not send anything at startup, just listen for incoming LCP messages.echotoleranceNumber of failed LCP echo requests needed to trigger a link failure.Send LCP echo requests at regular intervals.mruNegotiate maximum packet size we can handle.laddrNegotiate this IP address at our side of the link.raddrNegotiate this IP address at remote side of the link.Negotiate IP subnet mask at remote side of the link.The format used to represent the IP subnet.Acquire IP subnet and assign it to a free DHCP pool.savepwdSelect whether or not password is saved.demanddialEnable dial-on-demand feature. Nothing happens until packets are sent to this PPP interface.doddelayDuring this initial interval (seconds) packets do not trigger PPP interface.primdnsNegotiate IP address as primary DNS server.secdnsNegotiate IP address as secondary DNS server.dnsmetricDNS route metric to be used for the negotiated DNS servers.idletimeMaximum time the link may be idle (seconds).idletriggerConsider the link being idle if no traffic is sent and/or received during the idle time.unnumberedTake local IP address from 'laddr' field and remote IP address from the pool. SVC only.Another method to attach a link. Internal use only.The name of the PPP interface.detachDetach interface.Service Name Acces Concentrator %[-35]0 %[-35]1 The name of the PPP interface to scan.The time to scan for services (in seconds).attachAttach interface.The name for the new PPP interface. If not specified, the destination will double as interface name.Enable/disable dynamic interface.List of allowed isp domaines. /active/slock.txt%02lu:%02lu:%02luETH.Intf.EnableNamePPP.Intf.{intf}.RouteForwardingMetricSourceIPMaskSourceIPAddressDestSubnetMaskDestIPAddressLabelPPPoESessionIDFlagClonedFlagIncomingFlagRouteFlagAddressFlagMRUTraceFlagMSChapFlagNegACcompACcompFlagMagicIPCPTermReasonIPCPRetransmitsIPCPStatusLCPTermReasonLCPRetransmitsLCPStatusDoDTimeRemainingIdleTimeRemainingEchoToleranceEchoPPPStatusNetMaskFormatUnnumberedDialOnDemandSavePasswordRestartSilentPassivePcompPPPoEServiceNameServiceNamePPPoEACNameACNamePPPoEACStatusEnablePasswordUserNameAuthenticationSecDNSServerPrimDNSServerDoDDelayIdleTimeoutIdleTriggerMRUNetMaskRemoteAddressLocalAddressDNSMetricDHCPServerPoolRetryIntervalUptimeLastConnectionErrorLowerIntfDHCP.Server.PoolETH.IntfATM.Intf(== Status Used)(!= Status Used)PPP.Scan.ServicesPPP.Relay.Intf.{intf}TimeoutIntfNamePPP.Relay.IntfPPP.Intf.{intf}PPP.IntfAll PPP relay agent commands.Add an ethernet interface to the PPP relay list.Delete an ethernet interface from the PPP relay agent list.Modify an ethernet interface from the PPP relay agent list.Display all ethernet interfaces added to the PPP relay agent list.sesslistDisplay all active PPP relay sessions.Remove all ethernet interfaces from the PPP relay agent list and terminate all sessions.The ethernet intf to be added to the PPP relay agent list.Failed to add PPP relay interface %s. [%s] fatal errorFailed to delete PPP relay interface %s. [%s] Failed to modify PPP relay interface %s. [%s] %-2s %-16s %-17s %s HWaddr%-2d %-16s %-17s%c %s CL-HWaddr%-2s %-8s %-8s %-17s %-17s %-8s %-8s %-13s AC-HWaddrCL-sessAC-sessCL-portAC-port---%02lu[d]%02lu:%-2d %-8d %-8d %-17s %-17s %-8s %-8s %-13s ppp relayppprelayUnable to set %s%s Create a new ATM interface.Delete an ATM interface.Attach an ATM interface.Detach an ATM interface.Modify an ATM interface.Display the ATM interfaces.Flush all ATM interfaces.The name of an ATM interface.The name of the ATM interface to configure.The WAN destination for this ATM interface. Typically, a phonebook entry.The name of a qosbook entry defining the QoS parameters for the WAN link.encapsThe WAN protocol encapsulation to be used on this interface.The number of times the WAN connection setup should retry before giving up.fcsWhether or not to include the Ethernet FCS in the packet header (only used for llc encapsulation for mac).ulpThe upper layer protocol.mlprioReserving the Number of Priority queues for this ATM interfaceloggingEnable/disable error logging.The name of the ATM interface.The name for the new ATM interface. If not specified, the destination will double as interface name.llcvcmuxInvalid ATM interface name. Illegal option. out of resourcesFailed to create ATM interface: %s. Failed to set destination. Failed to set dynamic parameter. Failed to find ATM interface. Warning: the changes on a dynamic ATM interface will not be saved ! Unknown qosbook name, proceeding anyway. because link is busyfrom(none)%-10s: %s : %s Retry : %d QoS : %s Encaps : %s Fcs : %s Ulp : %s Multi Priority Queues : %d Connection State : %s Failed to attach ATM interface. Failed to detach ATM interface. Failed to delete ATM interface. Some ATM interfaces are still in use. Interfaces that are in use cannot be deleted. %-*s %-4d %s%s Display the phonebook.Add a new phonebook entry.Delete a phonebook entry.Flush all phonebook entries.The name of the entry to delete.The phonebook name for this destination.The address for this destination.Enable / Disable error logging.Dynamic entry (not saved).maxFwdCPCS_PDUMaximum forward CPCS PDU value (not saved).maxBwdCPCS_PDUMaximum backward CPCS PDU value (not saved).%d.%d.%d%d*%d*%d%s.%d.%datmchannel : PVC syntax is [port.]vpi.vci port=Invalid address specified. FORCEInvalid phonebook destination name, phonebook is in use. Failed to add phonebook entry. Invalid phonebook destination name. No spaces allowed in name. The name INCOMING is reserved. Please choose another name. Failed to add entry. Some phonebook entries are still in use. Entries that are in use cannot be deleted. %-*s %-4s Address Forcing the delete of : %s. Unknown phonebook entry. Phonebook entry in use. Entries that are in use cannot be deleted. Failed to remove entry. atm phonebook(bytes)(Kbits)(cells)(cps)linerate%-*s %-3ld %-8s %-8s %-8d %-8d %-8d %-8d %-8d %-8s %-8s Modify the qosbook configuration.ctdlistDisplay all connection traffic descriptors.ctdaddAdd a new connection traffic descriptor.ctddeleteDelete a connection traffic descriptor.Display the qosbook.Add a new qosbook entry.Delete a qosbook entry.Flush all qosbook entries.The name of the qosbook entry to delete.forceForce delete even when the entry is still in use.The name for the new QoS entry.txctdThe name of the CTD for transmit (upstream) direction.rxctdThe name of the CTD for receive (downstream) direction.The name of the CTD entry to delete.The name for the new CTD entry.The ATM service conformance definition.peakratesustratemaxburstminratemaxframecelldelayCell delay variation in tenths of microseconds.Enable/disable realtime traffic (VBR only).framediscardEnable/disable frame discard.VBRUBR.1UBR.2UBR.mdcrCBR.1VBR.1VBR.2VBR.3VBR.cVBR.ntVBR.tGFR.1GFR.2The input, output format of the qosbook.bytescellsThe minumum cell rate (in cells per second). (UBR.m or GFR)The maximum frame size (in cells). (GFR only)The maximum burst size (in cells). (VBR or GFR)The sustainable cell rate (in cells per second). (VBR only)The peak cell rate (in cells per second). Use '0' to indicate linerate for UBR.The minimum rate (in kilobits per second). (UBR.m or GFR)The maximum frame size (in bytes). (GFR only)The maximum burst size (in bytes). (VBR or GFR)The sustainable rate (in kilobits per second). (VBR only)The peak rate (in kilobits per second). Use '0' to indicate linerate for UBR.Invalid connection traffic descriptor name. Invalid qosbook destination name. Qosbook format in %s. peakrate, sustrate, maxburst, maxframe, minrate, celldelay, realtime, %s ignored for %s. %s must be specified for %s. Sustainable rate must be lower than peak rate for %s. Minimum rate must be lower than peak rate for %s. Peak rate may not be linerate for %s. Minimal sustainable rate for this modem is %d kilobits per second, value adapted. Minimal sustainable cell rate for this modem is %d cells per second, value adapted. Minimal rate for this modem is %d kilobits per second, value adapted. Minimal cell rate for this modem is %d cells per second, value adapted. Minimal peak rate for this modem is %d kilobits per second, value adapted. Equal connection traffic descriptors are not allowed, use connection traffic descriptor '%s'. Minimal peak cell rate for this modem is %d cells per second, value adapted. %-*s %-3s %-8s %-8s %-8s %-8s %-8s %-8s %-8s %-8s %-8s ConfRefPeakSustBurstMinrateFrameCdvtUnknown connection traffic descriptor. Connection traffic descriptor entry in use. Use 'force' option to delete anyway. Warning: qosbook entries existing of dynamic connection traffic descriptors will not be saved! Tx CTD%-*s %-3s %-*s %-*s Rx CTD%-*s %-3ld %-*s %-*s Unknown qosbook entry. Qosbook entry in use. Use 'force' option to delete anyway. atm qosbookoooooooooooooooo`ooooDoo(ooo oLo,olUnable to set %s%s. Modify/Display the bridge configuration settings.Display the current bridge instances.Add a new bridge instance.Delete a bridge instance.selectSelect the default bridge for configuring interfaces from (if not setting bridge name, for legacy purposes).Add a new bridge interface.Delete a bridge interface.Attach a bridge interface.Detach a bridge interface.Modify a bridge interface configuration.ifflushflush the bridge interfaces: detach/delete all interfaces.Display the current bridge interfaces.Clear bridge statistics.Flush all bridge instances with their interfaces and properties.brnameThe name of a bridge instance.The name of a bridge interface.The name of the bridge interface to configure.The destination for this interface. Typically an ATM or a physical interface name.portstateThe bridge portstate for this interface.The number of WAN connection setup retries before giving up.The name of the bridge interface.The new bridge interface name.The name of the new bridge instance.The lifetime (in seconds) of a dynamically learned MAC address.Ageing : %d Specify at least an interface name or a destination. Failed to create bridge link: %s. Failed to find ulp parameter: %s. Destination interface %s has incompatible ulp parameter. Failed to find bridge interface. Warning: the changes on a dynamic bridge interface will not be saved ! FREE!!%-10s: dest : %s Connection State: %s Retry: %d Port: %-12s PortNr: %-9s (Unassigned)(Unknown)port%d Port: %-12s PortNr: %-9d PortState: %s Interface: %s RX bytes: %-10lu frames: %-10lu TX bytes: %-10lu frames: %-10lu dropframes: %-10ld Failed to attach bridge interface. Failed to detach bridge interface: interface does not exist. Failed to detach bridge interface: internal interfaces cannot be detached. Failed to detach bridge interface. Failed to delete bridge interface: interface does not exist. Failed to delete bridge interface: internal interfaces cannot be removed. Failed to delete bridge interface. Invalid bridge instance name. Invalid bridge id in parameter value. Failed to find bridge instance. bridge configuration for "%s" : No name given for the new bridge instance. Could not creqte bridge instance with this name: already existing? No bridge instance name given. Failed to select bridge instance. Failed to delete bridge instance. eth bridgeCreate a new ETH interface.Delete an ETH interface.Attach an ETH interface.Detach an ETH interface.Modify an ETH interface.Display the ETH interfaces.Flush all ETH interfaces.The name of an ETH interface.The name of the ETH interface to configure.The destination interface for this ETH interface.The number of times the ETH connection setup should retry before giving up.vidThe VID for this ETH interface.The name of the ETH interface.The name for the new ETH interface.Failed to create ETH interface: %s. Failed to set ETH interface destination. Failed to find ETH interface. Warning: the changes on a dynamic ETH interface will not be saved ! ETH interface cannot be connected to itself. ETH interface %s is already connected to vid %lu. Other ETH interface is already connected to vid %lu. ETH interface %s is already part of ETH interface %s subtree. (unassigned)%-16s: Dest: %-16s %16s Connection State: %s Retry: %d %16s PortNr: %s %16s VID: %d Failed to attach ETH interface. Failed to detach ETH interface. Failed to delete ETH interface. Some ETH interfaces are still in use. Interfaces that are in use cannot be deleted. _dyn_All DNS client commands.All DNS server commands.DNS server configuration settingsPrint DNS server configuration settingsFlush all local DNS hosts and routes.DNS server host specific commands.routeRemote DNS server route commands .DNS server debug specific commands.Print the DNS server/forwarder statistics.Clear the DNS server/forwarder statistics.Corrupted packets received : %[9]0 Local questions resolved : %[9]1 Local negative answers sent : %[9]2 Total DNS packets forwarded : %[9]3 External answers received : %[9]4 Spoofed responses : %[9]5 Forward table full, discard : %[9]6 Spurious answers : %[9]7 Unknown query types : %[9]8 Creates a DNS forwarding entry or templateDeletes a DNS forwarding entry or templateRemoves all DNS forwarding entries and templatesLists all DNS forwarding entries and templates DNS Server Entries: DNS Server Source Metric Intf State Domain %6{D}{S} %[-15]7 %8{%[15]8/%[-2]9 }{ } %[-3]10 %11{%[-8]11 }{ * } %[4]14 %12{%[-16]12}{ * } The IP address of a DNS server.The DNS domain string.The interface associated with the DNS entry or DNS Template.The IP address of a DNS server. If 0.0.0.0 is used, the entry becomes a DNS-Template which is instantiated if DNS Server IPs are configured on an IP interface.If specified, only DNS queries from machines of which the source IP address matches the source prefix of the DNS entry will be forwarded to the corresponding DNS server.srcmaskThe IP address mask for the source prefix.Domain matching string. If configured, only those DNS queries of which the domain name in the query matches with the string configured for the entry will be forwarded to the corresponding DNS Server. Maximum string length: 62 charactersThe metric for the DNS entry. The DNS Entry List is sorted on DNS Metric; the lower the metric, the higher the priority of the entry.Add a local DNS hostDelete a local DNS hostFlush all local DNS hostsList all local DNS hostsAddress Hostname TTL (s) Creator id %0{%[-15]0}{ }%D{ }{*} %[-28]1 %[10]2%[12]3 The name of an IP host to delete.The name of an IP host to add.The IP address of the host.The lifetime of the host.domain : %0 timeout : %1s suppress : %2 state : %3{enabled}{disabled} trace : %4{enabled}{disabled} syslog : %5{enabled}{disabled} spoofing : %6{enabled}{disabled} spoof ip : %7 The DNS server domain name.The forwarded DNS query timeout.suppressSuppress not more than specified amount of remote DNS server errors.Enable/disable the local DNS server/forwarder.Enable/disable verbose console logging.Enable/disable SYSLOG for DNS events.WANDownSpoofingEnable/disable DNS spoofing when no applicable forwarding route present.WDSpoofedIPIP address used for spoofing when WANDownSpoofing enabled.dnsaddAdd a DNS server.dnsdeleteDelete a DNS server.dnslistList all DNS servers.Modify the DNS resolver configuration.Remove all DNS servers.nslookupDNS lookup for a domain name or an address.The DNS domain name string to query.The query timeout in seconds.The number of query retries before giving up.Use the searchlist to construct fully qualified domain names.Slash separated list of domain name suffixes.Enable or disable verbose logging.The index number (shown by the 'list' command) of the server to delete.The DNS server IP address.The DNS server port number.DNS client internal error !!! timeout : %us retry : %u search : %s srchlist : %s trace : %s invalid separator or character in searchlist. "%s" not recognized as an IP or ATM address. DNS server "%s" could not be added: no free table entry. DNS server "%s" is already existing. DNS server "%s" could not be added: invalid address. DNS server "%s" could not be added: DNS resolver not initialized yet. Error: entry value out of range [1,%u]. No DNS servers registered. Entry State Family Server %2u FREE IDLE CONNECTING CONNECTED RELEASING RECONNECTING RETRYING ? IP %s IP [port] %d - [addr] %d.%d.%d.%d Can't find %s: DNS client service disabled Can't find %s: Internal error Can't find %s: Out of memory Can't find %s: No response from DNS server Can't find %s: Non-existent domain Can't find %s: Temporary server failure Can't find %s: Non recoverable error Can't find %s: Syntax or semantic errors detected Warning [%s]: DNS response has been truncated Cant't find %s: Unknown error Name: %s Address: *.*.*.*Type: IP
none Aliases: dns clientdnscdns serverdnssClearUnknownQueryTypesSpuriousResponsesOutofResourceDiscardsSpoofedResponsesExternalResponsesQueriesForwardedLocalNegativeResponseLocalResolvedCorruptedPacketsDNS.Server.StatsStatusStatusDNSServerDomainIPIntfMetricSourceSubnetMaskSourceIPAddressDNSServerFlagsDomainIPIntfMetricSourceSubnetMaskSourceIPAddressFlagsIP.IntfDNS.Server.RouteCreatorTTLNameIPAddressDNS.Server.Host.{name}DNS.Server.HostWDSpoofedIPAddressWDSpoofingSyslogTraceEnableSuppressTimeoutDomainDNS.Serverp^p_p_ p_p_$p_0p_<[server resolve failure][server connect failure][server timeout][HTTP failure][update failure][recoverable service error][non-recoverable service error] !!!Add a dynamic DNS client.Modify a dynamic DNS client.Delete a dynamic DNS client.Delete all dynamic DNS clients.List all dynamic DNS clients.All dynamic DNS host name commands.All dynamic DNS service commands.Modify specific dynamic DNS service settingsList all dynamic DNS servicesThe dynamic DNS service.The dynamic DNS server hostname.The dynamic DNS server port.The dynamic DNS request string.updateintervalNumber of seconds before a dynamic update is sent to the dynamic DNS server (The value 0 means disabled).Number of seconds between retries if communication with the dynamic DNS server fails (The value 0 means disabled).max_retryThe maximum number of retries if communication with the dynamic DNS server fails.Add a fully qualified host nameDelete a host nameDelete all host namesList all host namesThe dynamic DNS host group.The dynamic DNS client name.The dynamic DNS client interface.The username for dynamic DNS authentication.The password for dynamic DNS authentication.The mail exchanger.backmxSet up the mail exchanger as a backup MX.wildcardAllow use of hostname wildcards.offlineSet the host to offline mode.Enable/Disable the dynamic DNS client.Enable/Disable the verbose console logging for the dynamic DNS client. update needed update in progress update successful [ ][o][v][x] wildcard backmx offline[FREE][INIT][IDLE][RESOLVING][CONNECTING][CONNECTED][UPDATING][AUTHENTICATING]service modifyhost addInvalid dynamic DNS client name. Invalid dynamic DNS group name. Invalid dynamic DNS host name. Invalid dynamic DNS service name. Unable to set %s No resourcesName clashFailed to add dynamic DNS host. [%s] because client is busyFailed to delete dynamic DNS client. Unable to flush host names, some of them are still in use. %-10s: server = %s port = %d request = %s update interval = %ds retry interval = %ds max retry = %d %-10s: %s %s %s options = %s user = %s password = %s addr = %s mx = %s group = %s HTTP: ... "%s%s" ... "%s [%s]" Failed to add host name. [%s] Unable to find host. Failed to delete host during update. Failed to delete host, host group still in use by a client. Failed to delete host. %s : %s %s (last update: %s) invalidlegend : %s %s %s %s Modify address translation on an IP interface.Display all interfaces.Add an address mapping to a nat enabled interface.Delete an address mapping from a nat enabled interface.maplistDisplay address mappings.tmpladdAdd an address mapping template.tmpldeleteDelete an address mapping template.tmpllistDisplay address mapping templates.tmplinstInstantiate address mapping templates for a given dynamic address.Flush current NAT configuration.addr_indexThe outside IP address index/key to instantiate for.dynamic_addrThe dynamic address to substitute the index/key with.The template index as listed by ':nat tmpllist'.The IP interface name scope for this template.The IP interface group scope for this template.The type of template.outside_addrThe outside (typically public) IP address or index (range for NAT).inside_addrThe inside (typically private) IP address or index (range for NAT).access_listThe range of inside addresses the template is restricted to.foreign_addrThe range of destination addresses the template is restricted to.protocolThe IP protocol.outside_portThe outside port number or range (only for NAPT).inside_portThe inside port number or range (only for NAPT).The mode to create the portmap.Use portmap only for inbound traffic.sort_sSort in s iso t.The map index as listed by ':nat maplist'.The type of mapping.The outside (typically public) IP address (range for NAT).The inside (typically private) IP address (range for NAT).The range of inside addresses the mapping is restricted to.The range of destination addresses the mapping is restricted to.Disabled, enabled or tranparent address translation.Failed to configure NAT for this interface. %-15s %-10s Warning : for NAT access list is automatically restricted to the inside address range. Failed to add mapping : %s. Failed to delete mapping. unmapped[%lu-%lu][%lu]unavailableNAPT%3d %-4s %-15s %-8s :[%u-%u]%-30s %-30s %lu %*c %-17s %s Access List...................any except local deliveryForeign Address...............Protocol......................Flags.........................User Description..............Description...................%*c %-17s %lu Creator Data..................Outside Address%-3s %4s %-15s %-30s %-30s %s Inside AddressWarning : interface group is ignored when an interface is defined. Failed to add template : %s. Ifgroup%-3s %4s %-15s %-8s %-30s %-30s %s Failed to instantiate. echo-replydestination-unreachablesource-quenchredirectecho-requestrouter-advertisementrouter-solicitationtime-exceededparameter-problemstimestamp-requesttimestamp-replyinformation-requestinformation-replyaddress-mask-requestaddress-mask-replyipinipipcompAdd an expression.Delete an expression.Modify an expression.List expressions.Flush all expressions.The name of an expression to list.The type of an expression.The format of the expression list.Disable/Enable listing dynamic expressions.prettycliThe name of an expression to delete.The index of a subexpression.The name of an expression to add.The MAC address.The IP address or range.maskThe IP mask (ignored if an IP range is provided).intfgroupThe IP interface group.bridgeportThe bridge port.tosThe Type Of Service specification in the IP packet.The precedence in the IP packet (part of tos).The diffserv code point in the IP packet (part of tos).The IP protocol (name or number) in the IP packet.The TCP/UDP source port number or range begin.srcportendThe source TCP/UDP source port range end. (inclusive)The TCP/UDP destination port number or range begin.dstportendThe TCP/UDP destination port range end.icmptypeThe ICMP type (name or number) of the packet.icmpcodeThe ICMP code or range begin.icmpcodeendThe ICMP code range end. (inclusive)At least one of the interface parameters must be presentTos, precedence and dscp can't be used at the same time.At least one of the service parameters must be presentIcmp code range not fully specified port range not fully specified%s is a dynamic expression and cannot be used by this command Error: Expression '%s' already exists. Error: %s Error: %s. (Sub)expression added successfully. Internal error. Error: Invalid subexpression index. (Sub)expression deleted successfully. Expression modified successfully. %-*s %-5s %5d %c %2d.expr:%s add%-*s %-5s %5s %-5s%-40s expressionFlushed %d expression(s). Error: Internal error. The name of an expression to modify.%s (p:%u b:%u) The format of the chain list.chainThe name of the chain which contains the rule.The index of the rule in the chain.newindexThe new index of the rule in the chain.The name of the new rule.clinkThe name of the chain to be parsed when this rule applies.The name of the source interface expression.The name of the source ip expression.The name of the destination interface expression.dstipThe name of the destination ip expression.The name of the service expression.srcmacThe name of the source mac expression.Disable/Enable logging when this rule applies.Disable/Enable this rule.The action to be taken when this rule applies ('link' when clink is used).connstateThe connection states.relatedestablishedDisplay all rule operations.Display all chain operations.Add a chain.Delete a chain.Modify a chain.Display a list of chains.Flush all chains.The name of the chain to modify.policyThe default policy of the chain.The name of the chain to delete.The name of the chain to add.Add a rule.Delete a rule.Modify a rule.Display a list of rules.Flush all rules.Display all debug operations.Display rule statistics.Clear rule statistics.The name of the chain.The name of the chain to flush.The name of the chain to list the rules of.The format of the rule list.The name of the chain in which to delete the rule.The number of the rule in the chain.Warning : the action for this rule is not decisive. Throughput may be affected. Unknown chain %s %s is an internal chain and cannot be modified by this command chain nameInvalid action specified %2d. [%c%c] Chains ====== %-*.*s %-16.16s %-16.16s%-*.*s %-16.16s %-16.16s Warning: Cannot flush all chains because some chains are still assigned!! %-16.16s mac=%s%s %s%s.%s%s > %s%s.%s%s%-32.32s %-4u %-6.6s %-s connstate: %s Rules (flags: C=Constant, D=Dynamic, E=Enable, L=Log) ===== Nr.%-32.32s %-4s %-6.6s %-60.60sError: Rule not existing Error: Dynamic rule Error: Index specified without chain. %-*s %5s %10s %10s %-*s %5d %10u %10u chain addchain modifyrule addpfacceptdropDisplay firewall configuration.The format of the firewall list. Modules Module======= %-16.16s %-8.8s %-40.40s %-40.40sHooks%-16.16s %-8.8s %-40.40s Hooks Prio%-16.16s %-4.4s %-16.16s%-16.16s %-4u %-16.16s %s: What ?%s%s : [%s%u-%u][%s%u] > *Add a new security level.Delete a security level.Modify a security level.List all security levels.Set/Display active security level.Flush security level configuration.The name of the security level to set active.The format of the security level list.The name of the security level to modify.The index of this security level.Select whether the security level is readonly.udptrackmodeSelect UDP connection tracking mode.Enable/Disable service definitions for this security level.Enable/Disable proxy system services for this security level.The description of this security level.looseThe name of the security level to delete.The name of the security level to add.The index of the security level.Enable/Disable host service definitions for this security level.firewall levelUnknown security level'%s' security level nameError: Security level already exists. Error: Invalid security level index. Error: Out of memory. Error: Could not add level. Error: Security level doesn't exist. Error: Could not delete level. Error: Invalid secirity level index. Error: Could not modify level. :%s Level Config %s Active level: %s nr%2s %-*s %-8s %-8s %-8s %-8s %-*sudptrackproxyingdescription%-2d %-*s %-8s %-8s %-8s %-8s %*s%-*.*sNo security level set. Error: Could not retrieve active level. Error: Security level doesn't exist Error: Could not set active level. fwlevelMode:Service Name:"%s" Host:%s User-Defined:%s Log:%s %s%s No service maps available. tcp or udpProtocol %s on port %d triggers portrange %d - %dport %d forwarding for protocol %s to host Portrange %d - %dPort %d for protocol %s will be forwarded to host portrange %d - %d port %d Create/define service portmap.Delete a service portmap.Protocol type.baseportInbound base port.The outbound portrange.triggerportDefines outbound trigger port.triggerprotocolProtocol of the trigger port.Display list of services.Add a service.Delete a service.Assign a service to a host.Disable a service.Service statistics.Flush all services.Enable/disable logging.server, client or custom service ?Invalid service name. No services available. %-40s %-16s %-12s %s Service NameUser-DefinedunassignedFailed to add service. Failed to delete service. Failed to add service portmap. Failed to delete service portmap. Failed to assign service. Failed to disable service. Error flushing services. Services : %d of %d in use. Service maps : %d of %d in use. Error retreiving service statistics. service hostservice host ruletlsacs-clienthttps-serverremote-upgradedselfDisplay/modify tls settingscertAdd a new certificateDelete a certificateList certificatesSSL/TLS client for ACS stateSSL/TLS server for HTTPS stateSSL/TLS client for remote upgraded stateauth-servRequest server authenticationauth-clientRequest client authenticationvalid-dateCheck certificate validity datevalid-domainCheck certificate domainname of the certificate fileCertificate indexDisplay more informationError while %s configuration data retrieving%-34s : %s memmMemory manager commands group.Display memm statistics.Display objects.Memm debug commands group.Display memm time statistics.clearstatsClear time statistics.Modify memm trace settings.Lock debug commands group.tag(Un)tag memory manager objects.Select typename(s) to list (supports partial typename)Set (or unset) the tagDisplay lock statistics.Modify lock trace settings.Select memm trace level (0-4).application name filter for lock traces (empty displays all lock traces)taggedShow only tagged (yes) or untagged (no) objectshidedeldynstrHide (yes) / show (no) deleted dynstrings (default = show)WARNING: Maximum memm tracelevel by compilation is %d memm trace : %s (level: %d)memmanager lock stats: memmanager lock time stats cleared memmanager pool free_time stats cleared WARNING: Maximum LOCK tracelevel by compilation is %d lock trace: %s (level: %d, filter='%s') %-10s %-*s %-20s Dst Intf: %-20d TTL: %-3d %-6s Flags: %-*s %c<%d>[%d]%c%s[%d]Display the multicast routing table.Flush the multicast routing table.TCDRCSrc IntfSrc IpGroup AddrFlags : [C]hecked, [R]eported, [D]ynamic, [T]tlIncr %-20s %-20s %-20s %-10s %s Dst Intfs%-20s %-20s %-20s %-20s <%-18d> %-20s %-20sError flushing multicast routing entries. ip mcastmcastAll client commands.Create a DHCP client.Activate a DHCP client.Configure a DHCP client.Delete a DHCP client.De-activate a DHCP client and releases its lease.List DHCP clients.ifrenewRenew a DHCP lease.Delete all DHCP clients.DHCP client specific debug commands.rqoptionsParameter request list.txoptionsOption list.Add an option.Delete an option.List all options.optionlistLists all DHCP Option Codes that can be used. Interface : %[-10]0 .TxOptions DHCP Options : %1 %2{ Suboption : %[-3]2 }%3{ Enterprise : %[-10]3 }%E{ Value : (%5)%[-64]4 }.Field%0{ Suboption : %[-3]0 }%1{ Enterprise : %[-10]1 }The name of the interface on which a DHCP Client is defined.Expand enabled/disabled.The name or number of the option.The enterprise number (see http://www.iana.org/assignments/enterprise-numbers)suboptionThe suboption numbersubnet-masktime-offsetdefault-routerstime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-file-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filtermax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressclassfull-static-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timevendor-class-iddhcp-client-identifiernwip-domainnwip-suboptionsnisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-class-identifierslp-directory-agentslp-service-scoperapid_commitclient-fqdninternet-storage-name-servers#84nds-serversnds-tree-namends-context#88#89dhcp-msg-authenticationclient-last-transaction-timeassociated-ip#93#97user-auth#99#100#101#102#103#104#105#106#107#108#109#110#111#112#113#114#115auto-configname-service-searchsubnet-selectiondomain-search-listsip-serversclassless-static-routescablelabs-client-configurationgeo-configvi-vendor-class-idvi-vendor-specific-info#126#127#128#129#130#131#132#133#134#135#136#137#138#139#140#141#142#143#144#145#146#147#148#149#150#151#152#153#154#155#156#157#158#159#160#161#162#163#164#165#166#167#168#169#170#171#172#173#174#175#176#177#178#179#180#181#182#183#184#185#186#187#188#189#190#191#192#193#194#195#196#197#198#199#200#201#202#203#204#205#206#207#208#209#210#211#212#213#214#215#216#217#218#219#220#221#222#223#224#225#226#227#228#229#230#231#232#233#234#235#236#237#238#239#240#241#242#243#244#245#246#247#248msft-classless-static-routes#250#251#252#253#254The value of the option.The value type of the option.The index of the (sub)option/enterprise number in the Option List.Add a DHCP Option Code to the Parameter Request List.Delete a DHCP Option Code from the Parameter Request List.List all DHCP Option Codes in the Parameter Request List.List all DHCP Option Codes that can be used in the Parameter Request List..RqOptions DHCP Options : %1 vendor-specific_infodhcp-server-identifierdhcp-parameter-request-listThe index of the option.Modify DHCP client trace configurationtracelistList DHCP client trace configurationPrint DHCP client statisticsClear DHCP client statisticswhether to Clear DHCP client statistics.DHCP client statistics: Corrupted packet recv : %[-5]0 OFFERs recv : %[-5]1 ACKs recv : %[-5]2 NAKs recv : %[-5]3 Pure BOOTP REPLIES : %[-5]4 Other message types : %[-5]5 DISCOVERs sent : %[-5]6 REQUESTs sent : %[-5]7 DECLINEs sent : %[-5]8 RELEASEs sent : %[-5]9 INFORMs sent : %[-5]10 Packet sent failures : %[-5]11 Memory usage: Table size of dyn leases: %12, in use: %13, free: %14(%12,%13,-,100,*,%12,/)%% Tracing: %0{enabled}{disabled} Enable/Disable tracing.renewRenew interface.DHCP Client Info : Interface : %[-10]0 DHCP Client State : [%1] HW address : %9 %E{ Link state : %11{up}{down} %15{ Last error : %15 }} IP Address : %6 %19{p-t-p IP : %19}{Netmask : %7} Default Gateway : %8 %E{ DNS Server 1 : %16 DNS Server 2 : %17 DHCP Server : %18{%18} Route metric : %4 DNS metric : %5 }(== Option 61) Client ID : %0 (== Option 77)%E{ User Class ID : %0 }(== Option 60)%E{ Vendor Class ID : %0 }(== expand 1) DHCP Transmitted Options : %0 %1{ Suboption : %[-3]1 }%2{ Enterprise : %[-10]2 } DHCP Requested Options : %0 (!= Value ) DHCP Received Options : (== Enable 1) %0{ Reboot phase starts within : %1 }{ Requesting known lease for : %2 Next REQUEST retransmission : %1 Retransmission timeout : %3 s REQUEST retransmissions left : %4 }{ Trying to get a lease for : %2 Next DISCOVER retransmission : %1 Retransmission timeout : %3 s DISCOVER retransmissions sent : %4 }{ Trying to get offered lease for : %2 Next REQUEST retransmission : %1 Retransmission timeout : %3 s REQUEST retransmissions left : %4 }{ Trying to renew lease for : %2 Next REQUEST retransmission : %1 }{ %5{Lease renews : %5}{Lease renewal point : passed} %6{Lease rebinds : %6}{Lease rebinding point : passed} %7{Lease expires : %7}{Lease expiring point : passed} }{ BOOTP lease : bound }{ Trying to INFORM : %2 Next INFORM retransmission : %1 Retransmission timeout : %3 INFORM transmissions sent : %4 }{ INFORMING : finished }The name of the dynamic interface to be configured.The client identity to be associated with the lease.The host name of the client to be associated with the lease.The vendor class identifier option to be associated with the lease.useridThe user class identifier option to be associated with the lease.The preferred dynamic IP address.leasetimeThe time in seconds the client wants to use an address.Accept domain name.Accept DNS server IP address.statrtAccept static routes.Accept gateway IP address.Route metric for default gateway and static routes.DNS route metric.%3d %-40sRENEWINGREBINDINGBOOTP-BOUNDINFORMINGINFORM-OK%3d %s%02x:%02x:%02x:%02x:%02x:%02x121331559585150dhcpdhcp clientdhccEnterpriseSubOptionTypeValueEnterpriseSubOptionOptionIPIntfNameDHCP.Client.Intf.{intf}.TxOptions.{option}(== Enable 0)DHCP.Client.Intf.{intf}.TxOptionsIndexOptionDHCP.Client.Intf.{intf}.RqOptions.{option}DHCP.Client.Intf.{intf}.RqOptionsIndexClearUsedLeasesMaxLeasesFailedPacketsInformReleaseDeclineRequestDiscoverOtherMessageTypesBOOTPRepliesNAKACKOfferCorruptPacketsDHCP.Client.StatsEnableDHCP.Client.Debug.TraceConfigRenew(== Enable 1)LeaseTimeRemainingRebindTimeRenewTimeRetransmissionCountRetransmissionTimeoutAcquiringTimeRetransmissionTimeStatusPointToPointServerDNSServer2DNSServer1LastErrorFollowLabelServerRouteBroadcastLinkStateDefaultGatewayNetmaskAddressDNSMetricRouteMetricLabelEnableDHCP.Client.Intf.{intf}DHCP.Client.IntfIP.IntfDHCP.Client.Intf.{intf}.TxOptions.51DHCP.Client.Intf.{intf}.TxOptions.50DHCP.Client.Intf.{intf}.TxOptions.77DHCP.Client.Intf.{intf}.TxOptions.60DHCP.Client.Intf.{intf}.TxOptions.61DHCP.Client.Intf.{intf}.TxOptions.12DHCP.Client.Intf.{intf}.RqOptions.1DHCP.Client.Intf.{intf}.RqOptions.51DHCP.Client.Intf.{intf}.RqOptions.58DHCP.Client.Intf.{intf}.RqOptions.59DHCP.Client.Intf.{intf}.RqOptions.6DHCP.Client.Intf.{intf}.RqOptions.15DHCP.Client.Intf.{intf}.RqOptions.33DHCP.Client.Intf.{intf}.RqOptions.3DHCP.Client.Intf.{intf}.RqOptions.121upgradesoftwarestart firmware upgradeRebooting in 1 second.. Error: reboot failed (errno=%d) Reboot the modem./bin/sleep %2d && /sbin/rebootDeviceConfigModify dhcp spoofing statecfglistDisplay dhcp spoofing stateAdd a Spoofing-AssociationDelete a Spoofing-AssociationEnable a Spoofing-AssociationDisable a Spoofing-AssociationList the available Spoofing-Associationsoption-addAdd a DHCP Option Code to a Spoofing-Association.option-deleteDelete a DHCP Option Code from a Spoofing-Association.Flush all the associations and the options.DHCP spoofing specific debug commands.Modify DHCP spoofing trace configuratinDisplay DHCP spoofing trace configuratinThe name of the Association.The option id.DHCP Spoofing Association DHCP Client DHCP Pool State %[-32]0 %[-32]1 %[-32]2 %3{enabled}{disabled} (!= name ).Option Options requested: %[3]0 Enable Association.pool_nameThe name of the pool to be associated.ifnameState: %0{enabled}{disabled} Enable/Disable spoofing.dhcp spoofingdhcspEnableDHCP.Spoofing.Debug.TraceConfigDHCP.Spoofing.Association.{name}.Option.{option}OptionNameDHCP.Spoofing.Association.{name}.OptionEnablePoolClientDHCP.Spoofing.Association.{name}DHCP.Spoofing.AssociationDHCP.Client.IntfDHCP.Server.PoolStateDHCP.SpoofingRouterConfigure bridge instance IGMP Snooping flags. Display bridge instance snooped groups.Configure bridge interface IGMP snooping flags and mode. Display bridge interface IGMP status.Interface configuration for "%0" : .Intf.{intf}Intf %[-10]0 : MODE = %[-8]1 FastLeave = %2 .IGMPSnoopingThe bridge instance currently to be configured.Bridge.{brname}The bridge interface currently to be configured.Bridge.{brname}.Intf.{intf}portmodeMode of the bridge port.fastleaveEnable/Disable Fast Immediate Leave.(or (== PortState disabled) (or (== PortState learning) (== PortState forwarding)))Bridge "%0" groups: IGMPSnooping = %1 forwardingtimeout : %2 lastmemberforwardingtimeout : %3 .IGMPSnooping.Groups.{group} %0: Intf %1 : via %2 mode Enable/Disable the IGMP Snooping.forwardingtimeoutBridge forwardingtimeout.lastmemberforwardingtimeoutBridge lastmemberforwardingtimeout.eth bridge igmpsnoopingigmpsnoopingFastLeaveModeNameLastMemberForwardingTimeoutForwardingTimeoutEnableNameBridge.{brname}Bridge.{brname}.Intf.{intf}.IGMPSnooping*.IntfVersionIntfAddressBridgeBridge.{brname}.IGMPSnoopingFailed to register this client. (%s%s%s) Failed to create_and_register this client context. Failed to allocate a client context. This client '%s' is already registered as a mbus client (tid = %d). CLI mbus client groupRegister cli client to mbusUnregister cli client from mbusModify client parametersExecute mbus commandAuthenticate a sessiontermsessionTerminate a sessionid of session to terminateAuthentication typeUser nameIP address of peer who inititated the authentication request.cleartextmd5cryptMbus command nameParameter nameParameter value to setgettypeGet type elements (default=param)depthNumber of levels to recurse, default=-1 (all)processcmdProcess SET_VALUE command flag (default=enabled)onerrorrollbackon error rollback flag (default=enabled)usecallbackUse result callback function (default=enabled)filterThe filter should be formatted as '(operator operand operand)'. Possible operators are ==, !=, <, <=, >, >=, and, or, not. The left operand is a parameter name. The right operand is a parameter value. For boolean operators the operands are filters. Example: '(== Name eth0)'.Fully qualified mbus pathClient command data flagsComma separated names of accessrights groupsType of accessright actionmodifierAccessrights modifierreplytypeType of accessrights replyRequested attribute-typegetallowedgetdisallowedgetasconfiguredallow_onlyallow_exceptwriteattrchgindexpathkeystrpathuncommittedsynchronizesub_addobjsub_delobjsub_updatexref_localidxxref_keypathexact_depthapplyonparamsapplyrecursivetypetreepathnon_persistentgetpathgetcountgetnamesgetvaluessetvaluesubscribeunsubscribegetaccessrightssetaccessrightswritelockGet/release mbus writelockwlgetimeoutWritelock get timeout in seconds (forever=-1, *default=nowait=0)wlidletimeoutWritelock idle timeout in seconds (forever=-1, *default=30)Path type (default = indexpath)sessionid to useSelect mbusd datamodel tree.dlinkDaemon link (default = local_ipc)mbusd_addrDaemon address (ip addr for inet)refresolvUse reference resolving (default=disabled)local_ipcremote_inetAuthenticated sessions: No authenticated session for this cli client dbg_ccmd_replyCommand MBUS_CCMD_GET_PATH: Command MBUS_CCMD_GET_COUNT: Command MBUS_CCMD_GET_NAMES: Command MBUS_CCMD_GET_VALUES: Command MBUS_CCMD_SET_VALUES: Command MBUS_CCMD_ADD_OBJECT: Command MBUS_CCMD_DEL_OBJECT: Command MBUS_CCMD_SUBSCRIBE: Command MBUS_CCMD_UNSUBSCRIBE: %s(%s) = %s%s (%s, levels)(%s ,%s %s: !(%s) All, !(%s) All instance id='%s' created%-10s (delayed) (buffered) (not processed) (rollback('%s') sent to plugin)DeletedSubscription failed: '%s' (%s)Subscribed: '%s' (id = %s)Unsubscription failed for id=%s (%s)Removed subscription (id = %s)dbg_event_handlerReceived event id=%lu, (%s) from subscr=%lu path='%s' name='%s' ori_value='%s' value='%s'%s_%02xFailed to allocate registration errstr. Failed to init client ipc socket. (%s) Failed to set client mbusd ipc address. (%s) Failed to init client inet socket. (%s) 127.0.0.1Failed to set client mbusd inet address. (%s) Failed to set specified client datamodel. (%s) This client isn't registered as a mbus client. Failed to unregister this client from mbus. linked with libmbus: v%s This client isn't yet registered as a mbus client. datamodel: '%s' cli client name: '%s' mbus ctx id: %lu mbus ctx sessionid: %lu writelock get timeout: %ld writelock idle timeout: %ld current path: '%s' request list length: %d items Failed to obtain the writelock (%s). Failed to release the writelock (%s). Invalid sessionid specified for this mbus client. This client isn't registered yet as a mbus client. Error: specified more then one path type. error: param required for unsubscribe cmd. error: action required for getaccessrights cmd. error: modifier required for setaccessrights cmd. error: action required for setaccessrights cmd. invalid command - clientcmd reset construction of command failed: %s - clientcmd reset The mbus client command failed (%s) Queued %d items on the clicommand list. Unknown authentication type. No local client_cli session slot available, please terminate a session first. Failed to init credentials. (%s) Failed to set clientipaddr in credentials. (%s) Successfull %s authentication, sessionid=%lu, groupmaskpos=%lu wanindicator=%s Error while authenticating (%s) Unable to find specified sessionid for this mbus client. Successfully terminated session %lu for this mbus client. Error while terminating session %lu (%s) mbusError mbus_client_cli_init: Missing client cli name. MBUSCmbus_cliclientqTq`qlqxqqqqqqqqqq(qqq qq0qhqqqqLqqqq,q%5d !add,del,!del,upd,!upd,uncommitted,committed%s%s%s%s Management bus commands group.listenumsDisplay the registered enumtypeslisttypesDisplay the registered objecttypesDisplay the object instanceslistcontextsDisplay the context instanceslistsubscriptionsDisplay the subscription instancesplugineventSimulate event from pluginUnregister a client/plugin contextSave the current configurationLoad configurationFlush the saved configurationexportExport the configurationimportImport the configurationxmldumpDump the registered datamodel to an XML fileMbus debug commands groupDisplay mbus statistics.Reset mbus statistics.Modify mbus trace settings.loadobjectsLoad/sync object instances from pluginsunloadobjectsUnload object instancesPath typeFlush objects before load (default=disabled)eventingSend events for added/deleted objects (default=disabled)Path type (default = indexpathnotifypluginNotify plug-in when recursively deleting objects (default=enabled)Select mbus trace level (0-4).Filename.Select output file format.unixwindowscachingCache to improve the speed of savingEnforce saving unghanged dataFully qualified mbus path to list.Select message-based client/plugin context id.ctxidPlugin context idEvent typePlugin event subpathPlugin event namePlugin event valueorivaluePlugin event orivaluePlug-in event flagsDetails enabled/disabledoutputList output typeshowflagsDisplay object flags (Clean or Dirty / Persistent or Volatile)Filter enumtypes by (part of) the nameWARNING: Maximum mbus tracelevel by compilation is %d mbus trace : %swritelock: free writelock owner: ctx=%lu:%lu (%s, %lus idle, idletimeout=%lus) delay list length: %d items guest group index: %d mbus event stats cleared (cfr. >mbus debug stats) mbus context stats cleared (cfr. >mbus listcontexts) cli - list enumtypescli - list objecttypescli - list objects%-7s %-20s %-30s %-20s %-5s %-10s cli - list subscriptionsowner ctx---------%-30s %7ld %-20s cli - load objectsERROR loading objects (%s) cli - unload objectsERROR unloading instances for path '%s' (%s) [CLI] Error: %s. failed to find the context by idfailed to allocate the eventfailed to allocate the cmddatafailed to add the cmddata to the eventfailed to append to plugin eventInvalid context id specified. Only message-based contexts can be unregistered. Failed to unregister context '%s' (%s). Succcessfully unregistered context '%s' mbus trigger grouplist trigger objectscli - mbusmod list objectsAC_BEAC_BKAC_VIAC_VOCCMPConfigures wireless interface parameters.Shows wireless interface parameters.secmodeWireless security settings.Wireless Debug commandsstationsShow Wireless Stations InfoWireless Multimedia settingsmacaclWireless MAC access control list settings. Reset Wireless interface. preceedreset interfaceAccess Control List configurationStart a registration process (only for register mode)Add an ACL MAC entryModify an ACL entryDelete an ACL MAC entryShows a list of all configured ACL entriesShows config and register infoFlushes ACL entriesACL Config and Register info: Control : %0 Registeration : %1 ACL entry list info: -------------------------------------------- Station Name : %0 Hardware Address : %1 Permission : %2 hardware address of the ACL entryThe Ethernet MAC address of the ACL entrypermissionThe action to be performed on ACL entryThe name of the stationproceedConfirmation requiredAccess Control List modeconfigure QoS settingsapacconfigconfigure AP EDCA parametersstaacconfigconfigure STA EDCA parametersmodelistshow QoS settingsapaclistshow apac settingsstaaclistshow staac settingsSTA EDCA table: ---------------------------- Class : %0 CWMin : %1 CWMax : %2 AIFSN : %3 ACM : %4 TXOP : %5 Units : %6 The class indeAP EDCA table: WLAN WMM Mode info: Mode : %0 AC classcwmaxCWmax configurationcwminCWmin configurationaifsnAifsn configurationtxoptxoplimit [us] configuration316312725551110232047409581911638332767WMM activeackpolicyWMM NoAck activenormalnoackwmmList of the currently associated stationsStations info: Station Name : %0 Hardware Address : %1 Flags : %2 The MAC address of stationTransfer statisticsTransfer statistics: Good Rx Packets : %0 Bad Rx Packets : %1 Good Tx Packets : %2 Bad Tx Packets : %3 Configure the security mode.wepConfigure WEP settings.wpa-pskConfigure WPA-PSK settings.Show the security mode.weplistShow the security wep info.wpapsklistShow the security wpa-psk info.WPA PSK: encryption : %0 presharedkey : %1 WEP key info: WEP key : %0 Security Mode info: Mode : %0 encryptiondata encryption (TKIP or AES)presharedkeyWPA-PSK key: expected format 8 to 63 ASCII characters or 64 HEX digits.WEP key: expected format 5 or 13 ASCII characters, or 10 or 26 HEX digits.wpaWLAN Info Display: state : %0 channel : %1 ssid : %2 any : %3 interop : %4 protection : %5 protmode : %6 shortslot : %7 frameburst : %8 rateset : %9 txpower : %10 Interface operational status of wireless access pointchannelThe communication channel numberssidThe Network name (SSID)Accept stations with any SSIDinteropInteroperability modeprotmodeProtection modeframeburstFrameburstingtxpowertxpower settingdisabledctsstoselfrtscts1,2,5.5,111b,2b,5.5b,11b,wirelesswlanEnableRegistrationControlPermissionMACAddressNameWLAN.Intf.wl0.ACL.MAC.{hwaddr}WLAN.Intf.wl0.ACL.MACWLAN.Intf.wl0.ACLUnitsTXOPACMAIFSNCWMaxCWMinClassWLAN.WMM.STAEDCAWLAN.WMM.APEDCAEnableWLAN.WMM.STAEDCA.{class}WLAN.WMM.APEDCA.{class}WLAN.WMMFlagsMACAddressNameWLAN.Intf.wl0.Station.{hwaddr}WLAN.Intf.wl0.StationInvalidPacketsSentValidPacketsSentInvalidPacketsReceivedValidPacketsReceivedWLAN.Intf.wl0.StatsPSKEncryptionWEPKeyModeWLAN.Intf.wl0.Security.WPAPSKWLAN.Intf.wl0.Security.WEPWLAN.Intf.wl0.SecurityTxPowerRateSetFrameburstShortSlotProtectionModeProtectionInteropModeAnySSIDSSIDChannelWLAN.Intf.wl0+/,9GEI%4ld:%02ld:%02ld.%02ld%0*ld %s %8p - %02xName Addr Size BSize Total MUse CUse NoMem Block ---- ---- ---- ----- ----- ---- ---- ----- ----- %-8s %8p%7d%7d%7d%6d%6d%7d %8p Total/max/used dynamic memory = %ld/%ld/%ld bytes (%ld%%/%ld%%) IWUMPGBLalloc.cpool_free() errorpool_alloc() detected invalid poolpool_check() detected invalid poolVHDRvb_skip_hdr: not enough header space.vb_recover_hdr: not enough space to add header.All proxy commands.Configure the IGMP proxy.Configure an IGMP proxy interface.Show the configuration of an IGMP proxy interface.grouplistShow the learned groups on an IGMP proxy interface.mbslistShow the IGMP proxy membership database (merge of all learned groups).IGMP proxy specific debug commands.Flush all IGMP proxy settings and learned groupsModify IGMP proxy trace configurationPrint IGMP proxy statisticsClear IGMP proxy statisticsThe name of the IGMP proxy interface to be listed.The name of the IGMP proxy interface to be configured.The state of the IGMP proxy interface.The IGMP version of the IGMP proxy interface.Enable/Disable the immediate deletion of a group when a leave is received.downstreamupstreamEnable/Disable the IGMP proxy.qiThe interval in seconds between general queries sent by the querier.qriThe maximum response time in seconds for an IGMP client in reply to general queries.lmqiThe maximum response time in seconds for an IGMP client in reply to group specific queries.The robustness variable allows tuning for expected IGMP packet loss.requireraEnable/Disable the router alert IP option check.localgroupEnable/Disable the processing of a local multicast group in an IGMP packet.IGMP proxy state : %s Query Interval : %s Query Response Interval : %s Last Member Query Interval : %s Robustness variable : %u Router alert IP option check : %s Process local multicast group : %s Could not set operational state Illegal value for Query Interval (qi). Query Interval must be bigger than the Query Response Interval (qri). Could not set Query Interval (qi). Illegal value for Query Response Interval (qri). Query Response Interval must be less than the Query Interval (qri). Could not set Query Response Interval (qri). Illegal value for Last Membership Query Interval (lmqi). Robustness variable must be bigger than 1. Invalid state specified. Unknow error code received. Invalid version specified. Unknown interface specified. Invalid interface specified. Querier%-19s %-10s %-7s %-16s - -%-3u %-15s %-10s %-7s %-15s %c %*c Query interval expires : %s %*c Other Querier present expires : %s %*c Querier's Query Robustness variable: %-2u %*c Fast Leave : %s %-3u %-15s %-15s %-11s%*c%s %*c Expires : %s %*c Version : %s %*c IGMPv1 Host present expires: %s %*c IGMPv2 Host present expires: %s %*c %s (Expires: %s) %*c Sources to be forwarded : %-19s %-15s %-11s %-6s Filter-Mode%-15s %-15s %-6s %-15s %-7s [%-2u/%-2u] Tracing: %s IGMP proxy statistics: Total IGMP packets recv : %u Too short IGMP packets recv : %u Too long IGMP packets recv : %u IGMP packets with bad checksum recv : %u IGMP packets with bad ttl recv : %u IGMP packets with no route alert option recv: %u IGMPv1 queries recv : %u IGMPv2 queries recv : %u IGMPv3 queries recv : %u IGMP bad queries recv : %u IGMP queries fail : %u IGMPv1 reports recv : %u IGMPv2 reports recv : %u IGMPv3 reports recv : %u IGMP bad reports recv : %u IGMP leave reports recv : %u IGMP bad leave reports recv : %u IGMPv1 queries sent : %u IGMPv2 queries sent : %u IGMPv3 queries sent : %u IGMP query election switch : %u igmp proxyPPPOERLY[pppoe relay] port %s DOWN, cannot send PADT [pppoe relay] PADT sent to port %s: %s [pppoe relay] F - cannot deliver packet to PPPoE driver, PADT dropped with unknown message codewith invalid versionwith invalid typewith invalid lengthwith invalid session-id[pppoe relay] PAD%c %s from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADI relayed from <%s> to <%s> [pppoe relay] F - cannot deliver packet to PPPoE driver, PADI dropped [pppoe relay] PADO without relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADO with invalid relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADO with invalid port index in relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] port %s DOWN, cannot relay PADO received from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADO relayed from <%s> to <%s> [pppoe relay] F - cannot deliver packet to PPPoE driver, PADO dropped [pppoe relay] PADR without relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADR with invalid relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADR with invalid port index in relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] port %s DOWN, cannot relay PADR received from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADR relayed from <%s> to <%s> [pppoe relay] F - cannot deliver packet to PPPoE driver, PADR dropped [pppoe relay] PADS without relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADS with invalid relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADS with invalid port index in relay-id tag from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] port %s DOWN, cannot relay PADS received from %02x:%02x:%02x:%02x:%02x:%02x on port %s ST-PPPoE relay: inactive session terminated by relay agentST-PPPoE relay: unable to allocate session[pppoe relay] PADS relayed from <%s> to <%s> [pppoe relay] F - cannot deliver packet to PPPoE driver, PADS dropped [pppoe relay] port %s DOWN, cannot relay PADT received from %02x:%02x:%02x:%02x:%02x:%02x on port %s [pppoe relay] PADT relayed from <%s> to <%s> ST-PPPoE relay: relay agent client port went downST-PPPoE relay: relay agent AC port went downST-PPPoE relay: port closed by relay agentprpoprseprpeprharzrzr|r|r}dr}tr}r}PPPOE_STATE_DISABLEDPPPOE_STATE_INITIALPPPOE_STATE_WAITINITPPPOE_STATE_WAITOFFERPPPOE_STATE_WAITREQUESTPPPOE_STATE_WAITCONFIRMPPPOE_STATE_CONNECTEDPPPOE_STATE_TERMINATEDWasn't me, babe. Wasn't me.Unknown Access Service Name: [pppoe] E - PADT not sent. Out of buffer resources. [pppoe] E - PADT sent for service %s [pppoe] I - requested service not available [pppoe] I - No service specified, listing all services. [pppoe] E - Valid PADI received [pppoe] E - PADO not sent. Out of buffer resources. [pppoe] I - Extra offer %s [pppoe] I - %s Offered %s [pppoe] E - valid PADR received [pppoe] E - PADS not sent. Out of buffer resources. [pppoe] received servicename tag. [pppoe] E - PADS sent by %s for service %s [pppoe] F - PADO received with non-zero session id [pppoe] F - PADO bigger than specified in length field [pppoe] I - valid PADO received [pppoe] I - trying to connect ... building PADR [pppoe] E - PADR not sent. Out of buffer resources. [pppoe] I - requesting NULL service received in PADO [pppoe] I - PADO contains NULL service [pppoe] I - requesting service %s received in PADO [pppoe] I - AC not specified, choosing : %s [pppoe] I - Found matching access concentrator : %s [pppoe] F - PADO contains SERVICENAME error : %s [pppoe] F - PADO contains SERVICENAME error [pppoe] F - PADO contains GENERIC error : %s [pppoe] F - PADO contains GENERIC error [pppoe] F - PADO contains relay session ID of invalid length [pppoe] E - PADR sent, entering state WAITCONFIRM (service %s from %s requested) [pppoe] F - unable to allocate vbuf, retransmission timer stopped !!! [pppoe] I - Scanning for services ... Filling buffer [pppoe] I - AC = %s [pppoe] I - service offered : %s. [pppoe] F - PADO contains SERVICENAME error : %s [pppoe] I - service already in list [pppoe] I - out of pppoe scan buffer resources. [pppoe] F - PADS bigger than specified by length field. [pppoe] F - Host unique id missing in PADS. [pppoe] F - PADS not expected, PPPoE client not in WAITCONFIRM state. [pppoe] F - PADS contains SERVICENAME error : %s [pppoe] F - PADS contains SERVICENAME error [pppoe] F - PADS contains AC-SYSTEM error : %s [pppoe] F - PADS contains AC-SYSTEM error [pppoe] F - PADS contains GENERIC error : %s [pppoe] F - PADS contains GENERIC error [pppoe] F - PADS contains zero session id. [pppoe] F - service missing in PADS. [pppoe] E - PADS received, %s confirmed service %s [pppoe] E - PADT received service %s [pppoe] I - Resent packet [pppoe] F - unable to allocate vbuf, packet not sent after rexmit timer expiry !!! [pppoe] E - AC session started [pppoe] E - PADI not sent. Out of buffer resources. [pppoe] E - PADI sent, entering state WAITOFFER rrrrrrrrrrr8rDrr,rtrrrdestination ureacheblesource quenchrouter advertisementrouter solicitationtime exceededparameter problemtimestamp replyinformation requestinformation replyaddress mask requestaddress mask replyecho replyInvalid expression typeExpression with same name already existsExpression memory exhaustedExpression does not existExpression still in useInvalid subexpression indexSubexpression already existsExpression type mismatch8 rrrrr$r8rXrprdrprrr[%s] CN verification: strcasecmp(%s,%s)=%d%sCN[%s] CN verification failed (%s)%sSSL /active//dl/tls/241231000000Z050101000000ZInternet GatewayTHOMSONSpeedtouchEeSSL_UNKNOWN_ERROREeSSL_SUCCESSEeSSL_API_ERROREeSSL_SOCKET_ERROREeSSL_INIT_ERROREeSSL_CERTIFICATE_ERROREeSSL_INVALID_PROTOCOLEeSSL_NO_FREE_ENTRYEeSSL_ENTRY_NOT_PRESENTEeSSL_INVALID_ACTION_ON_SOCKETEeSSL_INVALID_APP_CONTEXT_IDEeSSL_UNKNOWN_SSLOPTEeSSL_SOCKET_STUBError while reading certificate file.[invalid date]Key StrengthIssuerNot AfterNot BeforeSubjecttrusted certificate(s)certificate/private key pairCreatingAssigningExportingImportingremote_upgradedSSLAPI %scert%02d%02d.pem%-14s: %s %s%d-%s%d bit[public key error]OU[%s] %d %s loaded (%s) /dev/urandom[%s] Error when creating data dir (%s) DES part of SSLeay 0.8.2b 08-Jan-1998libdes v 3.24 - 20-Apr-1996 - eaydes(%s,%s,%s,%s)ptrrisc1@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                              @ @ @ @ @ @ @ @ @ @ @ @ @ @@ @ @ @ @ @ @ @ @ @ @@ @ @ @ @@ @@B@B@B@@@BB@BBB@B@@@@BBB@BB@BB@@                ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   !"#$% !"#$%&'()*+,-./0123456789:;<=>?@ABCD        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||DES3DESRC2RC4MD5MD2SHA1SHA256SHA512slsXsDs4s$sssssssssss|sssssss|slsXsLs@s4s,s ssB/q7Dۥ9V[Y?^[$1U }r]tޱtiG$ -,oJt\vژ>QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGXsXsDs0s ssssspsdsXsLsDs8s,s RRRR jjjj000066668888@@@@||||9999////4444CCCCDDDDTTTT{{{{2222####====LLLL BBBBNNNN....ffff(((($$$$vvvv[[[[IIIImmmm%%%%rrrrddddhhhhԤ\\\\]]]]eeeellllppppHHHHPPPP^^^^FFFFWWWWث XXXXEEEE,,,,????kkkk::::AAAAOOOOggggꗗ𴴴sssstttt""""筭55557777uuuunnnnGGGGqqqq))))ʼnoooobbbbVVVV>>>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% (>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTcc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,: @6sss restart Modified CNX: line %d, cnx_idx %d result %d delete_dcnx: line %d, cnx_idx %d VKAPI: vkapi_rtp_ep_onhook : cleaning up tone sessions lep.crecvfrom dsp socket failedvkapicmd_%pvkapi_mgmtlibep_event: libep == NULL libep_event: unknow event Event Failure !!!! libep_service: libep == NULL FD_ACTIVITY_WRITE not supported FD_ACTIVITY_READWRITE not supported libep_register_fd: invalid (%d) [VKAPI]: libep_register_ep: registering %s libep_register_ep: unknown libep type Too many ep registered (%d)[VOIPAPI]: libep_register_ep: ep->stack.config(ep, EP_CNF_LINK_MODE, EP_LINK_MODE_NORMAL) [VKAPI]: libep_unregister_ep: unregistering %s ep not found, cannot unregister[VKAPI]: libep_register_timer: registered %d ms [VKAPI]: libep_unregister_timer [VKAPI]: ep_play_tone() [VOIPAPI]: ep_play_tone() : ep->stack.cmd(ep, EP_CMD_TONE_GEN, %d) [VOIPAPI]:vkapi_lep_tone: ep->stack.config(ep, EP_CNF_MESSAGE_WAITING, 1) [VOIPAPI]:vkapi_lep_tone: ep->stack.config(ep, EP_CNF_MESSAGE_WAITING, 0) VKAPI: vkapi_lep_tone: unknown tone ! (%d) ep_evt_dtmf_ind on %s [VKAPI]: ep_evt_dtmf_ind: sending event %d [VKAPI]: pstn_evt_release_ind [VKAPI]: ep_event: NULL ep [VOIPAPI]: ep_event(): event %d ep_evt_call_ind on %s Aborting ringtest (outgoing call) [VOIPAPI]: send signal to stop the ring [VOIPAPI]: send signal to stop the multiring ep_evt_call_answer on %s [VOIPAPI]: ep_evt_call_release() : g_lep_pstn->stack.cmd(g_lep_pstn, PSTN_CMD_RELEASE_REQ) [LEP]: ep_evt_faxmodem_tones: MACHINE event [LEP]: ep_evt_faxmodem_tones: MODEM event [LEP]: ep_evt_faxmodem_tones: FAX event ep_evt_faxmodem_tones: unknow cause %d ep_evt_faxmodem_tones: invalid line_id !! [VKAPI]: ep_event: unknow event %d [VKAPI]: ep_service: NULL ep EP_SRV_UNREGISTER_CHANNEL_AUDIOEP_SRV_REGISTER_CHANNEL_AUDIO[VOIPAPI]: ep_service: %s [VKAPI]: ep_service:service %d not implemented pstn_evt_dial_end [VKAPI]: pstn_evt_call_ind pstnapi_event: unknow command %d [VKAPI]: pstn_register_timer: registered %d ms [VKAPI]: pstn_unregister_timer pstnapi_service: undefined service %d [VKAPI]: pots_ringtest_timer_cb [VOIPAPI]: pots_ringtest_timer_cb: send signal to stop the ringing VKAPI:lep.c -> starting pairing, timeout = %ds VKAPI:lep.c -> stopping pairing [VOIPAPI]: dect_ringtest_timer_cb: send signal to stop the multiringing [VKAPI]: vkapi_lep_dect_config Could not open event sockCould not bind event sockRTSTPSTN[VKAPI]: send_signal %s(%d) %s to line %d [VKAPI]:send_signal: cannot continue, ep = 0x%x, libep = 0x%x [VKAPI]:Aborting ringtest (incoming call) [VOIPAPI]:send_signal: ep->stack.cmd(ep, EP_CMD_RING_ON) [VOIPAPI]:send_signal: ep->stack.cmd(ep, EP_CMD_RELEASE) [VOIPAPI]:send_signal: libep->stack.cmd(libep, LEP_CMD_MULTI_RING) [VOIPAPI]:send_signal: libep->stack.cmd(libep, LEP_CMD_MULTI_RELEASE) Starting Ringing test for DECT... Starting Ringing test for FXS... [VOIPAPI]:send_signal: ep->stack.cmd( ep, EP_CMD_DTMF_REQ) [VOIPAPI]:send_signal: ep->stack.cmd( ep, EP_CMD_OFF_HOOK_MSG) [VKAPI]: start_sas() [VKAPI]: stop_sas() [VOIPAPI]:send_signal: ep->stack.cmd( ep, EP_CMD_ON_HOOK_MSG) call_setup: %s [VOIPAPI]:vkapi_lep_caps: ep->stack.config(ep, EP_CNF_SUPPORTED_CODECS) [VOIPAPI]:vkapi_lep_caps: ep->stack.config(ep, EP_CNF_ENABLE/DISABLE_DTMF_REJ) u0u0u0uu,uٴu۔u uudu@u(uHuupudu8u|u|udu@uuxuLuuuuuuuup v\v\v\v\v$v\v\v\v uv v\v\v v v vxv v vvvvvvvvvvvvvvvvv,v Flag[%s-%X] in ctx(%p) not set[%X] text[%s] %s[%s]: Unregister FD(%d) %s-%u: WARNING -> FXS FD not used in libep(%p) %s-%u: FAILURE -> [ %s ] -> Error unregister FD(%d) %s-%u: RETURN -> still remain End Point number(%d) in LEP(%p) %s-%u: EXIT -> No private context present(%p) in LEP(%p) %s-%u: WARNING -> DECT_CMD FD not used in libep(%p) %s-%u: WARNING -> DECT FD not used in libep(%p) DSPIPC_RESET_ALL_PORTS_DONESAGEM_MODIFY_USER_DEBUGDSPIPC_INIT_PORT_DONEDSPIPC_CLOSE_PORT_DONEDSPIPC_MODIFY_PORT_CODEC_DONEDSPIPC_QUIT_TONE_DONEDSPIPC_GEN_TONE_DONEDSPIPC_RING_EXPIREDDSPIPC_DIGIT_RECEIVEDDSPIPC_TONE_EXPIREDDSPIPC_INTER_DIGIT_EXPIREDSLIC_OFFHOOK_EVENTSLIC_ONHOOK_EVENTDSPIPC_CALLERID_PLAY_DONESLIC_FLASHHOOK_EVENTDSPIPC_SYNC_ERRORDSPIPC_CNG_TONE_REPORTDSPIPC_SIN_FAXTONE_DETECTEDDSPIPC_mMODEMREADYDSPIPC_FAX_DEBUGDSPIPC_RIN_FAXTONE_DETECTEDDSPIPC_RIN_MODEMTONE_DETECTEDDSPIPC_SIN_MODEMTONE_DETECTEDDSPIPC_DIGIT_TONE_END_REPORTDSPIPC_DIGIT_TONE_START_REPORTDSPIPC_DIGIT_TONE_CONT_REPORTDSPIPC_QUIT_THREE_WAY_CONFERENCE_DONEDSPIPC_INIT_THREE_WAY_CONFERENCE_DONEDECT_GLOBAL_INIT_DONEDECT_REMOVE_DONGLERTP_CMD_STOPDECT_ADD_DONGLEDECT_ADD_HANDSETDECT_REMOVE_HANDSETDECT_OFFHOOKDECT_ONHOOKDECT_DTMFDECT_DTMF_EXPIREDDECT_TONE_EXPIREDDECT_RING_EXPIREDDECT_INIT_DONEDECT_CODEC_UPDATE_DONEDECT_CLOSE_DONEDECT_CALLERID_DONEDECT_TONE_ON_DONEDECT_TONE_OFF_DONEEP_CMD_RING_ONEP_CMD_RELEASEEP_CMD_TONE_GENEP_CMD_DTMF_REQEP_CMD_ON_HOOK_MSGEP_CMD_OFF_HOOK_MSGEP_CMD_DEBUGRTP_CMD_STARTRTP_CMD_UPDATERTP_CMD_DTMF_DIR_RTPRTP_CMD_DTMF_DIR_BOTHRTP_CMD_DTMF_DIR_PHONE%s-%u: ERROR -> Initialize Fas machine %s: End %s: Begin %s: Set State[%s-%d] in Ctx(%p) with state[%d] HARDCOVOIP_STATE_BASE_INITIALIZE%s: WARNING -> State[%s-%d] in ctx(%p) already set %s-%u: ERROR -> Initialize Fsm Ep Dev machine %s-%u: ERROR -> Initialize Fsm Ep Sig machine %s-%u: ERROR -> Initialize Fsm Cnx Rtp machine %s: Not implemented yet ! %s-%u: RETURN -> [ %s ] -> Error on type driver(%d) %s-%u: RETURN -> FXS-LEP(%p) doesn't match internal reference(%p) %s-%u: RETURN -> LEP is NULL %s-%u: RETURN -> DECT-LEP(%p) doesn't match internal reference(%p) %s-%u: RETURN -> still remain actif TIMER in LEP(%p) %s-%u: RETURN -> still remain stack.stack context(%p) in LEP(%p) %s-%u: FAILURE -> Lack LibEndPoint driver.service Libep(%p) %s: Unset flags[%s-%X] in Ctx(%p) with Flags[%X] HARDCOVOIP_FLAGS_LIBEP_DEV_OPENHARDCOVOIP_FLAGS_LIBEP_REGISTER_FD%s-%u: EXIT -> Bad magic(%x) in LEP(%p) %s: Base Initialize Already Done /dev/dect/dev/dect_cmd/dev/dsp%s: FAILURE -> Base State(%u) unknown %s: Base Not Initialize yet %s: Set flags[%s-%X] in Ctx(%p) with Flags[%X] %s[%s]: Allocated memory hardcoVoip_libep(%p) %s[%s]: Allocated memory libep(%p) %s[%s]: Type driver(%d) %s: FAILURE -> Modify debug(%d) %s: WARNING -> Flag[%s-%X] in ctx(%p) already set[%X] text[%s] %s[%s]: Open /dev/dectCmd fd(%d) %s-%u: RETURN -> [ %s ] -> Error open /dev/dsp %s[%s]: Type libep(%d) %s[%s]: Open /dev/dsp fd(%d) %s[%s]: Open /dev/dect fd(%d) %s-%u: RETURN -> [ %s ] -> Error allocating memory libep %s-%u: RETURN -> [ %s ] -> Error allocating memory hardcoVoip_libep %s-%u: RETURN -> [ %s ] -> Cmd SET_DEBUG_LEVEL Error %s-%u: RETURN -> [ %s ] -> Error open /dev/dectCmd %s-%u: RETURN -> [ %s ] -> Error open /dev/dect %s-%u: RETURN -> Bad version hardco(%u.%u) hardco(%u.%u) %s-%u: FAILURE -> Lack Pstn driver.service pstn_driver(%p) HARDCOVOIP_FLAGS_PSTN_REGISTER_FDHARDCOVOIP_FLAGS_PSTN_DEV_OPEN%s-%u: RETURN -> Pstn reference is null %s-%u: RETURN -> Pstn reference(%p) doen't match internal reference(%p) %s-%u: EXIT -> No private context present(%p) in PSTN(%p) %s-%u: WARNING -> Pstn FD not used in pstn_driver(%p) %s-%u: FAILURE -> Error register FD(%d) %s: Register FD(%d) %s-%u: EXIT -> Bad magic(%x) in PSTN_DRIVER(%p) /dev/fxo%s-%u: Open /dev/fxo fd(%d) %s: RETURN -> Error allocating memory hardcoVoip_pstn %s-%u: RETURN -> Error allocated memory pstn_driver %s-%u: RETURN -> Error open /dev/fxo %s-%u: RETURN -> Pstn reference is NULL %s-%u: RETURN -> No private context present(%p) in PSTN(%p) %s-%u: RETURN -> RTP reference(%p) doesn't match internal reference(%p) %s-%u: RETURN -> Rtp reference(%p) is NULL HARDCOVOIP_FLAGS_RTP_DEV_OPEN%s: close /dev/rtp %s-%u: EXIT -> Bad magic(%c) /dev/rtp%s-%u: RETURN -> Bad version dev(%u.%u) lib(%u.%u) %s: Allocated memory hardcoVoip_rtp(%p) %s: Allocated rtp_driver %s: Open /dev/rtp fd(%d) %s-%u: RETURN -> Error allocating memory hardcoVoip_rtpDriver %s-%u: RETURN -> Error allocating rtp_driver %s-%u: RETURN -> Error allocated memory rtp_ioctlVersion %s-%u: RETURN -> Error open /dev/rtp %s-%u: RETURN -> Error ioctl GET_VERSION(%p) HARDCOVOIP_FAS_FLAG_Unregister_ep%s-%u: Return FAILURE -> Libep(%p) -> Bad type audio(%u) %s-%u: RETURN -> Ep reference is NULL %s-%u: RETURN -> still remain stack.stack context(%p) in EP(%p) %s[%s]: Unregister EP(%p) %s-%u: FAILURE -> [ %s ] -> Error unregister EP(%p) HARDCOVOIP_FAS_FLAG_Register_ep%s-%u: EXIT -> Bad magic(%x) in EP(%p) %s-%u: EXIT -> No private context present(%p) in EP(%p) %s-%u: EXIT -> No LEP present in EP(%p) HardcoVoip User Ep DevHardcoVoip User Ep SigDECTUSB:CHANNEL_%dFXS:CHANNEL_%d%s-%u: FAILURE -> Libep(%p) Error initialize default param en EP(%p) %s[%s]: Allocated memory driver_ep(%p) %s[%s]: Allocated memory Ep(%p) %s[%s]: Register EP(%p) %s: WARNING -> Prb allocating name reference %s: FAILURE: Register User Ep Dev to FSM %s: WARNING -> Prb allocating Ep name reference %s: FAILURE: Register User Ep Sig to FSM %s-%u: FAILURE -> [ %s ] -> Error register EP(%p) %s-%u: FAILURE -> [ %s ] -> Error allocated memory ep %s-%u: FAILURE -> [ %s ] -> Error allocated memory hardcoVoip_base.ep %s-%u: FAILURE -> Initialize Ep in Libep(%p) on channel(%u) HARDCOVOIP_FLAGS_LIBEP_STACK_INITIALIZE%s[%s]: Register FD(%d) %s[%s]: Initialize FXS for channel(%u) on libep(%p) %s[%s]: Wait for Initialize DECT on libep(%p) %s-%u: FAILURE -> [ %s ] -> Error register FD(%d) %s-%u: EXIT -> Bad magic(%x) lep(%p) %s-%u: RETURN -> Libep reference(%p) is NULL hardcoVoip_libep_cnfvZv[v[(v[lvZvZHvZ,vY Magic[%s-%X] Ctx[ptr(%p) magic(%X)] text[%s] LEP_MAGICHARDCOVOIP_MAGIC_LIBEP%s: Return FAILURE -> Ioctl DECTCTL_REGISTER_OPEN %s: BASE_VERSION [ version(%d) vendor(%d) ] %s-%u: [STACK->DRIVER-%s: LEP_CNF_NETWORK_AVAILABLE] Liebp(%p) -> Not implemented yet %s-%u: [STACK->DRIVER-%s: LEP_CNF_PAGE] Libep(%p) -> Not implemented yet %s-%u: Cnf country on DECT -> Not implemented yet ! %s-%u: (STACK->DRIVER-%s: LEP_CNF_DATE] Libep(%p) -> Not implemented yet %s-%u: [STACK->DRIVER-%s: LEP_CNF_CODEC] Libep(%p) -> Not implemented yet %s-%u: (STACK->DRIVER-%s: LEP_CNF_LOG] Libep(%p) -> Not implemented yet %s-%u: [STACK->DRIVER-%s: LEP_CNF_LIVEPHONE_NEED_UPDATE] Libep(%p) -> Not implemented yet %s-%u: Return FAILURE -> DRIVER->DEV: [ DSP_SET_COUNTRYOPT ] libep(%p) country(%u) %s-%u: Return FAILURE -> Bad [STACK->DRIVER-%s] config(%d) Libep(%p) %s-%u: [STACK->DRIVER-%s: LEP_CNF_START_PAIRING] Libep(%p) %s-%u: [STACK->DRIVER-%s: LEP_CNF_VERSION] Libep(%p) %s-%u: [STACK->DRIVER-%s: LEP_CNF_STOP_PAIRING] Libep(%p) %s(%p): [STACK->DRIVER-%s: LEP_CNF_COUNTRY] %s(%p): DRIVER->DEV: [ DSP_SET_COUNTRYOPT ] country(%u) %s: COUNTRY FR %s-%u: Return NOT_SUPPORTED -> libep(%p) SET_COUNTRY(%u) %s: Return FAILURE -> Ioctl DECTCTL_REGISTER_CLOSE %s: Return FAILURE -> Ioctl DECTCTL_GET_BASE_VERSION %s-%u: RETURN -> Error allocating memory hardcoVoip_libep %s-%u: WARNING -> [DRIVER->DRIVER: EP_CMD_RELEASE EndPoint(%p)] -> Phone doesn't support auto hang-on%s-%u: Return FAILURE -> Bad [STACK->DRIVER-%s] cmd(%d) Libep(%p) %s-%u: FAILURE -> Lack EndPoint(%p) stack.cmd]%s-%u: [STACK->DRIVER-%s: LEP_CMD_MULTI_RING] with list(%p) Libep(%p) %s-%u: FAILURE -> [DRIVER->DRIVER: EP_CMD_RING_ON EndPoint(%p)]%s-%u: [STACK->DRIVER-%s: LEP_CMD_MULTI_RELEASE] with list(%p) Libep(%p) %s(%p): [LEP_CMD_DEBUG] with debug(%x) EP_MAGIC%s: LEP_ON_TIMER_DECT -> Not implemented yet ! %s: LEP_ON_TIMER_FXS -> Not implemented yet ! %s-%u: RETURN -> Unknown DevEpFxs EvtType(%u) FSMQEVT-%s (%p): No Process { list(%d) CurEvt(%p-%s) IN_PROCESS(%d) } %s: FXS Event(%u) Type ACK on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s(%p): [SAGEM_MODIFY_USER_DEBUG] with debug(%x) %s: FXS Event(%u-%u-%s) Type NOT USED on EP(%p) for HardcoVoip_ep(%p) ==> Trash FSMQEVT-%s (%p): Free Event{%s-%d} %s-%u: Return FAILURE -> FXS_LEP(%p) -> Error read lg(%d) instead of(%d) on /dev/dsp(%d) %s: FXS Event(%u) Type EP SIG ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: FXS Event(%u) Type EP DEV ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok HARDCOVOIP_FLAGS_LIBEP_DEV_INITIALIZE%s: FXS Event(%u-%u-%s) Type ACTION on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: FXS Event(%u-%u-%s) Type EXPIRED on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: FXS Event(%u-%u-%s) Type ACK on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: FXS Event(%u) Type EXPIRED on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s-%u: RETURN -> Error allocating memory Fxs Event FSMQEVT-%s (%p): InsertLast Event{%s-%d} %s-%u: RETURN -> Unknwon Libep_action eventDesc(%u) EVT_MAGIC_BASE%s: DSPIPC_RESET_ALL_PORT_DONE event on libep(%p) %s-%u: RETURN -> Unknwon Libep_ack eventDesc(%u) %s:-%u): Return FAILURE -> Bad channel(%d) max(%d) %s:-%u: Return FAILURE -> Bad DSP channel(%d) max(%d) %s:-%u): Return FAILURE -> Bad FXS channel(%d) max(%d) %s-%u: RETURN -> Error allocating memory Ep Dev Event message %s-%u: RETURN -> No private context present(%p) in EP(%p) %s-%u: Return FAILURE -> Error No Ep on channel(%d) %s-%u: RETURN -> Unknown DevEpDect EvtType(%u) %s: DECT Event(%u) Type ACK on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: FXS Event(%u-%u-%s) Type NOT USED on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s-%u: Return FAILURE -> DECT_LEP-FD(%p) -> Error read lg(%d) instead of(%d) on /dev/dsp(%d) HARDCOVOIP_FLAGS_LIBEP_DEV_PLUG%s: WARNING -> Failure init Dect handset(%d) %s: DECT Event(%u) Type EP SIG ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: DECT Event(%u) Type EP DEV ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: DECT Event(%u-%u-%s) Type ACTION on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: DECT Event(%u-%u-%s) Type EXPIRED on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: DECT Event(%u-%u-%s) Type ACK on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: DECT Event(%u) Type EXPIRED on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: REMOVE_HANDSET(%u) event %s: WARNING -> DEV part of LIBEP already initialize %s: DECT_ADD_HANDSET(%d) event on libep(%p) %s: DECT_GLOBAL_INIT_DONE event on libep(%p) %s:-%u): Return FAILURE -> Bad DECT channel(%d) max(%d) %s: DECT_REMOVE_HANDSET(%d) event on libep(%p) %s:-%u): EXIT -> Bad channel(%d) max(%d) %s: FAILURE -> Flag[%s-%X] Ctx[ptr(%p) flags(%X)] text[%s] %s: FAILURE -> Dect get map base %s: FAILURE -> DECTUSB: Get List Handset %s: DECT Map Base(%d) %s: DECT_REMOVE_DONGLE event on libep(%p) %s: DECT_ADD_DONGLE event on libep(%p) hardcoVoip_ep_cnfhardcoVoip_searchChannelWithEpvvLvv8vvvvhvvhardcoVoip_ep_cmdhardcoVoip_ep_isHARDCOVOIP_MAGIC_EPHARDCOVOIP_MAGIC_AUDIO_COMMON%s[%p]: Error on type driver(%d) %s: DECT EndPoint(%p) -> with codec(%p) %s-%u: Return FAILURE -> Bad link_mode(%d) %s-%u: Return FAILURE -> Bad Endpoint Codec(%u) %s: FXS EndPoint(%p) -> with codec(%p) %s: Link_mode(%u) OFF %s: Link_mode(%u) SWITCH_PSTN -> Not implemented yet ! %s(%d): EXIT -> Allocating memory %s(%p): [STACK->DRIVER-%s: EP_CNF_DISABLE_DTMF_REJ] %s: Fxs Handset -> Not supported %s(%p): [STACK->DRIVER-%s: EP_CNF_HANDSET] %s(%p): [STACK->DRIVER-%s: EP_CNF_CODEC] with codec(%u) %s-%u: FAILURE -> Endpoint(%p) Bad [STACK->DRIVER-%s] config(%d) %s(%p): [STACK->DRIVER-%s: EP_CNF_ENABLE_DTMF_REJ] %s(%p): [STACK->DRIVER-%s: EP_CNF_PAGE] -> Not implemented yet ! %s-%u: FAILURE -> Endpoint(%p-%s) Bad EndPoint type(%d) %s: Link_mode(%u) NORMAL %s(%p): [STACK->DRIVER-%s: EP_CNF_LINK_MODE] with link_mode(%u) %s-%u: Return NOT_SUPPORTED %s(%p): [STACK->DRIVER-%s: EP_CNF_ENABLE_DTMF_DET] HARDCOVOIP_FAS_FLAG_Message_waiting%s(%p): [STACK->DRIVER-%s: EP_MESSAGE_WAITING] %s: Dect Handset(%d) %s(%p): [STACK->DRIVER-%s: EP_CNF_DISABLE_DTMF_DET] %s-%u: RETURN -> Unknwon SigEp Cmd(%u) Type(%u) %s: Sig Evt Type EP DEV ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: Sig Evt Type EP SIG ACTION on EP(%p) for HardcoVoip_ep(%p) ==> Ok %s: SIG Cmd(%u-%u-%s) Type SIG ACTION on EP(%p) for HardcoVoip_ep(%p) ==> in Progress ... %s: WARNING -> Phone doesn't support auto hang-off %s-%u: RETURN -> Error allocating memory Ep Sig Event message %s-%u: EndPoint(%p) Bad [STACK->EP_%s] IS(%d) %s(%p): [STACK->DRIVER-%s: EP_IS_DTMF_GEN] -> Yes %s(%p): [STACK->DRIVER-%s: EP_IS_OFFHOOK] -> No %s(%p): [STACK->DRIVER-%s: EP_IS_OFFHOOK] -> Yes hardcoVoip_pstn_cmdhardcoVoip_pstn_on_timerhardcoVoip_pstn_on_fd_activity%s-%u: Return FAILURE -> pstn_driver(%p) -> Bad EVT->FXO(%d) channel(%d] %s-%u: RETURN -> Error allocating memory Event message %s-%u: EXIT -> Bad magic(%d) PSTN(%p) %s-%u: Return FAILURE -> PSTN_DRIVER(%p) -> Error read on /dev/fxo(%d) %s: RETURN -> Pstn_driver reference is NULL hardcoVoip_rtpInfo_initializehardcoVoip_rtp_cmdRTP_INFO_MAGIC%s: FAILURE -> Don't known cmd(%d) ==> Creating Rtp Info struct %s: Rtp Cmd Type ACTION on RTP_INFO(%p) for HardcoVoip_rtpInfo(%p) ==> Ok %s: RTP_CMD_DEBUG -> Not implemented yet ! %s: RTP Cmd(%u-%u-%s) Type ACTION on RTP_INFO(%p) for HardcoVoip_rtpInfo(%p) ==> in Progress ... %s-%u: RETURN -> Error allocating memory Cnx Rtp Event message HardcoVoip User Cnx Rtp%s-%u: FAILURE -> Error allocated memory hardcoVoip_rtpInfo %s: FAILURE: Register User Cnx Rtp to FSM %s-%u: RETURN -> Unknwon RtpCnx CmdType(%u) hardcoVoip_eventConv_ep_cmd_ring_onhardcoVoip_eventConv_ep_cmd_releasehardcoVoip_eventConv_ep_cmd_tone_genhardcoVoip_eventConv_ep_cmd_dtmf_reqhardcoVoip_eventConv_ep_cmd_on_hook_msghardcoVoip_eventConv_ep_cmd_off_hook_msghardcoVoip_eventConv_dspipc_init_port_donehardcoVoip_eventConv_dspipc_modify_port_codec_donehardcoVoip_eventConv_dspipc_close_port_donehardcoVoip_eventConv_dspipc_gen_tone_donehardcoVoip_eventConv_dspipc_quit_tone_donehardcoVoip_eventConv_dspipc_digit_receivedvLv\vlv|vیvۜv۬vۼvvvvڤvv v hardcoVoip_eventConv_slic_offhookhardcoVoip_eventConv_slic_onhookhardcoVoip_eventConv_slic_flashhookhardcoVoip_eventConv_dspipc_callerid_play_donehardcoVoip_eventConv_dspipc_ring_expiredhardcoVoip_eventConv_dspipc_inter_digit_expiredhardcoVoip_eventConv_dspipc_tone_expiredhardcoVoip_eventConv_dect_remove_handsethardcoVoip_eventConv_dect_add_handsethardcoVoip_eventConv_dect_offhookhardcoVoip_eventConv_dect_onhookhardcoVoip_eventConv_dect_dtmfhardcoVoip_eventConv_dect_init_donehardcoVoip_eventConv_dect_codec_update_donehardcoVoip_eventConv_dect_close_donehardcoVoip_eventConv_dect_callerid_donehardcoVoip_eventConv_dect_tone_on_donehardcoVoip_eventConv_dect_tone_off_donehardcoVoip_eventConv_dect_ring_expiredhardcoVoip_eventConv_dect_dtmf_expiredhardcoVoip_eventConv_dect_tone_expiredhardcoVoip_eventConv_rtp_cmd_starthardcoVoip_eventConv_rtp_cmd_updatehardcoVoip_eventConv_rtp_cmd_stophardcoVoip_eventConv_rtp_cmd_dtmfDirRtp%s-%u: WRONG_PARAM -> Bad ETSI EN 300 659-3 type(%u) missRemoteUserNumReason -> PRIVATE missRemoteUserNumReason -> UNAVAILABLE%s: CallerId [ date( NULL missRemoteUserNameReason -> PRIVATE missRemoteUserNameReason -> UNAVAILABLE remoteUserNum( remoteUserName( PSTN Call VOIP Call VMWI Off VMWI On%s: OnHookMsg [hardcoVoip_managedEventvv@vvv8vvhvv\vvDvvHARDCOVOIP_FAS_FLAG_Port_dev_off_waitHARDCOVOIP_FAS_FLAG_Caller_id_play_on_waitHARDCOVOIP_FAS_FLAG_Port_dsp_on_waitHARDCOVOIP_FAS_FLAG_Port_dsp_off_waitHARDCOVOIP_FAS_FLAG_Tone_on_waitHARDCOVOIP_FAS_FLAG_Ring_onHARDCOVOIP_FAS_FLAG_Port_dev_on_wait%s: FAILURE -> Don't known event(%u) %s: Process -> Modify_port_dsp_codec_done -> Not implemented yet ! %s: Process -> Modify_port_dev_codec_done -> Not implemented yet ! HARDCOVOIP_FAS_FLAG_Tone_offHARDCOVOIP_FAS_FLAG_Port_dsp_onHARDCOVOIP_FAS_FLAG_Tone_onHARDCOVOIP_FAS_FLAG_Tone_off_waitHARDCOVOIP_FAS_FLAG_Port_dev_offHARDCOVOIP_FAS_FLAG_Port_dsp_offHARDCOVOIP_FAS_FLAG_Ring_offHARDCOVOIP_FAS_FLAG_Port_dev_on%s: Process -> Port_dev_off_done %s: Process -> Tone_off_done %s: Process -> Port_dsp_on_done %s: Process -> Port_dsp_off_done %s: Process -> Tone_expired %s: Process -> Callerid_play_done %s: Process -> Port_dev_on_done %s: Process -> Inter_digit_expired -> Not implemented yet ! %s: Process -> Ring_expired %s: Process -> Tone_on_done EPDEVprocess_offhookprocess_onhookfromEpDev_offHookfromEpDev_onHookfromEpDev_portModReqfromFasDev_processOffHook_completedfromFsmRtp_portModReqfromFsmSig_ringOfffromFsmSig_ringOnCidfromProcessOnHook_completedfromStkSig_dtmfReqfromStkSig_offHookMsgfromStkSig_onHookMsgfromStkSig_toneReqState{Idle} Event{FromEpDev_offHook}State{Idle} Event{FromFsmSig_ringOnCid}State{Idle} Event{FromStkSig_onHookMsg}State{Idle} Event{FromFsmSig_ringOff}State{Idle} Event{FromEpDev_portModReq}State{Process_offHook} Event{FromFasDev_processOffHook_completed}State{Process_offHook} Event{FromEpDev_onHook}State{Process_offHook} Event{FromEpDev_portModReq}State{Process_onHook} Event{FromPorcessOnHook_completed}State{Process_onHook} Event{FromEpDev_offHook}State{Process_onHook} Event{FromStkSig_toneReq}State{Process_onHook} Event{FromFsmRtp_portModReq}State{Porcess_onHook} Event{FromEpDev_portModReq}State{Hold} Event{FromEpDev_onHook}State{Hold} Event{FromStkSig_toneReq}State{Hold} Event{FromStkSig_dtmfReq}State{Hold} Event{FromFsmRtp_portModReq}State{Hold} Event{FromEpDev_portModReq}State{Idle} Event{FromStkSig_offHookMsg}EPSIGfreeringProcessincomingCalloutgoingCallincomingCallReleaseoutgoingCallReleaseestablishedReleasefromEpDev_digit_receivedfromEpDev_inter_digit_expiredfromFasDev_offHookBeginfromFasDev_offHookEndfromFasDev_onHookBeginfromFasDev_onHookEndfromStkSig_callReqfromStkSig_releaseReqState{Free} Event{FromStkSig_ringReq}State{Free} Event{FromFasDev_offHookBegin}State{RingProcess} Event{FromStkSig_ringReq}State{RingProcess} Event{FromStkSig_releaseReq}State{RingProcess} Event{FromFasDev_offHookBegin}State{IncomingCall} Event{FromStkSig_releaseReq}State{IncomingCall} Event{FromFasDev_offHookEnd}State(incomingCall} Event{FromFasDev_onHookBegin}State{OutgoingCall} Event{FromFasDev_offHookEnd}State{OutgoingCall} Event{FromFasDev_onHookBegin}State{OutgoingCall} Event{FromEpDev_digit_received}State{WaitUnsetChannelAudio} Event{FromFasDev_onHookEnd}State{WaitUnsetChannelAudio} Event{FromFasDev_offHookBegin}State{OutgoingCallRelease} Event{FromFasDev_onHookEnd}State{OutgoingCallRelease} Event{FromFasDev_offHookBegin}State{EstablishedRelease} Event{FromFasDev_onHookEnd}State{EstablishedRelease} Event{FromFasDev_offHookBegin}State{Established} Event{FromFasDev_onHookBegin}State{established} Event{FromStkSig_releaseReq}State{Established} Event{FromEpDev_digit_received}State{Established} Event{FromEpDev_inter_digit_expired}CNXRTPfromStkRtp_dtmfDirRtpfromStkRtp_startfromStkRtp_stopfromStkRtp_updateState{Free} Event{FromStkRtp_start}State{Used} Event{FromStkRtp_dtmfDirRtp}State{Used} Event{FromStkRtp_update}State{Used} Event{FromStkRtp_stop}hardcoVoip_fsmEpDev_holdhardcoVoip_fsmEpDev_idlehardcoVoip_fsmEpDev_process_offhookhardcoVoip_fsmEpDev_process_onhookhardcoVoip_fsmEpDev_process_ring_on_cidhardcoVoip_fsmEpDev_process_ring_offhardcoVoip_fsmEpDev_process_tone_reqhardcoVoip_fsmEpDev_process_dtmf_reqhardcoVoip_fsmEpDev_process_on_hook_msghardcoVoip_fsmEpDev_process_off_hook_msghardcoVoip_fsmEpDev_process_port_mod_reqEVT_FLAGS_BASE_NOT_DEL_EVENT_AFTER_FSM%s-%u: FAILURE -> Event(%p) TypeEvent(%u) not present fromPhone_offHook %s-%u: FAILURE -> Event(%p) TypeEvent(%u) not present hardcoVoip_fsmEpSig_process_free_with_call_reqhardcoVoip_fsmEpSig_process_free_with_offHook_beginhardcoVoip_fsmEpSig_process_ringProcess_with_call_reqhardcoVoip_fsmEpSig_process_ringProcess_with_release_reqhardcoVoip_fsmEpSig_process_ringProcess_with_offHook_beginhardcoVoip_fsmEpSig_process_incomingCall_with_offHook_endhardcoVoip_fsmEpSig_process_incomingCall_with_release_reqhardcoVoip_fsmEpSig_process_incomingCall_with_onHook_beginhardcoVoip_fsmEpSig_process_established_with_release_reqhardcoVoip_fsmEpSig_process_established_with_onHook_beginhardcoVoip_fsmEpSig_process_established_with_digit_receivedhardcoVoip_fsmEpSig_process_established_with_inter_digit_expiredhardcoVoip_fsmEpSig_process_incomingCallRelease_with_offHook_beginhardcoVoip_fsmEpSig_process_incomingCallRelease_with_onHook_endhardcoVoip_fsmEpSig_process_establishedRelease_with_offHook_beginhardcoVoip_fsmEpSig_process_establishedRelease_with_onHook_endhardcoVoip_fsmEpSig_process_outgoingCall_with_offHook_endhardcoVoip_fsmEpSig_process_outgoingCall_with_onHook_beginhardcoVoip_fsmEpSig_process_outgoingCall_with_digit_receivedhardcoVoip_fsmEpSig_process_outgoingCallRelease_with_onHook_endhardcoVoip_fsmEpSig_process_outgoingCallRelease_with_offHook_begin%s: Missing FsmQEvt Sig on hardcoVoip_ep(%p) %s-%u: FAILURE -> curEvent(%u) don't known on hardcoVoip_ep(%p) Ep(%p) FSM-SIG -> EP_EVT_CALL_IND with Ep(%p) %s: Process Release Ep(%p) %s: Phone does not support auto hang-off %s: Find Ep(%p) offHook -> No process %s: Phone does support auto hang-off FSM-SIG -> EP_SRV_REGISTER_CHANNEL_AUDIO with Ep(%p) %s-%u: EXIT -> Return code Error FSM-SIG -> EP_EVT_CALL_ANSWER with Ep(%p) %s: WARNING -> Nothing to do because auto hang-on not support ! FSM-SIG -> EP_SRV_UNREGISTER_CHANNEL_AUDIO with Ep(%p) FSM-SIG -> EP_EVT_KEY_IND(%c-%d) with Ep(%p) FSM-SIG -> EP_EVT_INTER_KEY_EXPIRED with Ep(%p) FSM-SIG -> EP_EVT_CALL_RELEASE with Ep(%p) FSM-SIG -> Nothing to do with Ep(%p) %s: NOT implemented yet !!! hardcoVoip_fsmCnxRtp_process_startrtp_applStarthardcoVoip_fsmCnxRtp_process_updatertp_applUpdatehardcoVoip_fsmCnxRtp_process_stoprtp_applStophardcoVoip_fsmCnxRtp_process_dtmfDirRtprtp_applSendDtmfHARDCOVOIP_MAGIC_RTPINFO%s: [RTP->K-RTP: RTP_APPL_START] rtp_info(%p) fd(%d) %s: [RTP->K-RTP: RTP_APPL_START] rtp_info(%p) fd(%d) ==> RtpDescriptor(%d) %s: FAILURE -> [IOCTL->RTP: RTP_IOCTL_START] %s-%u: FAILURE -> Event(%p) TypeEvent(%u) not present %s-%u: RETURN -> Error allocating memory rtp_ioctlInfo %s-%u: FAILURE -> [RTP->K-RTP: RTP_APPL_START] rtp_info(%p) fd(%d) RTP_IOCTL_INFO_MAGIC%s: [RTP->K-RTP: RTP_APPL_UPDATE] rtp_info(%p) fd(%d) %s: [RTP->K-RTP: RTP_APPL_UPDATE] rtp_info(%p) fd(%d) ==> RtpDescriptor(%d) %s-%u: FAILURE -> [RTP->K-RTP: RTP_APPL_UPDATE] rtp_info(%p) fd(%d) %s: FAILURE -> [IOCTL->RTP: RTP_IOCTL_UPDATE] %s-%u: FAILURE -> RTP_CMD_UPDATE: rtp_info(%p) rtpInfo(%p) Lack of RtpDescriptor(%d) %s: [RTP->K-RTP: RTP_APPL_STOP] rtp_info(%p) fd(%d) %s: [RTP->K-RTP: RTP_APPL_STOP] rtp_info(%p) fd(%d) ==> RtpDescriptor(%d) %s: FAILURE -> [IOCTL->RTP: RTP_IOCTL_STOP] %s-%u: FAILURE -> RTP_CMD_STOP: rtp_info(%p) rtpInfo(%p) Lack of RtpDescriptor(%d) %s-%u: FAILURE -> [RTP->K-RTP: RTP_APPL_STOP] rtp_info(%p) fd(%d) %s: [RTP->K-RTP: RTP_APPL_DTMF_DIR_RTP] rtp_info(%p) fd(%d) %s-%u: RETURN -> Error allocating memory rtp_ioctlDtmf %s: FAILURE -> [RTP->K-RTP: RTP_APPL_DTMF_DIR_RTP] rtp_info(%p) fd(%d) %s: FAILURE -> [IOCTL->RTP: RTP_IOCTL_SEND_DTMF] %s-%u: FAILURE -> RTP_CMD_DTMF_DIR_RTP: rtp_info(%p) rtpInfo(%p) Lack of RtpDescriptor(%d) hardcoVoip_fasOffHook_initializeSEQUENCE_OFF_HOOKACTION_SIG_OFFHOK_BEGINACTION_RING_OFFSUB_ACTION_PORT_DEV_DSP_ONACTION_DEV_OFFHOOK_ENDACTION_SIG_OFFHOOK_ENDACTION_OFFHOOK_COMPLETED%s: FAILURE -> Add OFF_HOOK Sequence %s: FAILURE -> Add Off_hook_completd Action of OFF_HOOK Sequence %s: FAILURE -> Add Call_OffHook_Begin Action of OFF_HOOK Sequence %s: FAILURE -> Add Ring_Off Action of OFF_HOOK Sequence %s: FAILURE -> Add Port_Dev_Dsp_On Action of OFF_HOOK Sequence %s: FAILURE -> Add Call_OffHook_End Action of OFF_HOOK Sequence hardcoVoip_fasOnHook_initializeSEQUENCE_ON_HOOKACTION_SIG_ONHOOK_BEGINSUB_ACTION_TONE_OFFSUB_ACTION_PORT_DEV_DSP_OFFACTION_DEV_ONHOOK_ENDACTION_SIG_ONHOOK_ENDACTION_ONHOOK_COMPLETED%s: FAILURE -> Add ON_HOOK Sequence %s: FAILURE -> Add On_hook_completd Action of OFF_HOOK Sequence %s: FAILURE -> Add Sig_OnHook_Begin Action of ON_HOOK Sequence %s: FAILURE -> Add Sub_Tone_Off Action of OFF_HOOK Sequence %s: FAILURE -> Add Sub_Port_Dev_Dsp_Off Action of ON_HOOK Sequence %s: FAILURE -> Add Sig_OnHook_End Action of ON_HOOK Sequence hardcoVoip_fasPortDevOn_initializeSEQUENCE_PORT_DEV_ONACTION_PORT_DEV_OFF_WAITACTION_PORT_DEV_ON_WAITACTION_PORT_DEV_ON_COMPLETED%s: FAILURE -> Add Port_Dev_On Action of PORT_DEV_ON Sequence %s: FAILURE -> Add PORT_DEV_ON Sequence %s: FAILURE -> Add Port_Dev_Off_Wait Action of PORT_DEV_ON Sequence %s: FAILURE -> Add Port_Dev_On_Wait Action of PORT_DEV_ON Sequence hardcoVoip_fasPortDevOff_initializeSEQUENCE_PORT_DEV_OFFACTION_PORT_DEV_OFF%s: FAILURE -> Add Port_Dev_Off Action of PORT_DEV_OFF Sequence %s: FAILURE -> Add Port_Dev_Off_Wait Action of PORT_DEV_OFF Sequence %s: FAILURE -> Add PORT_DEV_OFF Sequence %s: FAILURE -> Add Port_Dev_On_Wait Action of PORT_DEV_OFF Sequence hardcoVoip_fasPortDspOn_initializeSEQUENCE_PORT_DSP_ONACTION_PORT_DSP_OFF_WAITACTION_PORT_DSP_ONACTION_PORT_DSP_ON_WAITACTION_PORT_DSP_ON_COMPLETED%s: FAILURE -> Add Port_Dsp_On Action of PORT_DSP_ON Sequence %s: FAILURE -> Add PORT_DSP_ON Sequence %s: FAILURE -> Add Port_Dsp_Off_Wait Action of PORT_DSP_ON Sequence %s: FAILURE -> Add Port_Dsp_On_Wait Action of PORT_DSP_ON Sequence hardcoVoip_fasPortDspOff_initializeSEQUENCE_PORT_DSP_OFFACTION_PORT_DSP_OFFACTION_PORT_DSP_OFF_COMPLETED%s: FAILURE -> Add Port_Dsp_Off Action of PORT_DSP_OFF Sequence %s: FAILURE -> Add PORT_DSP_OFF Sequence %s: FAILURE -> Add Port_Dsp_On_Wait Action of PORT_DSP_OFF Sequence %s: FAILURE -> Add Port_Dsp_Off_Wait Action of PORT_DSP_OFF Sequence hardcoVoip_fasPortMod_initializeSEQUENCE_PORT_MODACTION_TONE_ONACTION_PORT_MOD_COMPLETED%s: FAILURE -> Add PORT_MOD Sequence %s: FAILURE -> Add Port_Dev_Dsp_Off Action of PORT_MOD Sequence %s: FAILURE -> Add Port_Dev_Dsp_On Action of PORT_MOD Sequence %s: FAILURE -> Add Tone_On Action of PORT_MOD Sequence %s: FAILURE -> Add Port_Mod Action of PORT_MOD Sequence hardcoVoip_fasToneOn_initializeSEQUENCE_TONE_ON%s: FAILURE -> Add Tone_On Action of TONE_ON Sequence ACTION_TONE_ON_COMPLETED%s: FAILURE -> Add Tone_On_Completed Action of TONE_ON Sequence %s: FAILURE -> Add TONE_ON Sequence %s: FAILURE -> Add Tone_On_ait Action of TONE_ON Sequence hardcoVoip_fasToneOff_initializeSEQUENCE_TONE_OFFACTION_TONE_ON_WAITACTION_TONE_OFF_WAITACTION_TONE_OFF_COMPLETED%s: FAILURE -> Add TONE_OFF Sequence %s: FAILURE -> Add Tone_On_Wait Action of TONE_OFF Sequence %s: FAILURE -> Add Tone_Off Action of TONE_OFF Sequence %s: FAILURE -> Add Tone_Off_ait Action of TONE_OFF Sequence %s: FAILURE -> Add Tone_Off_Completed Action of TONE_OFF Sequence hardcoVoip_fasRingOnCid_initializeSEQUENCE_RING_ON_CIDSUB_ACTION_PORT_RING_ONSUB_ACTION_PORT_DEV_ON%s: FAILURE -> Add Port_Dev_On Action of RING_ON_CID Sequence ACTION_RING_ON_CID_COMPLETED%s: FAILURE -> Add Ring_on_cid_completd Action of RING_On_CID Sequence %s: FAILURE -> Add RING_ON_CID Sequence %s: FAILURE -> Add Port_Ring_On Action of RING_ON_CID Sequence hardcoVoip_fasRingOff_initializeSEQUENCE_RING_OFF%s: FAILURE -> Add Sub Port_Dev_Dsp_off Action of RING_OFF Sequence ACTION_RING_OFF_COMPLETED%s: FAILURE -> Add Ring_off_completd Action of RING_Off Sequence %s: FAILURE -> Add RING_OFF Sequence %s: FAILURE -> Add Ring Off Action of RING_OFF Sequence hardcoVoip_fasOffHookMsg_initializeSEQUENCE_OFF_HOOK_MSGACTION_OFFHOOKMSG%s: FAILURE -> Add OffHookMsg Action of OFF_HOOK_MSG Sequence ACTION_OFF_HOOK_MSG_COMPLETED%s: FAILURE -> Add Off_onHookMsg_completed Action of OFF_HOOK_MSG Sequence %s: FAILURE -> Add OFF_HOOK_MSG Sequence hardcoVoip_fasPlayDtmf_initializeSEQUENCE_PLAY_DTMFACTION_PLAY_DTMF%s: FAILURE -> Add Play_Dtmf Action of PLAY_DTMF Sequence ACTION_PLAY_DTMF_COMPLETED%s: FAILURE -> Add Play_Dtmf_Completed Action of PLAY_DTMF Sequence %s: FAILURE -> Add PLAY_DTMF Sequence hardcoVoip_evt_port_dsp_off_donehardcoVoip_free_dsp_indexhardcoVoip_evt_port_dsp_on_donehardcoVoip_evt_port_dev_off_donehardcoVoip_evt_port_dev_on_donehardcoVoip_evt_tone_off_donehardcoVoip_evt_tone_on_donehardcoVoip_evt_caller_id_play_done%s: Begin ! %s: DECT_DSP -> EvtClosePortDone channel(%u) fd(%u) %s: Free DSP index(%d) with EP(%p) %s-%u: FAILURE -> Ep(%p) Dsp index Free %s-%u: Return Failure -> channel(%d) EndPoint(%p) on DSP index not used %s: FXS_DSP -> EvtClosePortDone channel(%u) fd(%u) %s-%u: FAILURE -> Dect Audio part on EP(%p) is missing %s-%u: FAILURE -> Fxs Audio part on EP(%p) is missing hardcoVoip_job_ring_offfxs_applSlicRingOffdectUsb_applRingOffhardcoVoip_job_tone_onhardcoVoip_epTone2DspTonefxs_applGenTonehardcoVoip_epTone2DectTonedectUsb_applGenToneww8wwwPwxwHwxwxwwwww wwwwhardcoVoip_job_tone_offfxs_applQuitTonedectUsb_applQuitTonehardcoVoip_job_sig_offHook_beginhardcoVoip_job_sig_offHook_endhardcoVoip_job_sig_onHook_beginhardcoVoip_job_sig_onHook_endhardcoVoip_job_port_dev_onhardcoVoip_dspCodec2DectCodecdectUsb_applInitPorthardcoVoip_job_port_dev_offdectUsb_applClosePorthardcoVoip_job_port_dsp_onhardcoVoip_used_dsp_indexhardcoVoip_free_dsp_indexfxs_applInitPorthardcoVoip_job_port_dsp_offfxs_applClosePorthardcoVoip_job_dev_offHook_endhardcoVoip_job_dev_onHook_endhardcoVoip_job_on_hook_msgfxs_applmesgWaitingIndMainfxs_applSlicRingdectUsb_applCidTxMainhardcoVoip_job_off_hook_msgfxs_applCidTxMainhardcoVoip_job_cid_and_ringdectUsb_applRingOnhardcoVoip_job_completedhardcoVoip_job_play_dtmfdsp_dtmfConv_Char2DspTonex2x-x-x-x-x-x-x2x-x-x-x-x-x2x2x2x2tx2hx2\x2Px2Dx28x2,x-x-x-x-x-x-x-x2 x2x2x2x7x7\x7\x7\x7\x7\x7\x7x7\x7\x7\x7\x7\x7xx7Tx7Lx7Dx7 DECT_RING_OFF on channel(%d) %s-%u: FAILURE -> DSP_SLIC_RING_OFF on channel(%d) %s: FAILURE -> Slic RingOff on port(%d) %s: FAILURE -> DECTUSB: Ring Off Port(%d) %s(%p): [DECT: DECT_RING_OFF] on channel(%d) %s(%p): [FXS: DSP_SLIC_RING_OFF] on channel(%d) %s(%p): Tone(%d) not implemeted yet fixe to TONE_ERROR %s: FAILURE -> EP_CMD_TONE_GEN -> channel(%u) [DRIVER->FXS: DSP_GEN_TONE]%s: FAILURE -> Generating tone(%d) %s: EP_CMD_TONE_GEN -> channel(%u) [DRIVER->FXS: DSP_GEN_TONE Vmwi(%d)]%s: EP_CMD_TONE_GEN -> channel(%u) [DRIVER->DECT: DECT_TONE_ON Vmwi(%d)]%s: FAILURE -> DECTUSB: Tone ON(%d) %s: FAILURE -> EP_CMD_TONE_GEN -> channel(%u) [DRIVER->DECT: DECT_TONE_ON]%s: FAILURE -> EP_CMD_TONE_GEN -> channel(%u) [DRIVER->DECT: DECT_TONE_OFF]%s: FAILURE -> DECTUSB: Tone OFF(%d) %s: EP_CMD_TONE_GEN -> channel(%u) [DRIVER->DECT: DECT_TONE_OFF]%s: FAILURE -> EP_CMD_TONE_GEN -> channel(%u) [DRIVER->FXS: DSP_QUIT_TONE]%s: FAILURE -> Quit Tone on port(%d) %s: EP_CMD_TONE_GEN -> channel(%u) [DRIVER->FXS: DSP_QUIT_TONE]HARDCOVOIP_FAS_FLAG_OffHookHARDCOVOIP_FAS_FLAG_OnHook%s: Fixed codec to G711 %s-%u: FAILURE -> Get Ep(%p) Audio Conf %s: FXS_DEV -> InitPort channel(%u) fd(%u) %s-%u: FAILURE -> Initialize Dev Port on channel(%d) %s: FAILURE -> DECTUSB: Init Port(%d) %s: DECT_DEV -> InitPort channel(%u) fd(%u) %s: FXS_DEV -> ClosePort fd(%u) channel(%u) %s-%u: FAILURE -> Close Dsp Port on channel(%d) %s: FAILURE -> DECTUSB: Close Port(%d) %s: DECT_DEV -> ClosePort fd(%u) channel(%u) %s: FAILURE -> Init Port(%d) %s-%u: FAILURE -> Initialize Dsp Port on channel(%d) %s: DECT_DSP -> InitPort channel(%u) fd(%u) ==> with Transcoding %s-%u: FAILURE -> Ep(%p) Dsp index is already used on EP(%p) %s: Used DSP index(%d) with EP(%p) %s-%u: Return Failure -> channel(%d) EndPoint(%p) on DSP index already used %s: DECT_DSP -> InitPort channel(%u) fd(%u) %s: FXS_DSP -> InitPort channel(%u) fd(%u) %s: FAILURE -> Close port(%d) %s: FXS_DSP -> ClosePort channel(%u) fd(%u) %s: DECT_DSP -> ClosePort channel(%u) fd(%u) %s: DECT -> Return to default values channel(%u) fd(%u) %s: FXS -> Return to default values channel(%u) fd(%u) %s: onHookMsg [%s-%u: FAILURE -> DECT_CALLERID on channel(%d) %s: FAILURE -> DECTUSB: CallerId port(%d) %s-%u: FAILURE -> DSP_SLIC_RING_ON on channel(%d) %s(%p): [FXS: DSP_ONHOOKMSG] on channel(%d) %s-%u: FAILURE -> DSP_CALLERID on channel(%d) %s: FAILURE -> Play VMWI on port(%d) %s(%p): [DECT: DECT_ONHOOKMSG] on channel(%d) %s: FAILURE -> Slic Ring on port(%d) %s(%p): [FXS: DSP_SLIC_RING_ON] on channel(%d) %02d%02d%02d%02d%s: FAILURE -> Play CallerId on port(%d) %s(%p): [FXS: DSP_CALLERID] on channel(%d) %s(%p): [DECT: DECT_CALLERID] on channel(%d) %s-%u: FAILURE -> DECT_RING_ON on channel(%d) %s: FAILURE -> DECTUSB: Ring On Port(%d) %s(%p): [DECT: DECT_RING_ON] on channel(%d) %s: EP_CMD_DTMF_GEN -> channel(%u) [DRIVER->DECT: DECT_DTMF_ON dtmf(%d)]%s: FAILURE -> EP_CMD_DTMF_GEN -> channel(%u) [DRIVER->DECT: DECT_GEN_TONE]%s: FAILURE -> EP_CMD_DTMF_GEN -> channel(%u) [DRIVER->FXS: DSP_GEN_TONE]%s: EP_CMD_DTMF_GEN -> channel(%u) [DRIVER->FXS: DSP_GEN_TONE dtmf(%d)]%s: WARNING -> Bad Dtmf(%d) hardcoVoip_sub_job_port_dev_dsp_onhardcoVoip_sub_job_port_dev_dsp_offhardcoVoip_sub_job_tone_offhardcoVoip_sub_job_port_dev_onhardcoVoip_sub_job_port_dev_offhardcoVoip_sub_job_port_dsp_onhardcoVoip_sub_job_port_dsp_offhardcoVoip_sub_job_port_ring_onhardcoVoip_sub_job_port_onHookMsg_on%s: Add Sub Job [ Port_dev_on & Port_dsp_on ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Port_dev_off & Port_dsp_off ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Tone_off ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Port_dev_on ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Port_dev_off ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Port_dsp_on ] on hardcoVoip_ep(%p) %s: Add Sub Job [ Port_dsp_off ] on hardcoVoip_ep(%p) %s: DECT type -> Add Sub Job [ Port_dev_on ] on hardcoVoip_ep(%p) %s: FXS type -> Add Sub Job [ Port_dev_on & Port_dsp_on ] on hardcoVoip_ep(%p) hardcoVoip_default_ep_common_audiohardcoVoip_default_ep_fxs_audiohardcoVoip_default_ep_dect_audiohardcoVoip_get_ep_audio_confhardcoVoip_copy_rtpInfoToIoctlhardcoVoip_copy_rtpInfoToIoctlx]tx^x]tx]x]tx]x]tx[x[hhardcoVoip_retrieveCallerId%s: Erase Endpoint(%p) because mode(%d) in NO_SEND_NO_RECV %s: Ep(%p) Descriptor(%d) { DSP [ Channel(%d) mode(%d) framesPacket(%d) ] RTP [ socket(%d) payload(%d) ssrc(%d) DtmfRcvMode(%d) DtmfRcvPt(%d) DtmfSndMode(%d) DtmfSndPt(%d) ] RTCP [ socket(%d) ] } %s: Ep(%p) rtpDriver(%p) ref = { ep(%p rtp_session(%p) } RTP { socket(%d) ssrc(%d) codec(%d) pt(%d) fPp(%d) mode(%d) link_mode(%d) } RTCP = { socket(%d } %s: FAILURE -> Don't known DIGIT MODE(%u) %s: FAILURE -> Don't known DIGIT MODE(%d) %s-%u: Return FAILURE -> Bad Rtp Codec(%u) %s: old -> %d new -> ULAW %s: old -> %d new -> %d %s: old -> %d new -> G722 %s: No Process %s-%u: Return FAILURE -> rtp_info(%p) rtpioctlInfo(%p) Error mode(%d) %s: old -> %d new -> ALAW %s: Vad(%u) Plc(%u) Ec(%u) Gain(%u) %s: encoder[ dtmf_det(%u) codec(%u) dtmf_rej(%u) g168(%u) g168TailLen(%u) ] %s: decoder[ codec(%u) ton_gen(%u) ] %s-%u: Return FAILURE -> [ %s ] -> Error allocated memory audio_fxs %s[%s]: Allocated memory audio_fxs(%p) %s-%u: Return FAILURE -> [ %s ] -> Error allocated memory audio_dect %s[%s]: Allocated memory audio_dect(%p) %s: AUDIO -> Vad(%u) Plc(%u) Ec(%u) Frame_per_packet(%u) Gain(%u) tail_len(%u) %s: AUDIO -> encoder[ %04x %04x %04x] decoder[ %04x %04x ] %s-%u: Return FAILURE -> Error on type driver Call -> { PSTN } ]%s: CallerId ==> [ remoteUserName -> { %s } remoteUserNum -> { %s } date -> { %s } missRemoteUserNumReason -> { PRIVATE } missRemoteUserNameReason -> { PRIVATE } missRemoteUserNameReason -> { UNAVAILABLE } missRemoteUserNumReason -> { UNAVAILABLE } Call -> { VOIP } %s-%u: FAILURE -> Error allocated memory callerId hardcoVoip_fasOnHookMsgDect_initializeSEQUENCE_ON_HOOK_MSG_DECTACTION_ONHOOKMSGDECT%s: FAILURE -> Add OnHookMsgDect Action of ON_HOOK_MSG_DECT Sequence ACTION_ON_HOOK_MSG_DECT_COMPLETED%s: FAILURE -> Add On_onHookMsgDect_completed Action of ON_HOOK_MSG_DECT Sequence %s: FAILURE -> Add ON_HOOK_MSG_DECT Sequence hardcoVoip_fasOnHookMsgFxs_initializeSEQUENCE_ON_HOOK_MSG_FXSSUB_ACTION_PORT_ONHOOKMSGFXS_ONACTION_ONHOOKMSGFXSACTION_ON_HOOK_MSG_FXS_COMPLETED%s: FAILURE -> Add ON_HOOK_MSG_FXS Sequence %s: FAILURE -> Add Port_OnHookMsgFxs_On Action of ON_HOOOK_MSG_FXS Sequence %s: FAILURE -> Add OnHookMsgFxs Action of ON_HOOK_MSG_FXS Sequence %s: FAILURE -> Add Ring_Off Action of ON_HOOOK_MSG_FXS Sequence %s: FAILURE -> Add Port_dev_dsp_Off Action of ON_HOOOK_MSG_FXS Sequence %s: FAILURE -> Add On_onHookMsgFxs_completed Action of ON_HOOK_MSG_FXS Sequence fas_getUserCtxfas_initializeBaseCtxfas_addEventOnJobCtxfas_registerUserCtxOnSeqfas_addEventOnUserCtxfas_unregisterJobCtxOnSeqAndUserCtxfas_waitEventBaseCtxfas_updateBaseCtxfas_updateUserCtxfas_addSubJobOnUserCtxfas_unregisterUserCtxOnAllSeqfas_freeUserCtx%s: FAILURE -> State[%s-%X] Ctx[ptr(%p) state(%X)] text[%s] FAS_STATE_SEQUENCE_USED%s: FAILURE -> Bad magic(%x) in seq[%p-%s] index(%u) %s: FAILURE -> Bad magic(%x) in action(%p) index(%u) %s: FAILURE -> Seq on Index(%u) >= maxSequence(%u) FAS_STATE_BASECTX_FREE FAS-USER_CTX Get ==> in progress ...%s: FAILURE -> allocating memory fas User Ctx FAS-USER_CTX(%p) Get ==> OK FAS-USER_CTX (%p) Initialize seq[%s] First act[%s] ==> OK FAS-BASE_CTX(%p) Initialize ==> in progress ... FAS_STATE_BASECTX_INITIALIZE FAS-JOB_CTX(%p) Add Event(%d) on Sequence[%s] ==> in progress ... FAS-JOB_CTX(%p) Add Event(%p-%d) on Sequence[%s] ==> OK %s: FAILURE -> allocating memory fas Job Evt FAS-JOB_CTX(%p) Register ==> OK FAS-JOB_CTX Register User ==> in progress ...%s: FAILURE -> allocating memory fas Job Ctx FAS-USER_CTX (%p) Add Event(%d) ==> in progress ... FAS-[USER_CTX(%p) SEQ_CTX(%p)] Add Event(%d) ==> OK %s: FAILURE -> Bad magic(%x) in jobCtx(%p) %s: FAILURE -> UserCtx(%p) is not register on any sequence FAS-JOB_CTX (%p) Unregister On Seq ==> Ok FAS-JOB_CTX (%p) Unregister on Seq ==> In progress ... No Wait event -> Next ACTION ===> LAST_ACTIONFAS_STATE_BASECTX_WAIT_EVENT -> Next actionFAS_STATE_BASECTX_COMPLETED ===> Already in WAIT_EVENT Match event(%u) -> No ProcessEvent -> Next action Match event(%u) -> On SubJob No Perform processEvent -> On Job No Perform processEvent -> On SubJob Perform processEvent -> On Job Perform processEvent%s: FAILURE -> Don't known state(%u) in baseCtx(%p) ===> WAIT_SLAVE FAS-BASE_CTX (%p) Update on [SEQUENCE(%s)] ==> in progress ... FAS-BASE_CTX (%p) on Sequence[%s] Update ==> OK Sequence[%s] Action[%s] State WAIT_EVENT Sequence[%s] Action[%s] State WAIT_SLAVE ===> LAST_ATION%s: FAILURE -> Bad magic(%x) in seq[%p-%s] index(%u) with user(%p) Match Flags(%x) and Action Flag(%x) -> But no processAction Sequence(%s] Action[%s] State INITIALIZE Match Flags(%x) and Action Flag(%x) -> On SubJob No Perform processAction -> On Job No Perform processAction Don't Match Flags(%x) and Action Flag(%x) -> Next Action -> On Job Perform processAction -> On SubJob Perform processAction FAS-JOB_CTX (%p) on Sequence[%s] Update ==> In process ... FAS-JOB_CTX (%p) on Sequence[%s] ==> Extract Evt(%p-%d) In process ... FAS-JOB_CTX (%p) on Sequence[%s] Update with Evt(%p-%d] ==> In process ... FAS-JOB_CTX (%p) on Sequence[%s] Update with Evt[%p-%d] ==> Process End FAS-JOB_CTX (%p) on Sequence[%s] ==> Free Evt(%p-%d) OK FAS-JOB_CTX (%p) on Sequence[%s] Update ==> Ok ... FAS-JOB_CTX (%p) on Sequence[%s] COMPLETED ==> Free FAS-SUBJOB_CTX (%p) Update with Evt(%p-%d) ==> In process ... FAS-SUBJOB_CTX (%p) Update with Evt(%p-%d) ==> Process End FAS-JOB_CTX (%p) on Sequence[%s] ==> Wait SubJob and SubJob completed ... FAS-JOB_CTX (%p) on Sequence[%s] ==> No Extract Evt FAS No Job present FAS-SUBJOB_CTX (%p) Completed -> Free and back to cross subJob List FAS-USER_CTX (%p) SubJobIndex(%u) Get ==> In progress ... FAS-SUBJOB_CTX (%p) Slave [SeqIndex(%u) ctx(%p)] Get ==> OK FAS_STATE_BASECTX_WAIT_SLAVE%s: FAILURE -> Allocating memory subJob Ctx FAS-USER_CTX (%p) Unregister ==> In progress ... FAS-USER_CTX (%p) Unregister ==> Ok FAS-USER_CTX (%p) Release ==> In progress ... FAS-USER_CTX Release ==> Ok%s: FAILURE -> UserCtx(%p) is already register on sequence fas_releaseActionfas_releaseSequencefas_addSequencefas_initializefas_addAction%s: FAILURE -> allocating memory fas action FAS-ACT[%s] index(%u) Release == OK FAS-ACT[%s] Index(%u) Release ==> in progress ... FAS_STATE_ACTION_WAIT_USED%s: FAILURE -> Bad magic(%x) in sequence(%p) index(%u) %s: FAILURE -> Don't known state(%x) of sequence(%p) %s: FAILURE -> Don't known state(%x) of action(%p) FAS-SEQ[%p-%s] index(%u) Release == OK FAS-SEQ[%p-%s] Index(%u) Release ==> in progress ... FAS_STATE_SEQUENCE_WAIT_USED%s: FAILURE -> JobCtx in already active in sequence(%p) index(%u) FAS-SEQ[%s] index(%u) Add == OK FAS-SEQ[%s] index(%u) Add ==> in progress ... Max Action(%u) -> in progress ... %s: FAILURE -> Seq[%s] Index(%u) >= maxSequence(%u) FAS-BASE Release ==> OK FAS-BASE Release ==> in progress ... FAS-BASE Initialize == OK FAS-BASE Initialize ==> in progress ... Max Seqence(%u) -> in progress ... OK sequence[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) FAS_STATE_BASE_WAIT_INITIALIZE%s: FAILURE -> allocating memory fas sequence FAS-ACT[%s] Seq(%u) Add ==> OK FAS-ACT[%s] Seq(%u) Add ==> in progress ... FAS_STATE_ACTION_USEDfsm_modifDebugCtxfsm_releaseCtxfsm_getCtxFSM_MAGIC_CTX FSM-%s-%p Release ctx ==> in progress ... FSM-%s-%p Release ==> OK %s: FSM-%s-%p:FAILURE -> Still User(%u) |==> New State Addr(%p) Release -> ... OK |==> Transition Addr(%p) Release -> ... OK |==> State Name Addr(%p) Release -> ... OK |==> Event Name Addr(%p) Release -> ... OK Process Addr(%p) Release -> ... OK FSM-%s Initialize ==> in progress ... |==> Max Event(%d) -> in progress ... |==> Max State(%d) -> in progress ... OK name[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) FSM-%s Initialize[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) ==> OK |==> Transition [maxEvent(%d) maxState(%d)] -> in progress ... OK Name[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) |==> Process [maxTransition(%d)] -> in progress ... OK transition[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) OK process[%p-%p] unit(%x-%d) nb(%x-%d) size(%x-%d) %s: FSM-%s-%p:FAILURE -> Allocating memory fsm->transition %s: FSM-%s:FAILURE -> allocating memory fsm%s: FSM-%s-%p:FAILURE -> Allocating memory fsm state trace%s: FSM-%s-%p:FAILURE -> Allocating memory fsm event tracefsm_addTransitionfsm_addNewStateToTransitionfsm_addCbModifyStatefsm_processTransitionfsm_registerUserfsm_unregisterUser%s: FSM-%s-%p:FAILURE -> Bad Process(%p) Magic(%x) %s: FSM-%s-%p:FAILURE -> Bad event(%x) >= maxEvent(%d) or curState(%d) >= maxState(%d) FSM-%s-%p: Add NULL Transition(%d) -> index(%d) %s: FSM-%s-%p:FAILURE -> Max transition(%u) FSM-%s-%p: Add Transition [%s] -> index [Transition(%d) Process(%d)] process(%p) Event(%s-%d) Cur State(%s-%d) max New State(%d) %s: FSM-%s-%p:FAILURE -> allocating memory fsm->transition FSM_MAGIC_PROCESS FSM-%s-%p: Add NewState[%s-%u] on Transition [%s] %s: FSM-%s-%p:FAILURE -> Bad indexTransition(%x) >= (maxEvent * maxState)(%d)) %s: FSM-%s-%p:FAILURE -> State already set on indexNewState(%u) on indexTransition(%u) %s: FSM-%s-%p:FAILURE -> indexNewState(%u) >= maxIndex(%u) on process(%p) FSM_MAGIC_USER%s: FAILURE -> Allocating Elt memory State(%s-%d) doesn't match with State(%s-%d) callback(%p) State(%s) -> Call process(%p) FSM-%s-%p / USER-%s-%p: NULL Transition Last event(%s-%d) New event(%s-%d) Cur State(%s-%d) FSM-%s-%p / USER-%s-%p: Perform Transition [%s-%d] -> process(%p) Rcv event(%s-%d) Cur State(%s-%d) State(%s) doesn't change State[ Cur(%s-%u) New(%s-%u)] List Modify State callback not empty%s: FSM-%s-%p / USER-%s-%p:FAILURE -> Bad Magic(%x) on ctx(%p) %s: FSM-%s-%p / USER-%s-%p:FAILURE -> Bad event(%x) >= maxEvent(%d) FSM_MAGIC_CB_MODIFY_STATE%s: FSM-%s-%p / USER-%s-%p:FAILURE -> indexNewState(%u) >= maxIndex(%u) on process(%p) %s: FSM-%s-%p / USER-%s-%p: No Process on index[Transition(%d) Process(%u)] with event(%s-%d) and curState(%s-%d) %s: FSM-%s-%p / USER-%s-%p:FAILURE -> State not set on indexNewState(%u) on indexTransition(%u) FSM-%s-%p Register User ==> in progress ... %s: FSM-%s-%p:FAILURE -> allocating memory user fsm FSM-%s-%p / USER-%s-%p: Register User ==> Ok FSM-%s-%p /USER-%s-%p Unregister User ==> in progress ... FSM-%s-%p / USER-%s-%p Unregister User ==> Ok fsm_getEventNameWithCtxfsm_getEventNameWithUserfsm_getStateNameWithCtxfsm_addEventNamefsm_addStateNamefsm_getCurStatefsm_setCurStatefsm_getOldStatefsm_setOldStatefsm_setReffsm_getRef%s: FAILURE -> Bad event(%d) >= maxEvent(%d) on ctx(%p) FSM-%s: Add Event(%d) Name(%s) %s: FAILURE -> Bad state(%d) >= maxState(%d) on ctx(%p) FSM-%s: Add State(%d) Name(%s) fsmQEvt_processWithMutexfsmQEvt_processfsmQEvt_modifDebugFSMQEVT_MAGIC_USER%s: FAILURE -> Don't known res code(%d) FSMQEVT-%s (%p): Extract Event{%s-%d} FSMQEVT-%s (%p): WARNING -> Bad Fsm Transition FSMQEVT-%s (%p): Don't free Event{%s-%d} FSMQEVT_FLAGS_USER_PROCESSING %s: Begin %s: End FSMQEVT-%s (%p): QUIT FSMQEVT -> CurEvt(%p-%s) %s: Modify Debug(%d) fsmQEvt_registerUserfsmQEvt_registerUserWithMutexfsmQEvt_unregisterUserfsmQEvt_unregisterUserWithMutexFSMQEVT-%s (%p): Decrease ref(%d) %s: WARNING -> Cur event not empty in fsmQEvt_user(%p) %s: WARNING -> List event not empty in fsmQEvt_user(%p) FSMQEVT-%s (%p): Free Memory FSMQEVT-%s (%p): Increase ref(%d) %s-%u: EXIT -> Register FsmqEvt_User %s-%s: FSMQEVT: FAILURE -> allocating memory fsm PINGING PINGING_DONE NULL_TERMINATED MSFT_CL_STAT_RT%s%s%s%s%s All server commands.Config DHCP server configuration settingsPrint DHCP server configuration settingsConfig DHCP server policy settingsDHCP server pool specific commands.leaseDHCP server lease specific commands.DHCP server option specific commandsDHCP server specific debug commands.Flush all DHCP server pool and lease entriesModify DHCP server trace configurationList DHCP server trace configurationPrint DHCP server statisticsClear DHCP server statisticswhether to Clear DHCP server statistics.DHCP server state: %20{Running}{Not running} DHCP server statistics: Corrupted packet recv : %[-5]0 %0{(overflow)} DISCOVER : %[-5]1 %1{(overflow)} REQUEST : %[-5]2 %2{(overflow)} DECLINE : %[-5]3 %3{(overflow)} RELEASE : %[-5]4 %4{(overflow)} INFORM : %[-5]5 %5{(overflow)} Pure BOOTP REQUESTS : %[-5]6 %6{(overflow)} Other message types : %[-5]7 %7{(overflow)} OFFERs sent : %[-5]8 %8{(overflow)} ACKs sent : %[-5]9 %9{(overflow)} NAKs sent : %[-5]10 %10{(overflow)} Packet sent failures : %[-5]15 %15{(overflow)} Relay agent options dropped : %[-5]11 %11{(overflow)} Lease table got full : %12{yes}{no} Ping table got full : %13{yes}{no} Second DHCP server seen : %14{yes}{no} Total size of lease table : %17, in use: %18, free: %19(%17,%18,-,100,*,%17,/) %% %16{There are %16 leases being verified }Add a DHCP server option templateDelete a DHCP server option templateList all DHCP server option templatesinstaddAdd a DHCP server option instanceinstdeleteDelete a DHCP server option instanceinstlistList all DHCP server option instancesruleaddAdd a selection rule to a DHCP server option instanceruledeleteDelete a selection rule from a DHCP server option instanceFlush all DHCP server option templates and instancesThe name of the DHCP server option instance.rulenameThe name of the DHCP selection rule.The logical key of the selection rule.%E{Flag Legend: [D]ynamic }Name Tmpl Name Use-count Policy %[-20]0 %[-15]1 (%[-15]7) %[-10]3 %[-9]4 %E{ Value : (%5)%2 Flags : %6{D}{-} } %1{Suboption : %1}%0{Enterprise: %0} (!= name ) Rule list:%0{%1{&}{|}%0}{%0} %1tmplnameThe name of the DHCP server option template.The transmit policy type for the DHCP server option instance.Enable/Disable option instance as dynamic.maxuseMaximum number of times an option instance can be used in DHCP poolsvaluetypeThe value type of the instance.The value of the DHCP server option instance.requestedalwaysrulesName Option name Use Flags %[-20]0 %[-30]1 %[-3]2 %[-5]3{D}{-} optionidSpecify the DHCP server option code.Enable/Disable option template as dynamic.Add a DHCP server leaseDelete a DHCP server leaseFlush all DHCP server leasesList all DHCP server leasesLease Pool TTL State Clientid %0{%[-21]0 }{%1{0.0.0.0 }{%1 }}%9{%[-15]9}{%[-15]2} %[-13]8 %[-9]3 %4 %E{%11(%2,%9)%6{ Leasetime: %6 }%7{ Gateway:%[-15]7 } Flags:%10 HW address: %5 }.RxOptionsOption info: %0 %1{Suboption: %1}%0{Enterprise: %0}The name of the DHCP server pool. Only the leases belonging to this pool will be deleted.The DHCP client identification string.The name of the DHCP server pool.The IP address for this client.offsetThe IP address offset in the pool preserved for this client.The time in seconds the client is allowed to use an address (tip: 0 means infinite leasetime).expirytimeThe time in seconds the DHCP server keeps the lease reserved (tip: 0 means infinite expirytime).The IP address of the default router for this client.macaddrThe host MAC address.Add a DHCP server poolConfigure a DHCP server poolDelete a DHCP server poolAdd a route to the DHCP server poolDelete a route from the DHCP server pooloptaddAdd an option instance to the DHCP server pooloptdeleteDelete an option instance from the DHCP server poolAdd a selection rule to the DHCP server poolDelete a selection rule from the DHCP server poolFlush all DHCP server poolsList all DHCP server poolsPool Start End Intf Admin State %[-2]18 %[-15]0 %16{%[-15]1 %[-15]2}{ } %3{%[-10]3}{ } %19{UP }{DOWN} %17 %16{ }{[void]} %E{ DHCP server = %4 %5{ [unnumbered]} Netmask = %6 Leasetime = %7{%7}{infinite} %20{Renewtime = %20 }%21{Rebindtime = %21% }%8{Gateway = %8 %9{[virtual]} }DNS domain = %10 DNS metric = %11 DNS address list: %22{%4(local DNS) }%12{%12 }%13{%13 }%14{ WINS address list: %14 %15{%15 }}{%15{ WINS address list: %15 }} }Option instance list: Name Option name %[-20]0 %[-20]2 %1 .Route Route list: Destination Gateway Interface %[-15]0/%1 %2{%[-15]2}{ } Rule list: %F{%0}{%1{&}{|}%0}%0DNS.ServerinstnameThe IP destination address of the route for DHCP clients.The IP address of the next hop. Must be directly connected to the DHCP clientEnable/Disable the DHCP server pool admin state.The interface for which the pool is allowed to lease IP addresses.The number of the pool before which you want the new pool to be added.poolstartThe DHCP server pool start IP address.poolendThe DHCP server pool end IP address.The DHCP server pool netmask.The IP address of the default router for DHCP clients.The IP address of the DHCP server for DHCP clients.The IP address of the primary DNS server for DHCP clients.The IP address of the secondary DNS server for DHCP clients.The DHCP server pool DNS route metric.primwinsThe IP address of the primary WINS server for DHCP clients.secwinsThe IP address of the secondary WINS server for DHCP clients.The time in seconds a client is allowed to use an address (tip: 0 means infinite lease).renewtimeThe time in seconds before a client switches to renewing.rebindtimeThe time in seconds before a client switches to rebinding.Assign an IP address from this pool to the DHCP server or not (ppp pools only).localgwProxy for a virtual default gateway residing in same subnet of DHCP client instead of the remote peer address.verifyfirstEnable/Disable IP address conflict network probing before handing out an address to a client.trustclientWhether or not the IP address suggested by a DHCP client should be taken into account.rtbehaviourDefine the DHCP Server's route options behaviour. The options that are involved are: 3, 33, 121 and 249. "Traditional" will return 3 and/or 33; "standard" will return 3 and/or 33 or 121; "msft" will return 3 and/or 33 or 121 or 249traditionalmsftState: %0{enabled}{disabled} Verifyfirst: %1{enabled}{disabled} Trustclient: %2{enabled}{disabled} Rtbehaviour: %3 Enable/Disable the DHCP server.infinite[%02x] %02x%c%-9sABANDONEDSTOPPEDFREE RESERVED%-15s%-13s%*c%-14s: %-15s Preferred Pool%-2ddhcp serverdhcsdhcspoolClearEnableUsedLeasesMaxLeasesOutstandingPingsTxFailureSecondServerDetectedFullPingTableFullLeaseTableRelayOptionDroppedNAKACKOfferOtherMessageTypesBOOTPInformReleaseDeclineRequestDiscoverCorruptPacketsDHCP.Server.StatsEnableDHCP.Server.Debug.TraceConfigDHCP.Server.Option.Instance.{name}.Rule.{rulename}RuleNameDHCP.RuleNameDHCP.Server.Option.Instance.{name}.RuleLogicalSubOptionEnterpriseOptionIDDynamicTypePolicyRefCountValueTemplateNameDHCP.Server.Option.Instance.{name}DHCP.Server.Option.InstanceMaxRefCntDynamicRefCountNameDHCP.Server.Option.Template.{name}DHCP.Server.Option.TemplateSubOptionEnterpriseOptionPoolReferenceLeaseTimeRemainingGatewayLeaseTimeMACAddressClientIDFlagsDHCPServerPoolPoolOffsetIPAddressDHCP.Server.PoolDHCP.Server.Lease.{clientid}DHCP.Server.LeaseExpirationTimeLogicalRuleNameGatewayDestIPMaskDestIPAddressInstanceEnableRebindTimeRenewTimeStateIndexStatusFlagsSecWINSPrimWINSSecDNSServerPrimDNSServerDNSMetricDomainNameLocalGatewayGatewayLeaseTimeSubnetMaskUnnumberedServerIPIntfMaxAddressMinAddressNameDHCP.Server.Pool.{name}.Rule.{rulename}DHCP.Server.Pool.{name}.RuleDHCP.Server.Pool.{name}.Option.{instname}DHCP.Server.Pool.{name}.OptionDHCP.Server.Pool.{name}.RouteDHCP.Server.Pool.{name}IP.IntfRtBehaviourTrustClientVerifyFirstDHCP.Server%s%02x%s*All DHCP rule commands.Add a rule for DHCP conditional selectionDelete a DHCP ruleList all DHCP rulesDHCP rule specific debug commands.Flush all DHCP rulesModify DHCP rule trace configurationList DHCP rule trace configurationName Use Type Value %[-25]0 %[-3]4 %1{%[-8]1 %10{!}{}%7%8{ enterprise : %8}{}%9{ suboption : %9}{} data : %6{%2{%6}{*%6*}}{*}}{%[-8]1 %5{!}{}%3(%11,%3)}{} The name of the DHCP rule.Specify the DHCP rule type.optiontypeThe option type of the option.matchThe option value matching.The mac address.requested-ipdhcp-overload-indicationdhcp-msg-typedhcp-text-msgdhcp-max-msg-sizevendor-class-identifierclient-identifierrelay-agent-infovciuci%s (%d)dhcp ruledhcruleEnableDHCP.RuleDebug.TraceConfigMACMaskOptionExcludeSubOptionEnterpriseOptionValueMACExcludeRefCountMACMatchRuleTypeNameDHCP.Rule.{name}DHCP.RuleType^[ ]*%s[ ]*=[ "]*%s.tmp.%dwr%s=%.*s %s([^;]*);([^;]*)%d/var/run/ntp_deltaNTP_DELTA/etc/bluedsl.confCOUNTRYTZCEST-1DST,M3.5.0/02:00:00,M10.5.0/03:00:00CEST+0DST,M3.5.0/01:00:00,M10.5.0/02:00:00/root/adsld.loga%03d %02d:%02d:%02d %s 0x%x %s %d %s /root/adsld_log.tmp;~%@~%T~%d 4.2.33Not implemented on HOST simulation ,,@F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0F0FmTFlFFI% Iϼ>I>ID> I>0IӜ>DI>XIH7>dID>tI|>I|7>IԈ>IưDI|>IЈI>7 >>>>>?? ?? ?$?,7 ?D8?T?`84?t?|??8X??<?8|7x8???8 H:;;;(;8;L;X;d ;p ; ; ;`l?9 @@@ @0@<@L9l 9`98p8(8L07788I:\IIxIIII0dDIX@I@I;./D-.X!IILItII$I`I,$I5h.@DJ@;J0JJD$JD8 JL#J{XM Jt>LJwDJwLM >MMM$? M0M8M@MH?0 >??$MJ@@JJJJ J@JJDCJN`JHNl# Jx@tNt# J@tN|NJ8@ JJJTJ4J\JPJDCJ NJ`ANJTNJNJNJNJTNJNJNANO O O OOA-PRpWYP K|BKK@Y\ KC,K\$KBYhB$YxYKCTKPKKK pK K DSK < 8 K DYK DDK D<YK DYK DK YD$YYYDH YDH6YlTY-PJEJ@KdKKKDSK YK B@DDD<B[]]&L-E8L-HL.,TL.`L.pL/(|L/|L/L0$L0xL0L1 L1tL1L2 L2pL2,L3@L3lPL3`L4pL4hL4L5L5dL5L6 L-IDL-<(!L*TIL*|L+L)<L,TiL,JL,L,J$Xh,!L'dJlL'L((L&8L(8L(JL)$L)TD!L#KL$L$L#<L&8L&hL KpLK|d|l|tl!L hKL L!,L<L"|!LpL0LL4L<LLL4Ld8!L`LLL$Lp8L8LLJL|LLL KpL<LlLtNLLLLD LOLOLOL`KpLL( LL LP,L8LDLHLXL@pO L P L $L QL ,QL Q<L4 LL<L LDLLOKpJX&LRLΜLδLhLl΀LLR LLLLDLdLDSL LSP8 LS@YLDL@l`T-PS\ XLSLLL`DQL LSPL<T\ L\TTYThSPT\DNS-CDNS Client5@ 0H<$4@MMV(H(0T\px 08PX dhhMƐM(VHHH00 x$,LP$M԰MWHx8\,\tMMMMX8 $HdatDN`XN N MhMXDWNpN XN @YNYh N 4N MMLDN <`NxNN[ NZNN N(N NHZq NZDN< $4ZHXl[@@ N8[N lN DMtDMMN? N<NX0N<[ ZXNNhNN (N!$N!`N$N$N%(N%N&N&PN'N)N)N+<Cmʘ4äÔäÌT<ìP(،@H4@T@Ä@dÄP``ِHٸPp`THPŐ`THPŰ`XParameterAttributeStructx_ڈÄHڔP`TP`P`XP `4P0`XäP@ìøäÔäÌP``Pp`dø(äÜÜÄÜPäPɰɼ˨pHOg Og(O O(OOOPgO O OO<OgO DOh\O  ʘOThO c,HXtc<ԀԈdàԐd8Ԝdcd,c(0@H`hpՀՈ՜դո HPpx֌֤֔֬dd t  4ߔ8DHPA<ԀԈàd Tepe|4L<,D@PD@P0x@PepxPxtyP`8LyPL4L<,NNNNN N,N8NDNDOt ϠWO!P+P,lP-d'P,x8G P/Tc$N4N LN}N` 3Nd3N$x3NO N4cD#NP\N d,i#Nsdl#Nt|#NuҔ#NҨ#NwҸ#Nx3Ny#N3N83N3N3NHO(#N~c8+N,T#N4l3Nzx#N{ӈNӠ#NvӰN$N<cN<@NN|s8PMU8qoPV@qnP[mf88DmxP`9 WP@:!`@:!t@:@:@:@: 0@:!(@:@:@:!8LrPJ@wt|wۈwO: :|eD(T: d999(l9|: :2P:hwO:|e4<9H9: 9x9DPlePPP@PkLPePPP|WP:t:|fWP:t9TPTP\PPP``P{PɐP {h{4h{\{xPDP{xpP PP(xPiP{\ PP{XPP  P{TxP8 P4{PDP&PQoxQoQsPQwQQ8QQQz Q{XQ|Q|<` (8HT`p~0~LdXd|d dHD,$d* HDDhk8 PBdA`E`0<S`fxJ (32=nGQe[t\7r, RY/8DPJESS]@jVz;~{&)  #,2<OfzXqtwz}a+[ALY^kUkO1"C :'.5=DV@bqne j//9OfMfs_bF  I"4HHQ]4]]%]cmu~~(+/ 5h ,6ALTTxaumwL2 (,,        3/z0 ]0 <J0 ffDEDS@Sj;j8tQ =  Gs TT~~//Q4[HHff0404 ]]u040404b]]|  ĜD]]']]|.55VVw|  + +Y Y 0  @   aaTT,,~~//n j eL04 HH AArOO99q7qaccmmRmLm  CCConfig CDConfig CHConfig CIConfig CMNConfig COConfig CPConfig CTConfig CWConfigH450SystemConfiguration MWIConfigSystemConfigurationTransportAddress allocationsallocations_5allocations_57c_default_ciplc_default_cipl_105callPropertyModecallPropertyMode_28canRetainServicecanRetainService_95cct1cct1_92 cct2Busy cct2Busy_93cct2NoResponsecct2NoResponse_94cdt1cdt2cdt3cdt4cdt5 chanDescs channelscheckParamLengthcht1cht2cicl cidAssociateciplcit1cit2cit3cit4cit5cit6classReferencecmnt cmnt_107constrainingFieldcontainerOfObjectSetscontainerOfObjectscontainerOfTypescontainerOfValuescopySingleMessagescpt1cpt10cpt2cpt3cpt4cpt5cpt6cpt7cpt8cpt9ctt1ctt2ctt3ctt4defaultScopeIddefaultScopeId_25deleteSingleMessages delimiter delimiter_4doNotUsePropertyfieldOfClassReferencefieldOfEnumeratedfieldOfObjectReferencefieldReference fullPropertyimports importsArrayindicateCalling intervalip ip6Addressip6Address_51 ipAddress ipAddress_36ipSourceRouteipSourceRoute_39 ipxAddressipxAddress_47 localAddresslocalIPAddressloose manualStart maxBuffSizemaxBuffSize_17 maxCalls maxChannelsmaxMultiHomedAddressesmaxMultiHomedAddresses_19maxPoolSizeInKBmaxPoolSizeInKB_18 maxProcsmaxRasInTransactionsmaxRasOutTransactions maxServicesmaxServices_65 messagesmodulemwit1mwit2 nameChansnetBios netBios_54netnum netnum_49nodenode_48nsapnsap_55 objectArrayobjectReferenceobjectSetArrayobjectSetElementobjectSetReferencepdlName pdlName_56port portFromportToport_50 protocolsroute route_42routing routing_44silentMonitorIndsilentMonitorInd_106stricttcw tpktChanstpktNoBuffers typeArraytypeFromConstrainttypeReference udpChans valueNode valueTreevalues vtNodeCount vtPoolSize watchdog watchdog_33withSyntaxElement \-=bO`w@*5vG YXj|r    jw2FFQ gq 8   {, 5 H Uar'J*U j`O ",`6H1Yj=\ 9B}{+e1F&Xgq6 ^& H'0 CCYii {  x$  , yLV"U0H_is}Nqgli%:U g?{dwX }  *u 3 > H b b y # [  Q W /  U  (n 2 D [ o   A %      % = P ]1 j: z s ' 6  *   T -  A [ p    " ` | 5  3 F Zd ps  a ?  Q "f.<DQgu{ gZ 9N-o;vFRd ;zC1+ C " p9 UO f}%]= 5 K mmm*v     7  M! at0?  pW  ..CYak - ' ag    l  U  N d)gB P bjbbjw Bw 8a 2 Q  t X'm6<HRddd|dcdho 8o z   0Y{ 3   !/= vCP[g } m  ,2liRp{]Rv9  I1 +xdfk1///H///ICYFY Y g gg `gggg z]N/  0   *M:BMMIMM`WWqOqq    !d1 H`` ````` 1```%``g`j  yAY@2:%2 2 7 @ M(MMM 4MMMjM=MM~Zjdu  N ) J8l  ]P)4<CL ` `j`K`F`5`M`6``@n5Z  4  Qnqp-GWj  W o9icT4Jduur*lfH -D DDoDDDDDD |DDD|D D#DD gD D 3DD DDD(DD[DDD[DcDD ^D -DDDDDBD DTD uDoDrDDDDmRd y)yWyya~:kj |y% Q%66.6 7H :H1b t4ttn:zs71 p3w} ((7((((/<Yaai |  L  h9F    % 0? : HI H H H H H% T< ^' l u    F t     j $ ! ! ?! ! ! ! !. !H!\g!\!\ !\C!\ !\!\!\ i!\!\!\K!p !p!p!~ !~! !k!>!!!!!!!@!!~!!!\!!!Z!!!!#!" E" " " " " " ^""#f"2&"A"P"_V"n"} """ =" 9""%"" " j"4"c")"""" 3"Z"" " "A""""## j##"4#.D#A #[#[?#g #z#K#U# # ##"# ## $## f# O# # '# # ##$B$ .$$,$,$,$,$,$,C$,$,$, $7)$78$7z$7h$BX$MK$\ m$\ @$\ $\ 6$\($\$\$\ $\$\s$\ m$\7$\]$\ $\$\ $\$\ $\ $\,$\$\v$\$\u$\.$\$\$\ <$\=$\$i $i$i$i$i $|$ $ $ $ $ p$$$$$ $$O$$Z$($$s$0$ $%+%%"U%:%V%V%V<%V%Vy%h%h(%w%% %%% % % % && &&"&+&8&N&a&xR& &,&& &%&&'''*';R'Dz'J'V'n':'''m' ''''''' ' ''F' ':( ( (((,(,_(2V(<(F(N '(U (a(a(t ( ( ( ((:(((o(c(L)) d)p) )& 0)& 6)& x)& )&)& )& j)& )&)& )& ")& g)&)&+)&^)&)&")&)& )&)&)&)&)&&)&r)&)&)&W)&p)&)&)&); ?)J)_ )m)y&) )F))I))) ) ))O) * * *; *P*X*X*X*\*h*x****a****q* H*++ ++#a+'^+-[+2+8 +C+X+j+s#+s+I++s++N+"++^+Y+W++,,],&",&>,&,0 ,A ,Q ,b ,o,vK,v,v ,v ,v,v,vm,v , , <,,,,,,- - U--2-<-P-Y-j--- ---K-E- - .e.J.a.4 |.< u.H.Q.a.u..5.#.b.P.p..U..-.g.).k.}.n/8/ h/ /D//+ 5/+ /6/V/Vj/V/V/V /VH/V/V/V/e/{/////X//////000. 0.0.0.0. 0.0I0I N0Y 0a W0mx00000000>0111 ;1(16[1B1H1R1\1\1\ j1\1\X1\1\v1\1\"1\ 1\F1\1\g1\1\1\1i1}.111r1*1l11111"11 ]111111 111 L1 111x1d1 $1S11 111 111111i1E1111t11 v11O11 ^11911E1^1&11 111 2 2) 92@2@y2F72R2`C2j F22222N2222e262222$222R222 |2 3 c3 y3?3333'3:3Q3i3i3i,3i333333333 3333E3)33U3v3 33<3&44 44"4-484C|4Ni4XK4c54n4y4yy4y,4yH4]4v4/44|4T44444 4444 H5N5 5 5 545I5bw5b5b$5bB5b5b5bP5b35b5j5v5v 5555545555u525)555B5 O6 6 66(6(6(6(6.686W ~6f 96y66666v66/6666T667777)787M7bc7m7mR7z7C7 7!773727 777777_777777b7'7{7H778 !8 f8  8 8 8 I8 Z8 -8 %8 8 8 i8 8 ~8 m8 8 x8 a8 Z8 8|83g8K48Y78j,88x878*8888899=9@9#C9-F97R9AI9KL9UO9_9wz999p9s99X99999=999999 99 R9 9:::$f:4 m:9 :9 Z:9m:9:A:W E:c:w: A:: K: ::: ; ;^;;; ; [; !; *;#;#;#;#=;4 ;L ;h ;O;;v;;;; K;;;-;;; <></< s<< <B<<< F<< {<c< <<<<<< X< <<e<<<<@< < W<< < <y<[< <"<6_>#>!><>X >>e >mL>m>m>m(>m>m>x>xC>/>>>>s>]>"> >>>H>|>>> > >;>}>? /? T?Q?1? ? ? .? ?'?'?1O?1?C?Q2?V)?_?_ g?_?_?_?_L?g?t'?tb?t?t?t6?tE?tS?G?D???+?L? ??.?2????;??@@n@@ @+@A@J ,@P @Z @d @r !@y8@@ <@@@@I@@@@@L@:@ @@I@@#@AA&rA96APA^A^ TAq DA A AA AAAA AA AAAAAA AAATB-B6 BT BT BcBqB/BwBtBB BBBBBCCOCCCRC,!C> C`QCqTCKCCCvC|CWCBDyDNHM LHM HMHMHMHM HM HM:HMHM2HMRH^ sHgHgHgHp HHH H H HI dI  I ]II2+I2{I2mI2ID I^ I^IiUIxIvI EI ?II QIUIEJKJ@J-J>ZJ]PJJJJ"J,JKK KKK!K3K$K6K K -K K LLL {L$ (L$ L5LHELKHLNd % ? ? ;#;#!!@@@@?'?'((7722 mm; ;< <7 7D+ D6DDeC|DH?DHDS?DSC C`KC`CqKCqCBC|,?,F3?F3K # 6# F6FF6FK`cK`CZCDNDC9C-0 3:0 3'3'--a|KKK%|FbFb:c:cFCFC |1\1\J?JK ?K 'n?'n%?%%?%Fw?Fw>!?>!'V?'VJ?J>?>KKD?DH9?H9- $CcCCcC- - 3, b|33$$4 11yy$,i$,5bU5b   uu5jU5j+X+X$,i$,+sd+s$,i$,+sd+sF$7i$7<s<<s< $7i$7<s<<s<?<?E&E5bU5b?tD?t<s<<6s<6?tG?t$7i$7.s.@s@E{vE{ } $7i$7.s.@s@E{vE{ } EeE5bU5b?tD?t|=d=?C}?C==EE'J'JEqEEE+E5bU5b?tD?t-EEEEJEEE}E|44 } 1 EEE{vE{5n5(O({9s9$,i$,1\[1\ H9 H>mi>m  EEE{vE{5n5(O({9s9$,i$,1\[1\ H9 H>mi>m EEE{vE{5n5(O({9s9$,i$,1\[1\ H9 H>mi>m$$7m7m 9K9+-l+-+'g+'+#+#jj04045bU5b'DD'D5bU5b  /T|44)K) D //#6#  uc u5U5 l l7zĜU EEE{vE{5n5(O({9s9$,i$,1\[1\ H9 H>mi>m$$7m7m | ? 9?98?8?*?*E?E1\[1\+j+j|?9?9GG= <99== :8B8##BKKKK ^8B8..BKKKK| T' T 0 0LHLHLKLK$M <';K';.K.$BK$B 11yy0<T (T  ;0 04 2|a?a=`?=`/{Ĝ60 -j -0 DĜ:E.6E.DD##!~]!~EE, z  <<#[?#[,?,-P-PC?C,?,,,::::::?---Y-Y5 ?5 6y6y?AP?AP66/e/e$|Ĝ RĜ`EĜ<|@?@!?!@?@2R?2R0.?0. <"<<<1#1EEDD)&)&" H"$\$\`'`6>Ĝ Q  <"<1#1>;>!\!\/EEDD)&)&" H"$\$\ <"<8  8 1#1EEDD)&)&$\$\8Ĝ  <"<8  8 1#1!\!\8x8k6kEEDD)&)&` `$\$\0  <"<1#1EEDD)&)&<"<EEDD)&)&.u.u y<"<1#1EEDD)&)&" H"$\$\|2?2=?=HM?HM<"<1#1//EEDD)&)&<"<1#1EEDD)&)&:|?(U?(U>>)y?)y5&&>6>5Ĝ)A9Ĝ'Ĝ ;KĜ 5 1#1//`'`565>K>Ky:y$ ;$ ;MMddEEDDA&6A&525I2 I2M M5ĜBzĜ%1#1<"<!p6!p!\!\99gg! ! 55EEDD)&)&060` `**H6H$\$\<"<//1#1;;EEDD)&)&J+JI 6I><?><00j?j$\$\j|2?2<"?<"=?=Y<"<;;1#1EEDD)&)&$\$\6 <"<1#1EEDD)&)&` `M MI2 I2$\$\H|#"?#"2F?2FHM?HM<"<!\!\`'`//11#1##EEDD)&)&6` `M MI2 I2E< E<>;>$\$\=AĜ  |2?2)?);?;HM?HM=?=.?.=1y=1;>Ĝ<"<gg991#16;;EEDD)&)&AxA/V6/V" H"$\$\M M>;>'0  <"<!\!\1#1;;??6##EEDD)&)&6x6HCH" H"$\$\''M M|2`?2`)?))?)(?()?)HM?HM=?=Y <"<;@;YY1#1EEDD)&)&$\$\5<"<dd1#1EEDD)&)&` `$\$\Ĝ j<"<!\!\`'`//MMdd1#1##EEDD)&)&6` `I2 I2$\$\`|W?W)?);?;HM?HM?<?<)?);>" H"$\$\ ? 6? 666(6(;#6;#!6!767 6 @6@@6@?16?1262IiĜ *+\ +ĜY=<"<ddtt**1#16;;EEDD)&)&FFL6LJ+J+^+IIM MI^UI^AxA>;>/V6/V" H"$\$\z|!H?!H#z?#z1?1|a?a#?#g|6?64?4/?//?/w"<"<MM!\!\tt@A@A@+@+dd//1#1Y:Y`'`6w6w6@@bb##EEDD)&)&FFL$6L$$ $ ` `M M6x6HCH" H"$\$\|2j?2j?HM?HM5?5=?=9<"<; C;1#1EEDD)&)&$\$\"<"<1#1EEDD)&)&$\$\|;>B6?B6D DA AI^UI^"}"} " H"$\$\AĜ [ <"<8  8 1#1i6igg99E.6E.DD##!~]!~EEEEDD)&)&+86+8!\!\L$6L$,v6,v5?5D DBT?BTID 6ID/V6/VA Ag g ` `" H"$\$\{|?>>>Ĝ@P0 t = ;==~ ;=~ @J @J?? /+?/+ood>X>X::AqĜ;6;0I D0I% D%A^ DA^0a4  4 3 ET\ |:4:4EN gENH^H^=6=3c3222 c2' 'FF ]0Y W0Y' ' j@d! ?|@Z @Z441\,1\' '5v ]5v|??|??PTB B  !6! 66G>e6>e/+6/+oo= ;=;L04 Q|;h;h;4 ;42 Ĝ# 1 1vv!v!??K@r?@r ? (N?(N K K  C>E E- -- -d dK??K K1611#166$,$E^,E^"1#1%%uE{E5bU5b?tD?tEE5bU5b?tD?tEE5bU5b?tD?t##E{vE{EqEE{vE{EqE|TH}}9*dd0m0m EEE{vE{5n5(O({9s9$,i$,1\#1\ H9 H>mi>m EEE{vE{5n5(O({9s9$,i$,1\#1\ H9 H>mi>m'D'{|1\#1\Y?Y+ + 1R1R H|&?&'''''*'*X|1\#1\++$,$' '5v ]5vH404F0  ,qT2 * CT 0 r0404 ])6)Eh6Eh j9699699#69#9-69-9A69A9K69K9U69U97197"|1\#1\16?16EdE*d* Z1\#1\ s 's')s) p|1\#1\2@?2@? 67 99##06077f|D?Db?bbbg 1#1  gg99!p6!pEEDD77;;mm66==K8\'8\( 8\/8\E04(<8\'(,(,EE/ / ((''KK?8\>8\904.8\?V8\B|?Q)?Q.#./8\!8\/8\.8\.8\(28\  (,V(,.P..J./ D/ !>!.8.B/BBBBB9w9w>>?? 3|j\j$$ o|Hg?Hg+?++?+5 ?5 ,?,? |Hg?Hg)J?)J/?/0?0A?A? \ [7M7M7878 8888 |88DD7)7)//9@@  -|LL99 \&+T \|  &"&"I I FF  55.. b|33$L$ 11yy8j\@8K,8K8Y,8Y'|G2G2F1F':'@,@CcCCcC- - Kt04KXLKX7bX7bKiXKiY1#1-1#1 *1#17x7Ĝ1#1~A ACCCgC 1#1~A A1#1~A A1#1~A A1#1~A A1#1~A A}1#1~A As1#1~A Ai1#1~A A_1#1~A A |1#1%%%%%%&&&&&&KKBB11C,C,7x71#1BĜC?0<  1#1KX]KX#[i#[$$$-u-DoD-6-H>6H>?1?A-A 8  8 EEDD8  8 EEDDg8  8 EEDDD8  8 EEDD204004*h*X*X6(6(6.040041H04*1B1B006(6(=q|@?@,o?,o=UĜ**X*X6(6(<<=h=h**X*X6(6(R|*x*x*****\*\00221i#1i"nĜ  8  8 6$$%VU%VEEDD" " /V6/V,v6,v!?! |<?<?=?=HM?HMn?n@y?@y1 ?1 0?0"?"#.?#.F?F`'`1#1"_ĜĜJ8  8 ))`'`:9&:9;;EEDDZ$$" V" /V6/V,v6,v!?!>;>M M" H"6%VU%V F$J@?JJ@?JJ@?J0@?0 D|6?66?6v?v |6?62@?2@$?$?!?!/?/ 3|Hg?HgH?H'?''?''?''?'/?/Ĝ5IĜ+ĜY-GG3Q3Q"PĜ%:ĜUL|?+2?+2*P?*PH?H?Ĝ  '8  8 $$???6?tt6`'`< <Y:YMM??;;%"%"EEDD" " .6.!6!!\!\/V6/V,v6,v++66==>;>Bc?Bc` `M M6x60I D0I% D%A^ DA^5454  |1?1#?#H?H?)?)1(?1(H?H$?$R?R?(F?(FHM?HM!?!>?>W?W?0?01#1;';$i?$i0.?0.G?G)m?)m p 8  8 :9:9EEDDCC66==` `>;>" H""AĜU8  8 EEDD" " !?!M M+ĜY"2Ĝ8  8 $$6`'`%VU%VEEDD" &" /V6/V,v6,v+"+66==!?!>;>` `" H""#Ĝ 8  8 6$$%VU%VEEDD" f" /V6/V,v6,v!?!" H""Ĝ8  8 6$$%VU%VEEDD" " /V6/V,v6,v66==!?!>;>` `" H"1\#1\+?+%w%w.aĜGiGCG.Q.QG?G1#1%Ĝ&Ĝ&a |? "? j*( (;#;#!^!77 ? @@@u@?1f?12W2 &N&N1#1&&%h6%h%%1} 1}GMGM8?8@@$\$\J04I7c7J@JÃ&x&xIEI/0 2D0 N D0 '83|b?bE?E9?99?9I68g8DbDDbD/X/D]D/X/D{D{C B N = <<-2-2,?,2?2%h?%h %? %<?<,?,5 ?5 BBBBBBBBPP[[IxvIx<?<6868+C?+C/6/6-<-<mm= c=‚~7c7&8N&84<„4?gc?g > 477,b @  4n??,& ,& „334y4y4774c??,& ,& „3534y/4y4X22 „'3K3\,\(,„)LNcLN.c.c'c'.c.=c=44C??,& ,&:w:w„3|34yv4y//H 48HH44„M33@@4-GG3i 3i66??==„L333 g34"GG3i 3i66??==??:A :A „t333 g34HH44„q33@@4 GG3i 3iq„p333 g34HH44„m33@@3GG3i 3i66??==„l3&33 g3: ?F„*B*J] 4++J>PJ>4F%F%(P(:$:$4N(P(|„3i34y]4y4T4Ìb!!2Q2\8q qJJQÌu\JJ{Ì}F\JJÌ \?_?_7A77%7JJ.Ì >x>xr!!7A77%72Q2\+X+?_?_8q q::JJ ÌZ!!2Q2\?_?_JJ Ìr!!7A77%72Q2\JJ}Ì ..JJ Ìnr2Q2\JJgÌ{>x>x\+X+?_?_q qJJ Ì r!!7A77%72Q2\`JJÌr!!7A77%72Q2\JJÌr!!7A77%72Q2\?_?_JJ. |? ? wU;#;#@@!!@@7 7?'?'(?(2/2J-%J-G" 4" C|44GG Pƒ7c7//.H.H#*,0123456789#*0123456789abc ANSI-41-UIMAddressPatternAdmissionConfirmAdmissionRejectAdmissionRejectReasonAdmissionRequestAlerting-UUIEAlertingMessage AliasAddress AltGKInfo AlternateGKAlternateTransportAddressesAuthenticationBESAuthenticationMechanismBandRejectReason BandWidthBandwidthConfirmBandwidthDetailsBandwidthRejectBandwidthRequestBearerCapability CallCapacityCallCapacityInfoCallCreditCapabilityCallCreditServiceControlCallIdentifier CallLinkage CallModelCallProceeding-UUIECallProceedingMessageCallReferenceValue CallStateCallTerminationCause CallTypeCalledPartyNumberCalledPartySubaddressCallingPartyNumberCallingPartySubaddressCallsAvailableCapacityReportingCapabilityCapacityReportingSpecificationCauseChallengeStringCicInfoCircuitIdentifier CircuitInfo ClearTokenCompressionTypeConferenceIdentifierConferenceList Connect-UUIEConnectMessageConnectedNumberConnectedSubaddressContentCryptoH323Token CryptoTokenDHsetDataProtocolCapability DataRate DateTimeDisengageConfirmDisengageReasonDisengageRejectDisengageRejectReasonDisengageRequestDisplayECGDSASignatureECKASDHECpoint ENCRYPTEDElementEncodedFastStartTokenEncodedGeneralTokenEncodedKeySignedMaterialEncodedKeySyncMaterialEncodedPwdCertTokenEncodedReturnSigEncryptIntAlg EndpointEndpointIdentifier EndpointTypeEnumeratedParameterExtendedAliasAddress FacilityFacility-UUIEFacilityMessageFacilityReasonFastStartTokenFeatureDescriptor FeatureSetGSM-UIMGatekeeperConfirmGatekeeperIdentifierGatekeeperInfoGatekeeperRejectGatekeeperRejectReasonGatekeeperRequest GatewayInfo GenericDataGenericIdentifierGloballyUniqueIDGroupIDH221NonStandardH235CertificateSignatureH235Key H245SecurityH248PackagesDescriptorH248SignalsDescriptor H310Caps H320Caps H321Caps H322Caps H323-UU-PDUH323-UserInformation H323Caps H324CapsHASHEDICVIV16IV8 Identifier InfoRequestInfoRequestAckInfoRequestNakInfoRequestNakReasonInfoRequestResponseInfoRequestResponseStatusInformation-UUIEInformationMessageIntegrityMechanism KeyMaterialKeySignedMaterialKeySyncMaterialKeypadFacilityListeningAddressLocationConfirmLocationRejectLocationRejectReasonLocationRequestMcuInfo MobileUIM MoreDataNonIsoIntegrityMechanismNonStandardIdentifierNonStandardMessageNonStandardParameterNonStandardParameterH235NonStandardProtocolNotificationIndicator Notify-UUIENotifyMessage NumberDigitsParams PartyNumber PasswordPreGrantedArqUsePresentationIndicatorPrivatePartyNumberPrivateTypeOfNumberProfileElementProgress-UUIEProgressIndicatorProgressIndicator31ProgressMessageProtocolIdentifierPublicPartyNumberPublicTypeOfNumber PwdCertTokenQ931ApplicationMessageQ931Configuration Q931Message Q954DetailsQseriesOptionsRASConfiguration RTPSession RandomValRasApplicationMessage RasMessageRasUsageInfoTypesRasUsageInformationRasUsageSpecificationRedirectingNumberRegistrationConfirmRegistrationRejectRegistrationRejectReasonRegistrationRequestReleaseComplete-UUIEReleaseCompleteMessageReleaseCompleteReasonRequestInProgressRequestSeqNumResourcesAvailableConfirmResourcesAvailableIndicate ReturnSigScnConnectionAggregationScnConnectionTypeScreeningIndicatorSecurityCapabilitiesSecurityServiceModeSendingCompleteServiceControlDescriptorServiceControlIndicationServiceControlResponseServiceControlSession Setup-UUIESetupAcknowledgeSetupAcknowledge-UUIE SetupMessageSignal Status-UUIEStatusEnquiryMessageStatusInquiry-UUIEStatusMessageStimulusControlSupportedPrefixSupportedProtocols T120OnlyCapsT38FaxAnnexbOnlyCapsT38FaxProfileT38FaxRateManagementT38FaxTcpOptionsT38FaxUdpOptions TerminalInfo TimeStamp TimeToLiveTransportAddressTransportChannelInfo TransportQOSTunnelledProtocol%TunnelledProtocolAlternateIdentifierTypedCertificateUUIEsRequestedUnknownMessageResponseUnregRejectReasonUnregRequestReasonUnregistrationConfirmUnregistrationRejectUnregistrationRequestUseSpecifiedTransportUserInformation UserUserV3KeySyncMaterialV42bisVendorIdentifier VoiceCapsabbreviatedNumber activeMC adaptiveBusyadditionalSourceAddressesadditionalSourceAddresses_231additiveRegistration!additiveRegistrationNotSupportedaddressaddressNotAvailableadmissionConfirmadmissionRejectadmissionRequest alertingalertingAddress alertingTime algorithmOIDalgorithmOIDsalgorithmOIDs_514alias aliasAddressaliasesInconsistentallowCallsWhenNonRegallowedBandWidthalmostOutOfResources altGKInfoaltGKisPermanentalternateEndpointsalternateEndpoints_720alternateGatekeeperalternateGatekeeper_600alternateTransportAddressesalternativeAddressalternativeAliasAddress amountStringamountString_478annexE ansi-41-uim answerCall answeredCallassociatedSessionIdsassociatedSessionIds_506audioauthenticationBESauthenticationCapabilityauthenticationCapability_513authenticationModeauthenticatonauto autoAnswer bChannelbadFormatAddress bandWidth bandwidthbandwidthConfirmbandwidthDetailsbandwidthDetails_694bandwidthRejectbandwidthRequestbasebearerCapability billingModebillingMode_479bits bonded-mode1 bonded-mode2 bonded-mode3bool busyAddress busyCause busyReasoncallCreditCapabilitycallCreditServiceControlcallDurationLimitcallEndcallForwardedcallIdentifiercallInProgress$callIndependentSupplementaryService callLinkage callModelcallProceedingcallReferenceValuecallReferenceValue_2 callServicescallSignalAddresscallSignalAddress_766callSignalingcallSignalingPort callSpecificcallSpecific_814 callStartcallStartingPointcallStartingPoint_469callStartingPoint_484 callStatecallStateValuecallStateValue_18 callTypecalledPartyNotRegisteredcalledPartyNumbercalledPartySubaddresscallerNotRegisteredcallingPartyNumbercallingPartySubaddresscallscanDisplayAmountStringcanEnforceDurationLimit canMapAliascanOverlapSendcanReportCallCapacitycapability-negotiation capacitycapacityInfoRequestedcapacityReportingCapabilitycapacityReportingSpeccause causeValuecertProtectedKeycertProtectedKey_901 certSign certificate challengechannelMultiplier channelRateciccic_449 cic_449_450 circuitInfoclassReference clearSaltclearSaltingKeyclosecname cname_503codingStandardcodingStandard_81collectDestination collectPINcompare15bitRasCrv complete compound compound_497conferenceAliasconferenceCallingconferenceGoalconferenceGoal_204 conferenceIDconferenceListChoice conferencesconferences_256connect connectTimeconnectTimeOutconnectedAddressconnectedNumberconnectedSubaddressconnectionAggregationconnectionParametersconnectionParameters_219connectionTypeconstrainingFieldcontainerOfObjectSetscontainerOfObjectscontainerOfTypescontainerOfValuescontent contentscreatecredit cryptoEPCertcryptoEPCert_421cryptoEPPwdEncrcryptoEPPwdHashcryptoEPPwdHash_419cryptoEncryptedTokencryptoEncryptedToken_892cryptoFastStartcryptoFastStart_427 cryptoGKCertcryptoGKCert_424cryptoGKPwdEncrcryptoGKPwdHashcryptoGKPwdHash_420cryptoHashedTokencryptoHashedToken_899cryptoPwdEncrcryptoSignedTokencryptoSignedToken_894 cryptoTokenscryptoTokens_826currentCallCapacitydatadataPartyNumberdataRatesSupporteddataRatesSupported_332 data_773 data_912 dateTimedaydebitdefaultdefaultGatekeeperdefaultProtocoldelay delay_804desiredFeaturesdesiredProtocolsdesiredTunnelledProtocoldestAlternativesdestCallSignalAddress destExtraCRVdestExtraCRV_202destExtraCallInfodestinationAddressdestinationCircuitIDdestinationInfodestinationRejectiondestinationTypedhExchdhkey diagnosticsdiffSrcAddressInSetupAndARQdigSigdirectdiscoveryCompletediscoveryRequireddisengageConfirmdisengageReasondisengageRejectdisengageRequestdisplaydontRegisterOnTimeoutdummydummy_3duplicateAliase164 e164_347 earlyH245 eckasdh2 eckasdh2_859 eckasdhkey eckasdhp eckasdhp_855element elementID email-ID email-ID_350empty encrptvalencryptedDataencryptedSaltingKeyencryptedSessionKey encryptionend endOfRangeendTimeendpointAliasendpointAliasPatternendpointAliasPattern_598endpointControlledendpointIdentifier endpointTypeendpointVendorenforceCallDurationLimitesnesn_368exceedsCallCapacity facilityfacilityCallDeflectionfailedfastConnectRefused fastStartfastStart_144fastStart_153fastStart_160fastStart_171fastStart_213fastStart_257fastStart_276featureServerAlias featureSetfeatureSetUpdatefieldOfClassReferencefieldOfEnumeratedfieldOfObjectReferencefieldReference fieldSizefillBitRemovalflag forcedDropforwardedElementsfullRegistrationRequired gatekeepergatekeeperConfirmgatekeeperControlled gatekeeperIdgatekeeperIdentifiergatekeeperRejectgatekeeperRequestgatekeeperResourcesgatekeeperRoutedgatewaygatewayDataRategatewayResources generalID generalId generatorgenerator_852 genericDatagenericDataReasongenericData_827 globalCallIdgroup group_454gsm-uimguidh221h221NonStandardh221NonStandard_914h235Keyh245 h245Address h245Controlh245Control_131h245SecurityCapabilityh245SecurityCapability_210h245SecurityModeh245Tunneling h248Messageh310h310GwCallsAvailableh310SeparateVCStackh310SingleVCStackh320h320GwCallsAvailableh321h321GwCallsAvailableh322h322GwCallsAvailableh323h323-ID h323-ID_348h323-UserInformationh323-message-bodyh323-message-body_126 h323-uu-pduh323GwCallsAvailableh323pduh324h324GwCallsAvailableh4501SupplementaryServiceh4501SupplementaryService_128 hMAC-MD5hMAC-iso10118-2-lhMAC-iso10118-2-shMAC-iso10118-3halfkeyhash hashedValshdlcFrameTunnelingwSARhdlcFrameTunnelling hopCounthopCountExceeded hopCount_716hourhplmn hplmn_382 hybrid1536 hybrid1920 hybrid2x64 hybrid384icvidid_340imei imei_381imports importsArrayimsi imsi_364 imsi_378inConfinIrr incompleteincompleteAddress infoRequestinfoRequestAckinfoRequestNakinfoRequestResponse informationinformationTransferCapabilityinformationTransferRateinsufficientResourcesinteger integrityintegrityCheckValueintegrity_523internationalNumber invalidAlias invalidCID invalidCallinvalidCallSignalAddressinvalidConferenceIDinvalidEndpointIdentifierinvalidPermissioninvalidRASAddressinvalidRevisioninvalidTerminalAliasesinvalidTerminalAliases_587invalidTerminalTypeinviteip ip6Addressip6Address_296 ipAddressipAddress_281ipSourceRouteipSourceRoute_284ipsec ipxAddressipxAddress_292 irrFrequencyirrFrequencyInCall irrStatusisTextiso9797 isoAlgorithmiviv16iv8join keepAlivekeepCallOnQ931ClosekeyDerivationOIDkeyExch keyMaterialkeypadFacility language language_164 language_221 language_648language_648_649 layer1Identlevel1RegionalNumberlevel2RegionalNumber localNumber localTCF locationlocationConfirmlocationRejectlocationRequest location_83loosemaintainConnection maintenance makeCall manualAcceptmanualCallProceedingmanualDiscoverymanualDiscovery_834 manualRASmanualRegistrationmanufacturerCodemanufacturerCode_917 maxCallsmaxConnectingCallsmaxFailmaxMulticastTTLmaxMulticastTTL_840 maxRetriesmaxRetries_839maximumCallCapacitymaximumStringLengthmaximumStringLength_932mcmcumcuCallsAvailablemcuCallsAvailable_445mdnmdn_366mediaWaitForConnectmember member_452messagemessageContentmessageContent_135messageNotUnderstood message_6midmid_372minmin_365minute mobileUIMmodSizemodulemodulusmonth moreDatamrandommscid mscid_369msisdn msisdn_367 msisdn_380 multicastmultipleCallSignalingAddressesmultipleCallsmultipleRASAddressesmultipleRASAddresses_845 multiratenToNnToOnen_IMA1 n_IMA1_116n_R1 nakReasonname name_882nationalNumbernationalStandardPartyNumber needResponseneedToRegisterneededFeatureNotSupportedneededFeaturesnested nested_498nestedcryptoTokennetBios netBios_299netnum netnum_294networkProvidednetworkSpecificNumbernewConnectionNeeded newTokensnextSegmentRequested noBandwidth noControlnoH245 noPermission noSecuritynode node_293 nonIsoIM nonStandardnonStandardAddressnonStandardControlnonStandardDatanonStandardIdentifiernonStandardMessagenonStandardProtocolnonStandardReasonnonStandardUsageFieldsnonStandardUsageFields_472nonStandardUsageTypesnone normalDrop notAvailable notBoundnotCurrentlyRegisterednotEstablishControlnotRegisterednotificationDescriptionnotificationIndicatornotifynsap nsap_300 number16 number32 number32_496number8 numberDigitsnumberOfCodewordsnumberOfCodewords_931numberOfScnConnectionsnumberingPlanIdentificationobject objectArrayobjectReferenceobjectSetArrayobjectSetElementobjectSetReference object_913octet3 octet3_19 octet3_26 octet3_30 octet3_34 octet3_38 octet3_47 octet3_54 octet3_58 octet3_7 octet3_72 octet3_74 octet3_80octet4 octet4_10 octet4_63 octet4_78 octet4_84octet5 octet5_14octetsoddEvenIndicatoroidoneByte oneByte_4oneToNopen originatoroverlappedSendingpISNSpecificNumberparallelH245ControlparallelH245Control_229paramS paramSsalt parametersparmS partyNumber passwordpdupdu_777 pdu_777_778 perCallInfoperCallInfo_768perCallInfo_768_769permissionDenied pointCodepointCode_451 pointToPointport port_295postControlDisconnectionDelaypreGrantedARQpreGrantedARQ_557preGrantedArqUsepreTimeToLiveRegistrationpreTimeToLiveRegistration_844prefixpresentationAllowedpresentationIndicatorpresentationRestricted priority priority_396privateNumberprivateNumberDigitsprivateTypeOfNumber productId profileInfoprofileInfo_877 progressprogressDescriptionprogressIndicatorprogressIndicator31 protocolprotocol-discriminatorprotocolDiscriminatorprotocolIdentifierprotocolPreferenceprotocolPreference_107 protocolTypeprotocolVariantprotocolVariant_344 protocolsprotocols_805provisionalRespToH245Tunneling public-key publicNumberpublicNumberDigitspublicTypeOfNumberpwdHash pwdSymEnc q932Full q951Full q952Full q953Full q954Info q955Full q956Full q957FullqosControlNotSupportedqualificationInformationCode!qualificationInformationCode_375r raceAnnexE raceTPKTradiusranIntrandomrange range_351 rasAddressrasMulticastAddressrasPortrateMultiplierrawreasonreasonForRedirection reason_457receiveCompressionrecomendation recvAddressredirectingNumberrefreshregistrationConfirmregistrationInforegistrationInfo_835registrationRejectregistrationRequest rejectReasonreleaseCompletereleaseCompleteCauseIEreleaseCompleteCauseIE_473releaseCompleteReasonremoteExtensionAddressreplaceWithConferenceInvitereplacementFeatureSet replyAddressrequestrequestDeniedrequestInProgressrequestRandomrequestSeqNumrequestToDropOtherrequesterRandom requiredreregistrationRequiredresourceUnavailableresourcesAvailableConfirmresourcesAvailableIndicate responseresponseRandomresponseTimeOutresult result_819routerouteCallToGatekeeperrouteCallToMCrouteCallToSCNrouteCalltoSCNrouteCalltoSCN_737 route_287routedrouting routing_289 rtcpAddressrtcpAddresses rtpAddressss_864scopeIdscreeningIndicatorsecondsecureChannelsecureSharedSecretsecurityDenialsecurityDeniedsegmentsegmentationAndReassemblysegmentedResponseSupported sendAddresssender sendersIDsendingCompletesentseparateLANStackserviceControlserviceControlIndicationserviceControlResponseserviceControl_813sesn sesn_376 sessionIdsetset_311setup setupAcksetupAcknowledge sharedSecretsidsid_371signal signalValue signaturesignature_904signature_906socsoc_377sourceAddresssourceCallSignalAddresssourceCircuitID sourceInfosparespare1spare2 spare_82srandomsrcAlternativessrcCallSignalAddresssrcInfossrc ssrc_504 standard standard_488start startH245 startOfRange startTimestartedstatusstatusEnquirystatusInquirystimulusControlstoppedstrictsubIdentifiersubaddressInformationsubscriberNumbersubstituteConfIDssubstituteConfIDs_776 supportAltGKsupportedFeaturessupportedFeatures_502supportedH248PackagessupportedH248Packages_549supportedPrefixessupportedPrefixes_599supportedProtocolssupportedTunnelledProtocols supportedTunnelledProtocols_312supportsAdditiveRegistrationsupportsAltGKsymmetricOperationRequired system-idsystem-id_370systemAccessTypesystemMyTypeCode t120-onlyt120OnlyGwCallsAvailablet302t304t310 t310_102t322 t322_103t35CountryCode t35Extensiont38FaxAnnexbOnly!t38FaxAnnexbOnlyGwCallsAvailablet38FaxMaxBuffert38FaxMaxDatagramt38FaxMaxDatagram_940t38FaxProfilet38FaxProtocolt38FaxRateManagementt38FaxTcpOptions t38FaxUdpECt38FaxUdpEC_941t38FaxUdpOptionst38TCPBidirectionalModet38TCPBidirectionalMode_944 t38UDPFECt38UDPRedundancyt38UDPRedundancy_943t_DTt_IMA1 t_IMA1_115t_R1t_R2 t_R2_113tcptelexPartyNumber terminalterminalAliasterminalAliasPatternterminalAlias_836terminalCallsAvailableterminalExcluded terminalTypeterminationCausetext text_491 threadIdthreePartyService timeStamp timeToLivetlstmsi tmsi_379 toBeSignedtoken tokenOID token_896tokens tokens_825totalBandwidthRestrictiontpkttranscodingJBIGtranscodingMMR transferModetransferredTCFtransmitAndReceiveCompressiontransmitCompression transparent transport transportIDtransportNotSupported transportQOStransportQOSNotSupportedtransportedInformation ttlExpiredtunnelledProtocolAlternateIDtunnelledProtocolIDtunnelledProtocolObjectIDtunnelledSignallingMessagetunnelledSignallingMessage_134tunnelledSignallingRejectedtunnellingRequired twoBytes twoBytes_5type typeArraytypeFromConstraint typeOfNumbertypeOfSubaddresstypeOfSubaddress_55typeReferenceudpundefinedNodeundefinedReasonunicodeunknownunknownMessageResponseunreachableDestinationunreachableGatekeeperunregistrationConfirmunregistrationRejectunregistrationRequest unsolicitedurlurl-IDurl_455usageInfoRequestedusageInformationusageReportingCapability usageSpecusageSpec_650 useAnnexEuseAnnexE_105useGKCallSignalAddressToAnswer!useGKCallSignalAddressToMakeCalluseSpecifiedTransport user-datauser-data_123user-informationuser-information_125userInformationuserInformationLayer1Protocol!userInformationLayer1Protocol_16userProvidedNotScreeneduserProvidedVerifiedAndFaileduserProvidedVerifiedAndPassed userUseruuiesRequestedv120 v14bufferedv42bisv42lapmv76wCompressionv76wCompression_928 valueNode valueTreevaluesvendorversion versionIdversionId_336 version_936video video_772voicevoiceGwCallsAvailablevplmn vplmn_383 weierstrassA weierstrassBwhen when_432 when_465 wildcardwillRespondToIRRwillSupplyUUIEswithSyntaxElementxyyear~@HLUn<#9###g9#g##;|#;;;H#H! ;+8##,<;#A;+8;|;=; ;###H! .HJ&8&x&N/G$.HJ&8&x&N:E.:E..H? J&8&x&N? .H? 4y? .H? J&8&x&:E.:E..HJ&8&x&N.HJ&8&x&N.HJ&8&x&N.H74y7.HJ&8&x:9.H4y*.HJ&8&x&N.HJ&8&x&N.H:E.:E..HJ&8&x&N4y.H@PUUPUIPUNPUNSPUSPUADTPRUPRL2PRL1PRPPRLPRAN:E..H(.H(J&8&x1J&8&x1.H7232J&8&x14y74y774y7232J&8&x1.H2232J&8&x1232J&8&x1@(#)RADVISION H.323 Protocol Stack 4.2.2.3b.H? &8&x&N? <M6=J66.H&8&x&N.H&8&x&N.H&8&x&N.H;#&8&x&N;#.H!&8&x&N!.H@&8&x&N@.H@&8&x&N@.H(&8&x&N(.H?'&8&x&N?1.H7&8&x&N7.H2&8&x&N2SVS dS)S S@TSw8S}S|S@SRRhR RtRRRUUHUSURRS.H;#4y.H!!.H!!J&8&x&N J&8&x&N!:9J&8&x&N!:9.H4y*.H4y*.HJ&8&x&N1#H)1(H$R(FHM<=!>Wn@y01 0"#.F+2*PH64//D$-#[?>x3(q4yI&x1??;?t?<M!$" :9);`.H>x.H3(.H.Hq.H.H.H.HJ&8&x&N?.HJ&8&x&N.HJ&8&x&N?.HJ&8&x&N.HJ&8&x&N.HJ&8&x&N;.HJ&8&x&N.HJ&8&x&N?.HJ&8&x&Nt.HJ&8&x&N?.HJ&8&x&N$.HJ&8&x&N.HJ&8&x&N<.HJ&8&x&NM.HJ&8I.HJ&8&x1.HJ&8&x&N" .HJ&8&x&N!.HJ&8&x&N$.HJ&8&x1.HJ&8&x&N" .HJ&8&x&N$.HJ&8&x1.HJ&8&x&N" .HJ&8&x&N$.H.HJ&8I.HJ&8&x1.HJ&8&x&N" .HJ&8&x&N:9.H4y.HJ&8&x1.HJ&8&x&N!.HJ&8&x&N!).HJ&8&x&N!.HJ&8&x&N!;.HJ&8&x&N!`.HJ&8&x&N!:9J&8&x&N:934yJ&8&x&N!5.HJ&8&x&N? 54S<(4<DLT\dlt|,4DXp $TVTVTV\ƜTVTVTVTVTVTVTVTVTVTVTV :DD! ! ! D! ! ! :E.E.!p!p!p!\!\!\!\!\!\!\!\!\!\!\!\!\!\!\!\!\!\!\:#############:EEEBTBT;HM;HM;HMM6#;HM;HM2F$m999;;99!~:!~:E.KXgb<g<t<;!\#<0j';*D:9;*;/``$$E.!pD! w@A?;7<9;;7<;7<9gD:D!\:#H! .HJ&8&x&N&N!&N" &N? 54&N!:9@y.H!J&8&x&N!:91 &N&N$&N? 54%.HJ&8&x&N&N? 54.HJ&8&x&ayr.HJ&8&xV<VHVV/G.HJ&8&x&N$d>r/G.HJ&8&x&N$.HJ&8&x.H!J&8&x&N!HM.H!J&8&x&N!:9F.H!J&8&x&N .H;#4y.H;#4y.HJ&8&x&N$/G.H!J&8&x&N!:9@y.H!J&8&x&N!$(6T5+$       v r   \ I 8 K  ) :  ) :   `  r " w  q 6 J   `  R   *     > $  O ;    i /D/i//-///// / // / ////[/ U//r///////h//88U888HHHH'H>HUHHzHHlHHHcHHHHHH H H OH_HH HyHH H HUUU~U UaU UnU U {U [UxU AUU U!UU2UUCUUUoU.UUCUBUU2U!UUVUUUUUUUUUU3UJUUTUUUUzUUUiUUXUUU6UGUee-euee%eee e e Le eeeeeeeeMe9eee e||| m| h| c|K|P|[||||^|c|h|m||||| ||||||| ||||%|||||| | ~r J l ^ DYd$$q96}5F EW{ 1[5MFX b |  ,Ae* f ux Rc0( ;P}R, tAo X N = <=@ 0U{k@l G x XQD?f+/w >u/  S^3  & : K(\ jj=j:x:93ZNHB $i2`@M]r-'  . [ s g L V+h=_OO [krui1r1FN~[}[[`[Z[6[H[N[T[*[$[B[l[<[[0[W[[[[[[[[[[f[[c[[[[[[K[[[[[u[[[[[[[[[[?[o[[[[v[[j[ H[^[ [[R[[C[4[.[(["[[[t[[&[[e[Y[[[*[[[[[[$[[[[6[[2[>[_[J[D[[[Sak u sg[)O3@=1G+Q%[eoy z#q-b7\AVKPUG_Ai;s/}#  r'l1`;TEHO<Y3c'm!w ic]WQKE?93-' !&3KA<O*[gyG,  0 0 :  :E D # T e qC y     {   Q   3 I _ p  } } A W  * K f v   G J 3 ! ! 4 J] Z % e r      " X 0 @ O ^ me |W I = )     !0?N]ls{ia3+}"1 p> O[gt  o 3 $  6 B@ ^T .it g C x  xrlf ~ + ? 7M bw \   C  ' U' @:N` xu y'=y,mBaXUnFh5)4J`vxf-&o; (H R ] T] g Xgg Ig$g]g0g @gog g pg |g?gKz L "?\yn 'Da~~i]QE,I @WbIo 7o Uo 'P9 v j ^1 M c{  p   H%:I =Uj~'tZI?-q 8* 5D\pzp (&&<&l9QLcLaq  6 G  .AK~Vg_n t v     3 F ` t/'2Jo^,MF<`8m m s |}    1  h    D\$u{`  o     {  o b % Z 7 9 . B     0    # 6 M M Z k k k' kH ku ki k k k y y  yb y y y y y y  \     ! !!!1!?!O!_!o!!!!! ! N!9!P! !" +" Y" "*w"; "; "D "P"] "d "n "t "}"" " " " """" I" ###0#B##YN#m ## # # [# :# s# # # J# e# }# y# # # # *# # !# # $$ $ '$ $.$9$D$O$Z$e$pz$ 7$ 4$ $ M$ K$ =$ E$$f$ $ % % % % %$ %) %1 %1 %<%D %K %U %U*%U<%US%b %b %j %u %%%u%^%+%%"%4%%% %& L& &9l&Ne&gV&g &u -&~ & & & & k& O&& & &S&' ' P' '-': 3'N'Ne'N'N'Nc'N'N 'N 'N'N '_ 'vI' a' '' k'''' 0( ( ((("("(+ (+ (+ -(+ <(P(l({( ((((((()))&)5)D)S)b)q)))))))))***%*4*C*R*a*p*********+++$+3+B+Q+`+o+~ + 0+ C+ )+ + P++A++;+5+n+Y+, :, l, #,,=w,[M,y ,E,$,,,u,0,Q,,T,?,3,,W,!,6,B,---N---#-2 -2 -2 -2-2 -2 -? -? -P-P-P-a-j-j-j-j-|"- - - - - - - r- '- - 6- -- u- *- - 9- . 0. ?. . !.# &./_./.9.G |.V d.k a. ^. . ...... s. m. j. / /'Y/'>/'/8V/G!/G R/G :/X/g O/g 4/z F/ / / W////70 0& 0S 0}0040a0 y0 a0k0e0i1m1q1,u1>1S1c =1c 41c v1k d1k61kf1kW1kE1k*1k1|11112229Z2TN2oB292 -2 &222223  33, 3, 39 a3J 3J 3X o3j33333|3p3d4X4'I4<4Q4f4{4k484,4 4455#585M5b5w5{505 5u5 5 5 5 6 6 6 6 6/ *6=66=M6=6=6=6=6=$6=6K6K6T 6a6q 6w 666k6 6 6T666 "6 6 7 77-!7;A7C7S7a7q7777777~8 818J8f8~8x888999=9P9h9{9 9 989 R9}9M99:r:* :5 :C :U :g:m :} :a:y:U:M:Q: y:: f:\:; ; ; m;, ;, ;9;D;X;g;g;gS;r F;r;r;r 1;r;{;E;;;; ; ;; _; g< c<4 7q@x7q?<@x<@7@x7A%@x%B6a@x6aC!?@x!?D!O@x!OE!_@x!_F!o@x!oG!@x!H!@x!I!@x!J!@x!Kd   ({l " e|""-2 -2(l(l.9 4:%U%U&g&g+ +::././   !4@ 6= 6=:%U%U   6= 6=:%U%U   :$] 6= 6=:%U%U&g&g+ +::././  &N u&9e&9  k$,@x,@x$;@x;-@x-,@x,,@x, g-j -j  &- -  [ k kO V-j -j-P -P   k k V-j -j  t V k kg-j -j V-P -P2 2,,    k k  V! !   I k k 3 V! !3 r3 -P -P2 2,,  [, ,,,,}, k kO- -, ,, ,,,  A, ,,,,}, k k3- -, ,, ,,,   J| 'N 'N k k   k k      f   Ĝ j$@x| '- '-$&@x&'@x''@x'i$@x@x@x | y y'N 'N v6= 6=.. // $$;r@x;r@x@x@x| y y'N 'N' T 99* *'  ' &&- -/X /X/G/G0 '++` `+ +/'/'++99'  ' &&/8 /8/'/'=| y y'N 'N+00++ '"* "*$p $p99D D5 5+ +/'/'++1| y y'N 'N6= 6=  ..6= 6=# #| y y'N 'Ny..6= 6= | y y'N 'N.. 6= 6=N N Ĝ lz| y y'N 'N o og gO$H@xHu@xu D$.#@x.#6/@x6/ #/g /go o/G/GI` Ig g/z /zg g/g /g/G/Go og g0 01k 1k; ;g g0 0g g :| y y'N 'N 0| y y'N 'N5 |5 5 |`x`qxq/x/&|m m"; ";; ;;, ;, -2 p-2%1 %%1 e|xRxR 6 67 73 3F F K& &" "6T 6T    + M   .|! !# #3J 3J3, 3,# #. .,yC # #X HC,: ,2+ 02+X H+1c8 &1c?# #1c -1cI+ P # #$ $+X H+]: @]/„# #. .39„# #X HC,: ,3X„# #1c -1c#„# #$ $+X H+]: @]|# y#3J o3J3, a3,/ W/ 6 M  MX M #8 # Z, p404 r049 9+~+~>|<4 <4( (Ĝ T 0 0 o \0& o0&0S \0S-2 p-2-? -? 0-2 p-26 \6:-2 p-26 \6-? -?|- p--x-(+x(+. p.|- --x-(+x(+. .|- --x-(+x(+. .|- --x-(+x(+. .6 $ [|$ E$! ! 04" Q"w$;@x;<@x<;@x;&@x&|-x--x-`x`<8\"d8\"t8\%u8\;8\"8\ " ";  ; %b %b"n "n"] "]< {<68\6w8\/04%8\68\:5|6 6% %%K8\8\%j8\%8\%)8\"8\ " "%$ %$%  % %b %b %D %D:* :*:U :U:C :C. .6q 6q6 6 Z|; ;"  " T|;rx;r$x$$x$,x,$x$'x'|;rx;r"x"& x& &x&9x9'x' "\@.k ..k.V X.Vt. C.. X.1|. g.t Xt: X:.G ^.G& X&\"DTs\\|m m"; ";; ;;, ;, -2 p-2%1 %%1 |( (" "4 '_ '_n n _:me:m:}e:}$$(04&~04## #---04&04&04$& && &- -6|9x9$x$5Ĝ $# #--5 56 6## #--|# ## #$ $# #&u &u' '': ':  rU  eHu/rUo 'E|:E|'E|!  0rU- ' H9u/rUo 3 -eEH'Bu/rUo <1 9eQH3Nu/rUo H{ He]HBZu/+rUo TM ZeiHNurUf ` iH`u/3rUo l re~{rUx r0 xerU  ~erU E|0E|$E|6E| erU  erU  e/arUo z erU p erU  Hu/irUo  Hu/srUo  rU    rU  (,rU) # 18rU5 /'vE|;#YE|A;gE8M|G% !Hu/rUo P% 3HEu/rUo V% JHEu/rUo \ ienkrUh b;gE8w|qE|z%E|_ erU A erU -a Hu/rUo - Hu/rUo -| Hu/rUo ! Hu/rUo ! Hu/rUo V *Hu/rUo K KH<u/rUo ;gE8|0 leHfu/ rUo 0} xeHru/rUo 3 ~erU "P e rU ;E8| 'E|:E|(PE|E|%7E|+#BE|1 eLIrUF @F XrUU O, drUa [ ,prUm g G|rUy s: hH_u/)rUo  Hu/=rUo # Hu/IrUo  eHu/WrUo : Hu/erUo E|;{E|#mE|;E8|j  rU ~  .rU 9  CrU   LrU   gH u/rUo   sH u/rUo U  erU    eH [u/rUo .E|!E|'1>E|-9E|3'E|9E|?#0E|E#E|K"E|Q'E|W/E|]/E|c;E|i * G 6W3 f a k!W3W3 f a k!W3W3 f a k!   l ` T H < rb4 3 p' H rb4a\{ 3kfl 3kf p 8/'# ] iKI;NASGN iK?SG? iK?SG \uV^Pb0q!zqzqEq q WE3-q WE3-q ~gP9"   E WE3-   iW3-#1+% WK#1+ iWK  |iWK  m iWK?-#1+%   os^gM[(@<O ^WE3  OWE3  @ WE3  tZ'I8v:8/'#  tZ'I8os^gM[(@pH l ` T H < r\uV^P G 6<Ob~gP9" 4 3 p' qN&ic]WQKE?93-#1+%'I;! f  a  k!kfa\NAzSGq #*,0123456789#*0123456789abc&ArgumentType&Errors&ParameterType &ResultType&alwaysReturns&argumentTypeOptional &errorCode&operationCode¶meterTypeOptional&resultTypeOptional&returnResult &synchronous ANSI-41-UIMActivateDiversionQArgActivateDiversionQResAddressAddressInformationAddressScreenedAlertingNameArg AliasAddress BasicServiceBasicService_197 BusyNameArgCICapabilityLevel CIFrcRelArgCIFrcRelOptResCIGetCIPLOptArg CIGetCIPLRes CIIsOptArg CIIsOptResCINotificationArgCIProtectionLevel CIRequestArg CIRequestRes CISilentArgCISilentOptResCIStatusInformation CIWobOptArg CIWobOptRes CTActiveArgCTCompleteArgCTIdentifyResCTInitiateArg CTSetupArg CTUpdateArgCallHoldOperationsCallIdentifier CallIdentityCallParkPickupOperationsCallReroutingArgCallReroutingRes CallStatusCallStatus_152 CallTypeCallWaitingArgCallWaitingOperationsCallingNameArgCcArg CcLongArg CcRequestArg CcRequestRes CcShortArg CfbOvrOptArgCfnrDivertedLegFailedArg CharacterSetCheckRestrictionArgCheckRestrictionResCmnArg CoReqOptArgCode Code_122 Code_126 Code_129 Code_132 Code_135 Code_138 Code_141 Code_144 Code_161 Code_162 Code_163 Code_164 Code_167 Code_170 Code_172 Code_175 Code_178 Code_181 Code_184 Code_187 Code_190 Code_194 Code_230 Code_231 Code_232 Code_233 Code_234 Code_235 Code_237 Code_242 Code_246 Code_250 Code_254 Code_263 Code_265 Code_269 Code_273 Code_277 Code_281 Code_285 Code_289 Code_295 Code_300 Code_308 Code_309 Code_312 Code_316 Code_320 Code_322 Code_324 Code_337 Code_338 Code_380 Code_383 Code_386 Code_389 Code_392 Code_408 Code_410 Code_414 Code_418 Code_422 Code_426 Code_430 Code_438 Code_439 Code_440 Code_441 Code_445 Code_449 Code_453 Code_458 Code_461 Code_465 Code_469 Code_473 Code_476 Code_479 Code_500 Code_501 Code_502 Code_505 Code_508Code_80Code_81Code_82Code_83Code_84Code_85Code_86Code_87Code_88Code_89Code_90Code_91Code_92ConnectedNameArg CpNotifyArg CpRequestArg CpRequestRes CpSetupArg CpSetupResCpickupNotifyArgDeactivateDiversionQArgDeactivateDiversionQResDiversionReasonDivertingLegInformation1ArgDivertingLegInformation2ArgDivertingLegInformation3ArgDivertingLegInformation4Arg DummyArg DummyResEndDesignationEndpointAddress EntityTypeErrors ExtendedName Extension ExtensionSeq ExtensionSetFeatureControl FeatureListFeatureValuesGSM-UIMGeneralProblemGloballyUniqueIDGroupIndicationOffArgGroupIndicationOffResGroupIndicationOnArgGroupIndicationOnResH221NonStandardH225InformationElementH323-MWI-OperationsH323CallCompletionOperationsH323CallDiversionOperationsH323CallIntrusionOperationsH323CallOfferOperationsH323CallTransferOperations H323CommonInformationOperationsH4501SupplementaryServiceHoldNotificArg IntResultIntResultListInterpretationApduInterrogateDiversionQArgInvoke InvokeId InvokeIdSetInvokeProblemMWIActivateArgMWIDeactivateArgMWIInterrogateArgMWIInterrogateResMWIInterrogateResEltMixedExtension MobileUIM MsgCentreIdNSAPSubaddressNameNameOperationsNamePresentationAllowedNamePresentationRestricted NbOfMessagesNetworkFacilityExtensionNonStandardIdentifierNonStandardParameter NumberDigitsNumberScreenedObjectSet_121ObjectSet_128ObjectSet_131ObjectSet_166ObjectSet_169ObjectSet_171ObjectSet_174ObjectSet_177ObjectSet_249ObjectSet_253ObjectSet_264ObjectSet_268ObjectSet_272ObjectSet_276ObjectSet_280ObjectSet_284ObjectSet_288ObjectSet_319ObjectSet_321ObjectSet_323ObjectSet_407ObjectSet_409ObjectSet_421ObjectSet_457ObjectSet_464ObjectSet_468ObjectSet_472ObjectSet_475ObjectSet_504 OperationSetParkConditionParkedToPositionPartyCategory PartyNumberPartySubaddress PickExeArg PickExeRes PickrequArg PickrequRes PickupArg PickupResPresentationAllowedIndicatorPresentationIndicatorPresentedAddressScreenedPresentedAddressUnscreenedPresentedNumberScreenedPresentedNumberUnscreened PriorityPrivatePartyNumberPrivateTypeOfNumber ProcedurePublicPartyNumberPublicTypeOfNumberROSRUAlertOptArgRejectRejectProblemRemoteHoldArgRemoteHoldResRemoteRetrieveArgRemoteRetrieveResRetrieveNotificArg ReturnErrorReturnErrorProblem ReturnResultReturnResultProblemSSCIProtectionLevelScreeningIndicator ServiceApdus SimpleNameSubaddressInformationSubaddressTransferArgSubscriptionOption TimeStampTransportAddress Type_236UserSpecifiedSubaddressabbreviatedNumberactivateDiversionQactivatingUserNraddressNotAvailable alerting alertingCall alertingName allServicesalwaysReturns_75_125alwaysReturns_75_134alwaysReturns_75_137alwaysReturns_75_140alwaysReturns_75_143alwaysReturns_75_180alwaysReturns_75_183alwaysReturns_75_186alwaysReturns_75_189alwaysReturns_75_193alwaysReturns_75_241alwaysReturns_75_245alwaysReturns_75_294alwaysReturns_75_299alwaysReturns_75_315alwaysReturns_75_382alwaysReturns_75_385alwaysReturns_75_388alwaysReturns_75_391alwaysReturns_75_413alwaysReturns_75_417alwaysReturns_75_425alwaysReturns_75_429alwaysReturns_75_444alwaysReturns_75_448alwaysReturns_75_452alwaysReturns_75_460alwaysReturns_75_478alwaysReturns_75_507alwaysReturns_75_76 ansi-41-uim answered anyEntity argumentargumentExtensionargumentExtension_159argumentTypeOptional_69_120argumentTypeOptional_69_123argumentTypeOptional_69_168argumentTypeOptional_69_191argumentTypeOptional_69_239argumentTypeOptional_69_243argumentTypeOptional_69_247argumentTypeOptional_69_251argumentTypeOptional_69_292argumentTypeOptional_69_297argumentTypeOptional_69_313argumentTypeOptional_69_411argumentTypeOptional_69_415argumentTypeOptional_69_419argumentTypeOptional_69_423argumentTypeOptional_69_427argumentTypeOptional_69_442argumentTypeOptional_69_446argumentTypeOptional_69_450argumentTypeOptional_69_459argumentTypeOptional_69_462argumentTypeOptional_69_466argumentTypeOptional_69_470argumentTypeOptional_69_503 argument_109 attendant audio3100HzbasicCallInfoElements basicServicebasicServiceNotProvided busyNamecallAlreadyPickedUp callFailurecallForceReleased callIdentity callIntrudedcallIntrusionCompletecallIntrusionEndcallIntrusionForcedReleasecallIntrusionGetCIPLcallIntrusionImpendingcallIntrusionIsolatecallIntrusionNotificationcallIntrusionRequestcallIntrusionSilentMonitorcallIntrusionWOBRequest callIsolatedcallOfferRequest callPickupIdcallPickupIdInvalidcallRerouting callStatuscallTransferAbandoncallTransferActivecallTransferCompletecallTransferIdentifycallTransferInitiatecallTransferSetupcallTransferUpdate callWaiting callbackReqcalledAddress callingInfo callingName callingNrcallingNumbercallingPartySubaddresscan-retain-service ccCancelccExecPossible ccIdentifier ccResume ccRingout ccSuspend ccbsRequest ccnrRequestcfb cfbOverridecfnrcfnrDivertedLegFailedcfu characterSetcheckRestrictionciCapabilityLevelciProtectionLevelciStatusInformationclassReference%clearCallIfAnyInvokePduNotRecognized cmnInform cmnRequestconnectedAddressconnectedInfoconnectedNameconstrainingFieldcontainerOfObjectSetscontainerOfObjectscontainerOfTypescontainerOfValues cpNotify cpRequestcpSetupcpickupNotifydatadataPartyNumberdata_24deactivateDiversionQdeactivatingUserNrdestinationAddress(destinationAddressPresentationIndicator%destinationAddressScreeningIndicatordestinationAddress_101destinationEntitydestinationEntityAddress discardAnyUnrecognizedInvokePdudiversionCounterdiversionCounter_208diversionReasondiversionToServedUserNumberdivertedToAddress divertedToNrdivertingLegInformation1divertingLegInformation2divertingLegInformation3divertingLegInformation4 divertingNre164e164_26email email-ID email-ID_29 emergExtendDesignation endpointerrcodeesnesn_46establishmentFailure extendedName extension extensionArgextensionArg_510extensionArgumentextensionArgument_104 extensionIdextensionId_103 extensionRes extensionSeqextension_223failureToMatch faxAndEmailfeatureControl featureListfeatureValuesfieldOfClassReferencefieldOfEnumeratedfieldOfObjectReferencefieldReference fileTransferfutureReserve1futureReserve2futureReserve3futureReserve4futureReserve5futureReserve6futureReserve7futureReserve8generalglobalgroupIndicationOffgroupIndicationOngroupMemberUserNrgsm-uimguidh221NonStandardh225InfoElementh323-ID h323-ID_27 holdNotifichplmn hplmn_60imeiimei_59imports importsArrayimsiimsi_42imsi_56insufficientInformationinteger integer_333internationalNumberinterpretationApduinterrogateDiversionQinterrogatingUserNrinvalidCallStateinvalidDivertedNumberinvalidMsgCentreIdinvalidReroutingNumberinvalidServedUserNumberinvoke invokeId invoke_105ip ip6Addressip6Address_16 ipAddress ipAddress_1ipSourceRouteipSourceRoute_4 ipxAddressipxAddress_12 iso8859-1 iso8859-2 iso8859-3 iso8859-4 iso8859-5 iso8859-7lastReroutingNrlevel1RegionalNumberlevel2RegionalNumber linkedIdlocal localNumber local_78longArglongTermRejectionloosemanufacturerCodemdnmdn_44midmid_50minmin_43 mobileUIMmodulemscid mscid_47 msgCentreIdmsisdn msisdn_45 msisdn_58multimediaUnknown mwiActivatemwiDeactivatemwiInterrogatenamenameNotAvailablenamePresentationAllowednamePresentationRestrictednationalNumbernationalStandardPartyNumbernbOfAddWaitingCallsnbOfAddWaitingCalls_317 nbOfMessagesnetBios netBios_19netnum netnum_14networkFacilityExtensionnetworkProvidednetworkSpecificNumbernoNotificationnodenode_13nominatedInfonominatedInfo_215 nominatedNr nonStandardnonStandardAddressnonStandardDatanonStandardIdentifier notActivatednotAuthorized notAvailablenotBusynotIncomingCallnotificationWithDivertedToNr notificationWithoutDivertedToNrnsapnsapSubaddressnsap_20numberAnumberB$numberNotAvailableDueToInterworkingnumberOfDiversionsExceedednumericStringnumericString_334object objectArrayobjectReferenceobjectSetArrayobjectSetElementobjectSetReferenceobjectSet_532objectSet_533objectSet_534objectSet_535objectSet_536objectSet_537objectSet_538objectSet_539objectSet_540objectSet_541objectSet_542objectSet_543objectSet_544objectSet_545objectSet_546objectSet_547objectSet_548objectSet_549objectSet_550objectSet_551objectSet_552objectSet_553objectSet_554objectSet_555objectSet_556objectSet_557objectSet_558objectSet_559objectSet_560objectSet_561objectSet_562objectSet_563objectSet_564objectSet_565objectSet_566objectSet_567objectSet_568objectSet_569objectSet_570objectSet_571objectSet_572objectSet_573objectSet_574objectSet_575oddCountIndicatoropcodeoriginalCalledInfooriginalCalledNroriginalDiversionReasonoriginalReroutingReasonoriginatingNrpISNSpecificNumber parameterparameterTypeOptional_77_262parameterTypeOptional_77_311parameterTypeOptional_77_336parameter_112parkCondition parkPosition parkedCall parkedNumberparkedToGroupparkedToNumberparkedToPositionparkedToUserBusyparkedToUserIdleparkingNumberpartyCategory partyNumberpartySubaddresspartyToRetrievepickExepicking-upNumber pickrequpickupportport_15presentationAllowedpresentationAllowedAddresspresentationAllowedIndicatorpresentationRestrictedpresentationRestrictedAddress primaryEnd priority priority_331privateNumberprivateNumberDigitsprivateTypeOfNumberproblem problem_113proceduralError procedure publicNumberpublicNumberDigitspublicTypeOfNumberqualificationInformationCode qualificationInformationCode_53redirectingInforedirectingNrredirectionInforedirectionNrredirectionNumberredirectionSubaddressrejectrejectAnyUnrecognizedInvokePdu reject_108rejectedByNetworkrejectedByUserremoteEnabledremoteEnabled_221_222remoteExtensionAddress,remoteExtensionAddressPresentationIndicator)remoteExtensionAddressScreeningIndicator remoteHoldremoteRetrieveremoteUserAlertingremoteUserBusyAgainreroutingNumberreroutingReasonreservedNotUsed1reservedNotUsed2reservedNotUsed3reservedNotUsed4reservedNotUsed5resourceUnavailablerestrictedNullresultresultExtensionresultTypeOptional_72_127resultTypeOptional_72_130resultTypeOptional_72_165resultTypeOptional_72_173resultTypeOptional_72_176resultTypeOptional_72_248resultTypeOptional_72_252resultTypeOptional_72_463resultTypeOptional_72_467resultTypeOptional_72_471resultTypeOptional_72_474 result_110 result_111retain-serviceretain-service_434retain-sig-connectionretrieveAddressretrieveCallTyperetrieveNotific returnErrorreturnError_107 returnResultreturnResult_106returnResult_70_124returnResult_70_133returnResult_70_136returnResult_70_139returnResult_70_142returnResult_70_179returnResult_70_182returnResult_70_185returnResult_70_188returnResult_70_192returnResult_70_240returnResult_70_244returnResult_70_293returnResult_70_298returnResult_70_314returnResult_70_381returnResult_70_384returnResult_70_387returnResult_70_390returnResult_70_412returnResult_70_416returnResult_70_420returnResult_70_424returnResult_70_428returnResult_70_443returnResult_70_447returnResult_70_451returnResult_70_477returnResult_70_506returnResult_70_71 rosApdus rosApdus_119routeroute_7routing routing_9screeningIndicator secondaryEnd servedUserNrservice serviceApduserviceUnknownsesnsesn_54 shortArgshortMessageServiceshortTermRejectionsidsid_49silentMonitoringPermitted simpleNamesocsoc_55 sourceEntitysourceEntityAddressspecialServiceNumber specificCallspeechspeechAndEmail speechAndFaxspeechAndVideospeechFaxAndEmailspeechVideoAndEmailspeechVideoAndFaxspeechVideoFaxAndEmailssCCBSPossiblessCCNRPossiblessCFreRoutingSupportedssCHDoNotHold%ssCHFarHoldSupportedssCHFarSupportedssCIConferenceSupportedssCIForcedReleaseSupportedssCIIsolationSupportedssCISilentMonitorPermittedssCISilentMonitorPermitted_531ssCISilentMonitoringSupportedssCIWaitOnBusySupportedssCIprotectionLevelssCOSupported&ssCPCallParkSupportedreserveFeature13ssCTDoNotTransferssCTreRoutingSupportedssMWICallbackCallssMWICallbackSupportedstrictsubaddressInformationsubaddressTransfersubscriberNumbersubscriptionOption*supplementaryServiceInteractionNotAllowedsynchronous_73_74 system-id system-id_48systemAccessTypesystemMyTypeCodet-61t35CountryCode t35ExtensiontelefaxGroup2-3telefaxGroup3telefaxGroup4Class1 telephonyteletextelexPartyNumbertemporarilyUnavailable timestamptmsitmsi_57transferringNumber transportID typeArraytypeFromConstrainttypeReference undefinedunknownunrecognizedCallIdentityunrestrictedDigitalInformation unspecifiedurl-IDuserNotSubscribeduserProvidedNotScreeneduserProvidedVerifiedAndFaileduserProvidedVerifiedAndPasseduserSpecifiedSubaddress valueNode valueTreevaluesvideovideoAndEmail videoAndFaxvideoFaxAndEmailvideotelephonyvideotexSyntaxBasedvplmn vplmn_61withSyntaxElement+$#+$##]1c1c$,.+$+$1c+$1c1c2$+$+$+$+$+$1c1c$,.1c1c$,.1c1c$,.+$1c1c$,.+$1c1c$,.+$+$+$0+$#]+$1c1c$,.1c1c$,.#]#]+$+$+$+$+$+$#]1c1c$,1c1c$,1c1c$,Lc1c1cL$,+$LLLc1c1c&+$LLLL+$+$#]#]1c1c$,.+$##1c1c$,.+$##+$#]+$+$#]1c1c+$#+$+$+$$,1c1c1c1c$,1c1c1c1c+$+$1c1c$,+$##]6T5##]+$+$+$6T5#]""#]#"+$+$+$1c1c+$+$1c1c$.+$+$+$1c1c1c1c$.1c1c$.+$+$#]###+$"`"q"/6T5#+$6T53J+$6T53,$6T5/.!.#.3J.3,z <,7p7|7,X7777$77777787488(8@8X8p48888899909D49`49|9959999:::(:<:P:`:p:::::::;;; ;,;8;P;h;;;;;;;;;;< < <0<@> 4@>>,><3>D>P>\>h>t>>>>>>5>>>>>???$?4?@?L?X?d?p?|?|?5??TRGSEctIdlectAwaitIdentifyResponsectAwaitUserResponsectAwaitInitiateResponseXXXXhX@X(TRDSEctIdlectAwaitUserResponsectAwaitSetupResponseTRDSE_AwaitSetupResponse1ctAwaitUserResponse1ctAwaitConnectXXXPX|X0X\TRTSEctIdlectAwaitUserResponsectAwaitUserResponse1ctAwaitSetupXXDXXРXXCDACDA-IdleCDA-WaitWsWthWWWtCDDCDD-IdleCDD-WaitWuTWvWWWvCDICDI-IdleCDI-WaitWwWwWWWx0CDOCDO-IdleCDO-DivertWxWyhWz0W}HWzLWxCDRCDR-IdleCDR-AwaitUserResponseCDR-InvokedWztW{WpW,WtWzTW~$CDSCDS-IdleCDS-Act-WaitCDS-AwaitUserResponseW(WWWW~XCDSICDS-Inv-IdleCDS-RequestedWW|W|WWWDCDFCDF-Inv-WaitCDF-AwaitUserResponseWW8WWHWWHGSEHGSE-IdleHGSE-Idle-Only-NEHGSE-NE-HeldHGSE-RE-RequestedHGSE-RE-HeldHGSE-RE-Retrieve-RequestedWW@WxWWǴHDSEHDSE-IdleHDSE-NE-HeldHDSE-RE-HeldHDSE-RE-AwaitUserResponseHDSE-RE-AwaitUserResponse1WȘWDW0WܸWȐPRKGCPG_IdleCPG_RequestedXLX]lXvXM@PRKDCPD_IdleCPD_SetupRequCpickupSetupInitCPD_In_ProgressXNXOPXPLX|XXMPRKTCPT_IdleCPT_WaitforPickupCpickupRemoteRequestedCpickupRequestedXU4XUXVXXDXSXWPKUPCPUP_IdleCPUP_RemoteRequCPUP_WaitConnectXWXgX{hX^<GPSRVGPSRV_IdleGP_NotifyOnRequGP_NotifyOffRequX_ Xb Xo|XcGPMEMGPMEM_IdleXcXdXy`Xz,XcWGSEWGSE-Call-Waiting-IdleWGSE-Call-Waiting-InvokedXՐX՘XXX WDSEWDSE-Call-Waiting-IdleXXtXXXXMWIMCMWI-MC-IdleMWI-MC-WaitMWI-MC-AwaitUserResponseX$X"X#X1X9X$HMWISERMWI-Ser-IdleMWI-Ser-WaitMWI-Ser-AwaitUserResponseMWI-Ser-AwaitUserResponse1X%X&X'X-|X7X%hNIENI-IdleXTX@tX<@CCCC-IdleCC-Wait-AckCC-Invoked-UserACC-SuspendedCC-Wait-UserACC-RingoutCC-Wait-UserBCC-Invoked-UserBCC-Await-CompletionCC-Wait-UserB-AlertWdW_0Wa8We\Wl,WcWrPWrCOCO_IdleCO_Sent_InvokeCO_Dest_InvokeXCXAXAXJlXH4XBCIACIA_IdleCI_Wait_AckCI_Wait_Ack_NTFCI_Orig_InvokedCI_Orig_IsolatedCI_Isolation_RequestCI_Forced_Release_RequestCI_WOB_RequestWWWpW WCIBCIB_IdleCI_Dest_WOBCI_Get_CIPLCI_Dest_NotifyCI_Dest_InvokedCI_Dest_IsolatedCI_CbiggerThanACIB_Not_BusyCIB_In_ProcessWWXXhX0WxCICCIC_IdleWXWWWCMNCMN_IdleCMN_Wait_AnswerCMN_Wait_ResponseCMN_Wait_Answer_ResponseWHWFWG8WKWPtWH%%%%%%%%%""PUUPUIPUNPUNSPUSPUADTPRUPRL2PRL1PRPPRLPRAN%U"""7-"LLLLLLLXhX|XXXXY'dY6T5#+$]""6T5#+$9&"3 ,3 """%U"%U-2%U(l%U-2%U"%U-2%U(l%U"%U-2%U(l%U"%U-2%U(l%%%%%%"+$6T5"""??P===>VVVVVVV Xm XLmLWmW:|Wz W,Q Xm X:| Xz X,Q XGGTTWmW:|Wz W,QWWCYWWyHWy;Wy,WyWVW9.WLmL:|Lz L,QLnnWWXXPXYYpڢ!h4b)Ngt ;"QJy4:C0+ m_7O5mmQE䅵vb^~LB7k \8kZ$|KI(fQ[=|cH6UӚi?$_e]#ܣbV R)pmg 5NJtl#s'ڢ!h4b)Ngt ;"QJy4:C0+ m_7O5mmQE䅵vb^~LB7k \8kZ$|KI(fQS0m0m0m'J0mEEE'DEEEEEEEEE'DE?tE?tE'DEED.HJ&8&x&ND0m0m0m0m0m0m0m;EUE.H? J&8&x&N? E0mD.HJ&8&x&ND.HJ&8&x&NDEE$,E.HJ&8&x&NE:!\:!\.H!J&8&x&N .HJ&8&x&ND %)+/5;=CGIOSYaegkmqq\(\H\\\](]`]]^^@^x^^_ _X__``8`p``a0axaab4bbbcTcccd4dlayEwKd>EwK"RNbR!d>rjd>sd>Ga!@d>GD)d>Ga!@d>GD)@JkA@%bt$+$4$ayfjd>fjQa5ayW3.HJ&8&x&N" 5(U[.HJ&8&x&N!.HJ&8&x&N" .HJ&8&x&N" QTxp w \Y!c>OexTX  08:R\pa q3L_Zu     '>pO_shz8+AQo qC D# 78C MeQx  O4m /hG Yq o&RW)  < <- V$ v! H      : 1 K h  T   /  + 1 Ee [w t z =    K  & 8 K k    %  ? d  x    %& GcNyuY 4H _ z U5FO@3`W2g{    .!f60G'YIx P ; 2 & s d R C0 G a ~  # 3R"aw vneJY<4CS{z  .g ,r)<Y =l{A hSSA'V''-8CLPV`*hrNEK t S_>  +>8W uiQC7^X  Y h \ k  b+ _+F eFKK nQZ Jcnn|)>4 "5J;JWh yUyy%y &A~Ml#<DL[cnx +xxTxj/ )k,n/q %   2##5787IIItI;[[[w[>nnnznA  /#=LfyfN#]c    >    n e G  _)) )t)eFhhhhbhq |;?p%1HHYn$\#"hCb]nW  ' > X n.     !! ! ! ! X!! 8!k!! !!!V!+ !6 ,!A !L !W F!b!mF!zC!8!=!2!D!>!!""&y"?"W"p"["]"c"M"@" " " "`""|" "# # ]#(y#(#(#1Z#M#M#Mv#M#U#a#q#q####D##5###$$ $+ $+$4q$N$h$$$$$ $t$%%%1%Gz%bA%x%%%%% r%%& i&&6&J&\&o M&o& F&&+& &S&&w&_&&&&V&&Y&z& &b''P''"'"\'"t'+'>'J'Z'Z 'Z'eM't''e'''9'@' '{'((( (/(B(_(((o((((W( (( ( (7( (u((((( ) )$ ):N)H&)U)c))p)~,))9))a)@)))v** m*?d*U_*q **_*** * * * ***s+p+ g+-m+>j+Nn+Y+e;+w5+G+++A+x+l+,,",?,Q,Qa,^P,o,',,,&,,,,,,y,,|,- -b- -- -5-5-L-L-hf-uZ--- - - - - - ----C-..2%.2.H+.H.`(.`.t....... / /!e/4/D/Y /Y +/i/w /w/w/>/b//_//A0k0+ 05r050Q90q0~0~ 0H06030-000 0 0 0 1 |11-:1- 1-1@1@G1Q21Q1Q1Qk1f&1|1 1 1 1 ,1 1212/2@2f2v222@222223(3,3>3X3v3U33)3D3 :333344%4&4& 4.4:4:4D 4S4S4SC4S4\4\Y4q4q\4:44h4P4 45 )5 z5 >5 5 55 5 _55 S5 55@5e5e5e 5| 5 55P55S55V5f6Z66-u6Gt6O6h6h 6y66$6G66O6R6U7X7 (77! %7!7.7. .7; +7;7H 77H7R 47R7\ 17\7f7f C7m7 R77 77y77V7 :777 =77 @8 O8 8 a8 8- L8-8:V8JM8]"8]8l 8 ^8828858V8 99.M9@19V9V9f9w%9 "959n99s99j:a: [::.:. U:;:; X:Hj:N:[:m :|[:|z:|:::::): ::::;q;!;-;CD;Y;Y";i;i;;z; ;w;8;<2<1<1 <7== >=> >>>>$>9>P>k >z>>>>>>L?I? ;? ?h?%/?4?B?T?\Y?\?k?k\?zQ?z?P???i??? ? Q? v? 4@ @ N@ @' B@6 @L g@f @r @@@@@s@@@@@A A*A3AH=AZ:Ao2A A AAAA FA"B BB/ IBABWBrBBRBOBLBIB^B[BdBaB/CC tCC C(C ~C* gC=iCOCY8CbSCxVCCCCBCNCChC3CzCC C C CCC CCCCCDD!MD<DWaDzeDzDzDz,DDDD dDYDEVEE_E*E*_E8E8bEFLEXwEf.Ef EfEf E{EEEEEE_EEF!F!F6FOFOBFhFgF-F@F FCF0FFF3GTG G*GDGaGGtGGsGGkGGGGGGGHH,;H?;HXHd H&H"HHHHI/I2I'FI@EI@I@I@QIPIe5IyIIIIIIJ J!J:JMJZJlJJJRJ:J>JJK K PK xKK4KR KRVKR~KgKgYKWKJK{KSKKKKoK L LeL)XLG;L_LoLzLLLLLLnL,MmMJM>Ma}MSMAMM M MM NNN#N3 INDNN NX Nb`NiINuNuNN0N(N6N3N#NTNrO OQO+ OG OGOYOoObOOJOOO&OOOGP 7P P wP P kP+P+P@ #P[ PzPPP#PrPZQ (Q Q QQQ0QIQb Q{ Q{ Q{ Q{ Q{ QQQzQ\Q Q 1R R!YR7 LRM RdeRR_RgRRR}RHRRRS S S ES yS 7S mS S{SS*`S>{SRS_pSp =S}zS5SFSS#SSSSSSSDSS}SSS_T T T T7 TTTe Tk TuTT (T T TTTTTT VTTdTT\TTTTTTT1TTTT TTTTTTfT "T TTTTGTT T #TTT WT TTTTT)TT_UBUUSU GU TU U$=U1 /U;>UHYUHUH8UHU[ UebUeUeUe)UzUmUKU@UUUUV V FV V VV(;V:VSVpV~VVVVVVVVJW WW uW./W3WGW^WyWLWWWWkWnWWXqXXXMXX'X9XO5Xb&XyXy8Xy X XX[XXXXIXXX X+XXYYY1YIYe YeYe Yq}YCYY YYY Y YYY Z ZZ) Z)ZCZC Z[Z[ ZsZs Z ZZZ Z ZZ ZZ [ [[[[[e[,[CP[iM[J[[ [ [ [ [ [ \ }\\,c\:\K\` \` \`=\fW\\s\\\ V\\\t\\#\\ \ Y\ b\ A] ],]Y;]O]/]]^^&^H5^lI^>^A^)^___ \_:_Y_g_g_#____k_ _ _^_4_ 4__ 1__ ` :` `5v`I`N{`]-`e6`s``` ` ` ` `K`aaa ha Ja!a! a.a@ aQaQaQ aa ayayaHaa9aaab b4ibI ObXbibvbb)blbbbc&c- d> jd>dHdVdh [dvdvddddd dd ee= ebnebeueke,e!ee e e ee fff1ffCxfO sfV Zfa jfj ^fwff,ffUf fffg ggAg1g.%gBgY gtg~gg~gg g g gg g zgg}ggguh {h h h %hh(h8hAhJ,hJhJhQh]hiht#h2hhkh hh 4hhhh %hh hiii%i< wi<iMihiwiwiw PibiiEii^iij jj j7 j7j7 jGj[ jo jj0j?jKjhjj^jjqj j j vjjj j gj UjjjrjZjijJj jkk/khkkekk!hk!k+Gk9:kAkPk\km=k{kkkkvk\k k kllDll}ll l$5l7lOlV6lewltgltlljlmllplll7lll4l1lmm.m+mm`m. }m.nm6 nmBLmZcmnTmm m mTmpmmm;m\mmmXmwmnntnn%n@nMnM newnkn~ annnnnJnnvnn n nooFu>3uG#uUu`}ujutu~uu(u+u}uquuv v.vCvf8vLv,vvvwwhwtw[w$w$bw$w$w$w5wL wL :wL HwL |wL pwL w\ wpwpwwwGwww ww}wwww wDwkw ww wwwwGwJwwxxPx}x' x1 x;xExOxYx^xexjxy'x\xwxox x ex Dx xxxdy Ry y "y yGy,Dy;AyH>yUYyU!yU yU /yb yb yt y y qyyy8y7yyz ^z }zzzz(z1z?zHzPzYzhzwzzz zzzzzz{{{{ d{{ x{ {"{,{:{K{SD{i.{r{{o{?{S{{{{1{{ u{ {{| k| |%|?|]|r|Q|||,||8||)}&}}+}Jk}h }h }h "}sl}}q}@}}2}5}n}/~L~4~B~Q~_~n~|~O~ ~~&~~~ a~ ^#6JR\ RRM MBWRR((BABA FFuG rrFFFFu>#u>t t6tFFFFu>#u>NiĜ"Ĝe G:G'PP"M"NbINb"#"f1#f1b4#b4b#bK#KP#Pg0  guggugIP d|I@I@T T h]|CCd2#d2~~hJhJdvdv.4|,.nnWFW---nnWFW--D2gg--g~CC,0 k{,,ff.042 gtuUuU22CCk\\kkPkP,,ffggWFW.t.ty|TT??8]8].2.2.`.`.H.H|TTyyk9k9kmkm22--BWBBRBBB0404Q|SSw$w$[[Fe  hhh)h)P \P Q|SSw$w$[[85e#5e#1||UeUeDzDzkk1Q1Q#|UHUHmm##1@1@nhnXhXV|''d2#d2  hhh)h)P zP ebkeb{04{K{KYY{r{r kA kAJZ CCCCJMJMCCCCllW l7 1 2@ hQ|CCd2#d2~~hJhJ2211l$l$> >V(0  }4S;4SV ;V r6r~ x |CbCbCxCxR!R!RRCCRdRd""}J}J}L}}}@}}ww [CCwPw$6$Stwtwo6oh(  |hhttsstti%i%nnii]]ttbXbX6644tt}}! |prprihihxx!!dd|ayayd>d>$+Y$+n@|pdpd__ tguggugnnQ|SSw$w$[[eu  hhh)h)P P Q|SSw$w$[[-5e#5e#1f|UeUeDzDzkk1Q1Q#|UHUHmm#5#1@&1@nhnXhXL|A''d2#d2  hhh)h)PP P ebeb;|nnnene;|u`u`ujujututu~u~|;z;:q:X |XXD6D3CCpY6pYhhhjhj!h!/pY6pY//w /wO O_:ĜV0 $DXX4S4SV V {4S4SV V rra.|,?,?,,,","++[a!a!|4:64:4S;4SV ;V U0 4D |4: 4:UUx |11JJRMRM}}||||}L}}}}}||H,H,/ ///p,p,pCpC[[[i[i[C[C{{EEDD_ _ //// ECCww+Nq+N|GGlele%G043%1z%1e|FOFOii,o,oo]o]B|rrzztt:[|rrzzz(z(z1z1z?z?L|TT+Y+Y:N:NBrBrd|I@I@T T hi|CCd2#d2~~hJhJdvdv.< <|/i/i/D/D.. 4t 4xmP+hP+  |m m9V9V v V|xyxyAA <j jCC`e$`e'T' j jCCI@TI@ j jCCI@TI@  ""jjp|TTRR:H:HMMS_4an\(S>l(S{SnvnSRpSR*4\|TT**@@2v%X%'J |TT'>'>2f2fI'#'`|%%yydV|hh``+j jdHdHn**11 8|TTHH  aaIIc|''c#cIc|c|j j**YHdHd &|TTHH  aaII`s|yUyU66G|```]`]6|FFlVlV))t t sYssĜ<YsEs04 x04 04i|::*?*?F|99* * |99))"&04snt t "y""pt t sYs3X3,Y3,F6|99**t]4X9t t XOX%t t $T$|E{E{ss%%X'X'tGtG|r|rssF!F!3>3>"W"WsQ~sQpFhgFhi^iaIa`'`C  4JJtwtw33zyzp4g0 cIt t !!g g|t2t2FF,,cici00000000aac-c-FOFOiiaa`0`):|||xx( (jTTĜ! T_Tjujut t jZj(N(K  K KhKKR KRKghKg__juj**$4c|$$$$ !b|xO|ppKKCC ww!!xE|ppKKCC wwx;|ppKKCC wwj jj j|TT<<qqNqNq?"q?SSSSSh |TTpp,,yyrrrr<1<1SS,,::ppppqq880J J  {w wk+0 EF0 B?z0 N7?\Q?\?kQ?kE*LE*E8LE8kGkk!Gk!G0 >GkGkhk7V70 jOo |llwwwpwpuuu,u,5555554\4\4q4q|##77II[[nn|OGOGEhEOhO | 0 OY|llwwwpwp|II[[nn|GOGOG  7|T7T7TTkkkk\|TT7!7!777;7;7.7.7\7\7R7R7H7H7777777f 7fA AB/B/8-k8-8 k8 7p7:.:.:;:;::8888{A{C* ?| ?q%h%{ k{{ {h  gh C gCXXEfEf0 Kd"|mm\`\`""##""''  d d   y hy yhyhXhX1-h1-0~Z0~>>Z |ZZZ[Z[ZsZsZ)Z)ZCZCZZZZZZZZYYYYY Y{ k{{ {h  gh C gC6h6hEfEfd|\`\`""d d   nMhnM|TT= == =>k >kB oB99h|TTx x __h %h#` .`Y|oopp& Z&o F&oiwiw |TT++F JFz 8 KKo Si<hi<g\  \ [ *[u[[ [jo|* *g zgNX|__j7 j7eM M|e e w w-Ĝ - -x1|TT}h }h (8(/Y/Y= =w whĜ __Y Yh h&CCL|TT}h }h (8(C..K K w w; q;z =z< 7<88R RCC  |TT}h }h (8(/Y/Y= =QQ_ _P P3 3 4 !W|N3N3R7R7bIbI j j! F!dh|~~~~j jd> [d>c4 =j jc mc1 4 0 |0!L|ybyb~Q{ Q{! !`4 a0 |0` `G0 |000 |0 Q{ |Q{!A|ybyb*q*q ?Q{ Q{! !`4  j j` ` xj jQ{ |Q{ 0 a@|4&4&yyn4 x'|C#Cn n w wa! a!-4  %Q{ Q{- -P[4  dj jP@ P@55!6|yUyU55! ,!55\|xxUUaaccx55\\\ A\55\|xxaaccm6|yyCC55m. nm.\ b\-0 `T_TjujK  K KR KR- -4h4Ye#Ye_55!+|yUyUytyt)$)$))xx((O+O+AAjjAAGG~~AAaaaaz55! !5|>ooxYhxYMMzh,zh4. VS|4&4&@@V:V:iwiw|SSwwww\0  't|''&&&&&&'"'"&&&&''?B|hh99?4?4'Z'Z\\hf f?%|hh99? /? h|SSwwww'e|''&&&&&&'"'"&&&&''?|hh99u|6G6Gxxuqu? h? 'ZM'Z\\Ahhf fQ&o F&oiwiw |TT++FFz 8 KKQi<hi<X d2#d2nnXX[ [ nknkGQ Q &h&Lz|TT||xx( (__O O3 38..LoLoR |TTU[U[||xx( (/4/4=^=^=t=tQQ__O O3 3 hAol|AZ2AZU$ /U$7oQ /oQp|WW~~BB304-u\S*|\,@\,-hZ-hC= C=+|xxNNy+l+S`Sh3vU3vpIp 0 QI|;i;izzh>6h66h66h67h7BhBBhBBhBBhB+ h+ +>h+>+-h+-+h+*h*|rFrFr$:r$U0 UUJlkJl>|zHzHz|v.v.^^uu:|TTzzzPzP>>>>>>vviMiM>>zziizzrrxexeSSSSSrWrrr vr W |TTpp,,yyrrrr<1<1SS,,::ppppqq88JJGGlww_k$h$hthhthhhh#h#7h7IhI[h[nhnlhlwhwuhuu,hu,5h55h55h54\h4\4qh4qEhEOhO | / hhhIhI[h[nhnlhlwhw  7?\Q?\?kQ?kE*LE*E8LE8kGkk!Gk!'GkGkhk77Okhhhh h hh7GkGkhkK|TT7!k7!7k77;k7;7.k7.7\k7\7Rk7R7Hk7H7f7f7k77k77k7AhAB&B8-k8-8 k8 7m7m:.:.:;:;::8l8l88{{Y%h%{ k{{ {h  gh C gCXXEfEf{h{(h(4h4AHhAH'h'YhYShSXhXmBhmBy hy yhyhXhXh)h)xhxlthltlhllhllhl@h@`5h`5,h,,h,-5h-5-Lh-L_gh_g@h@hNuhNu05h05>4>>P4O>zO>z>9>92~u~?Tu?T24Y0 Y4YI|5h5XX22(0 #0 (/#q#q##''( 4n0 Emm((HHGGLLLLEEY1Y1#q#q##mm\\#M#M#(#(""N0 HN0 o0N(NN#NNN0Qo-o{|UURRrrmkm\fk\f#1k#1# k# "k"k!uQu}sh}s{?{05905W 0 {YqkYqW uW WuWh8uh8hAuhAN#4(4(_4 h)h)@h@xhx6yh6yWhWchc6h6WhW}h}[,h[,,h,,h,-5h-5-Lh-L@h@lthltlhllhllhlhNuhNu_gh_gvzvjhj` f` (B(B((NN{h{>4>l0 G0 "0  u mm\\#M#M#(#(""GGy hy yhyrhrmmmmllllll1-h1->>U0 @0 0U@U4Emn4 _hmTmmZTmZN?  mm\\#M#M#(#(""GGy hy yhyhXhXrhr?i?#mmmmllllll1-h1-0~Z0~>>ZhZZ[hZ[ZshZsZ)hZ)ZChZCZhZZhZZhZZhZYhYYhY{ k{{ {h  gh C gC6h6hEfEf{h{#U0 x\\#M#MrhrG GnMhnM{h{|?Ĝ|]Ĝ|||%|%|TT====>$m>$AA9w9w3 3+Ĝ !h!+wh+w!h!+eh+e!h!+h+!+!+++KĜ/cOhONhNKJK6463u u 5Z5& 4(4`6-|fCfC'o'V0 Vp~Vp6Ok6O6u6%i%|TTffffh4x{__YxYhhK44\K4TT\:\:KK L_L_#{h{ 1|AAAATTffLL"HX#HX[h[nhnchc<h<DhD|:m:m&&\\u u% %X XL LH Hg.42 =h=g%g_4J!h!)h) I'I'^lN^lvNv]N]J:JfhfL)+L)ww_4_DWhDWphphU0 ohooho`Nh`NghgEhE'+h'+&h&'h'xjhxjUzmUzwhwDhDR}RHHzYgzY+ ~Bh~B~_h~_~|h~|h h =h=)Uh)U)ph)p)h)hH#HH#HH#HfwhfwJ!0 M>J:uJ:J J MNhN:h::h:;!h;!;-h;-J0 I0 0qIIIyIyJJ;|0+0+Aw5hw5~4h~4~Qh~Q~nh~nhh/h/)Hh)H)ch)c)~h)~I#II#IIeIe;;H?hH?U;hU;MM;C;C   MM8J4@ 8:M8:UHhUHmhmhUehUeDzhDzkhk1Qh1QnhnXhX\EXEX??x|ll\t\yw}wC5e#5e# UHhUHmhmhUehUeDzhDzkhk1Qh1QnhnXhX''w$hw$[h[ffS{:ĤVkV{,{, |TT::;Y;Yzwrzw<7C<799M..JxJ==J6=J |TT^^vv]]]]vv] ] ^& ^&vC vC], ],=(h=(<<$$==H6H^^vv]]88^H%^Hvf%vf]Y%]Y^^^ ^33OOr||?x?UU!!|yUyUxx*U*Ur`Mr`j j!V!j j  T0 14xtkk> x  >4 4j j\\P+P+  ' ' !|@@ h!!)|FFlOlO K)) 1t6tn%n%:p6pp6pF#F|VV:|:|TT(( TTLtLn nL1L# |TT66GGs3Js3W^ W^b &bP Pc cb CbLwLB)B<<SSy.y<<JJ%b%b{S{S66OOD!!D!44MzM88 |TTEEii/!/!4400LeL$4$4$$;;S}YS}MaMa88|TTGDGDGaGarnrsesWG WGWy Wy# \#a ;aa 2aP PP Pb bb bbv dbvb RbffEEEE$h$h%%OOCd>$+Y$+@@!#*0123456789ABCD#*,0123456789ATMParametersAlternativeCapabilitySetAudioCapability AudioModeAudioTelephonyEventCapabilityAudioToneCapabilityAuthenticationCapabilityBEnhancementParameters CRCLengthCapabilitiesConf CapabilityCapabilityDescriptorCapabilityDescriptorNumberCapabilityIdentifierCapabilityTableEntryCapabilityTableEntryNumberCertSelectionCriteria ChannelEntryCloseLogicalChannelCloseLogicalChannelAckCommandMessageCommunicationModeCommandCommunicationModeRequestCommunicationModeResponseCommunicationModeTableEntryCompressionTypeConferenceCapabilityConferenceCommand ConferenceIDConferenceIndicationConferenceRequestConferenceResponseConnectionIdentifier CriteriaCustomPictureClockFrequencyCustomPictureFormatDataApplicationCapability DataModeDataProtocolCapability DataTypeDialingInformationDialingInformationNetworkTypeDialingInformationNumber%EncryptionAuthenticationAndIntegrityEncryptionCapabilityEncryptionCommandEncryptionModeEncryptionSyncEncryptionUpdateDirectionEncryptionUpdateRequestEndSessionCommandEnhancementLayerInfoEnhancementOptions EscrowDataExtendedVideoCapabilityFECCapabilityFECDataFECModeFlowControlCommandFlowControlIndicationFunctionNotSupportedFunctionNotUnderstoodG7231AnnexCCapabilityG7231AnnexCModeG729ExtensionsGSMAudioCapabilityGenericCapabilityGenericMessageGenericParameterH222CapabilityH222LogicalChannelParametersH223AL1MParametersH223AL2MParametersH223AL3MParametersH223AnnexCArqParametersH223AnnexCCapabilityH223CapabilityH223LogicalChannelParametersH223ModeParametersH223MultiplexReconfigurationH223SkewIndicationH2250Capability!H2250LogicalChannelAckParametersH2250LogicalChannelParametersH2250MaximumSkewIndicationH2250ModeParameters H235Media H235ModeH235SecurityCapabilityH245ConfigurationH261VideoCapabilityH261VideoModeH262VideoCapabilityH262VideoModeH263ModeComboFlags H263OptionsH263Version3OptionsH263VideoCapabilityH263VideoModeH263VideoModeCombosIS11172AudioCapabilityIS11172AudioModeIS11172VideoCapabilityIS11172VideoModeIS13818AudioCapabilityIS13818AudioModeIV16IV8IndicationMessageIntegrityCapabilityJitterIndicationKeyProtectionMethodLogicalChannelNumberLogicalChannelRateAcknowledgeLogicalChannelRateRejectLogicalChannelRateRejectReasonLogicalChannelRateReleaseLogicalChannelRateRequestMCLocationIndicationMaintenanceLoopAckMaintenanceLoopOffCommandMaintenanceLoopRejectMaintenanceLoopRequestMasterSlaveConfMasterSlaveDeterminationMasterSlaveDeterminationAckMasterSlaveDeterminationReject MasterSlaveDeterminationReleaseMaximumBitRate McuNumberMediaChannelCapabilityMediaDistributionCapabilityMediaEncryptionAlgorithmMediaPacketizationCapabilityMediaTransportTypeMiscellaneousCommandMiscellaneousIndication&MobileMultilinkReconfigurationCommand)MobileMultilinkReconfigurationIndicationModeDescription ModeElementModeElementType ModeEntryMulticastAddressMultilinkIndicationMultilinkRequestMultilinkResponseMultimediaSystemControlMessageMultiplePayloadStream MultiplePayloadStreamCapabilityMultiplePayloadStreamElement!MultiplePayloadStreamElementModeMultiplePayloadStreamModeMultiplexCapabilityMultiplexElementMultiplexEntryDescriptor$MultiplexEntryRejectionDescriptionsMultiplexEntrySendMultiplexEntrySendAckMultiplexEntrySendRejectMultiplexEntrySendReleaseMultiplexEntryTableConfMultiplexFormatMultiplexTableEntryNumberMultiplexedStreamCapability MultiplexedStreamModeParametersMultiplexedStreamParameterMultipointCapabilityNetworkAccessParametersNewATMVCCommandNewATMVCIndication"NoPTAudioTelephonyEventCapabilityNoPTAudioToneCapabilityNonStandardIdentifierNonStandardMessageNonStandardParameterOpenLogicalChannelOpenLogicalChannelAckOpenLogicalChannelConfirmOpenLogicalChannelRejectParameterIdentifierParameterValueParams PasswordPictureReference Q2931AddressQOSCapabilityQOSModeRSVPParametersRTPH263VideoRedundancyEncoding#RTPH263VideoRedundancyFrameMappingRTPPayloadTypeRedundancyEncodingRedundancyEncodingCapabilityRedundancyEncodingDTMode RedundancyEncodingDTModeElementRedundancyEncodingElementRedundancyEncodingMethodRedundancyEncodingModeRefPictureSelectionRemoteMCRequestRemoteMCResponseRequestAllTerminalIDsResponseRequestChannelCloseRequestChannelCloseAckRequestChannelCloseRejectRequestChannelCloseReleaseRequestMessage RequestModeRequestModeAckRequestModeRejectRequestModeReleaseRequestMultiplexEntryRequestMultiplexEntryAckRequestMultiplexEntryReject+RequestMultiplexEntryRejectionDescriptionsRequestMultiplexEntryReleaseResponseMessageRoundTripDelayRequestRoundTripDelayResponseSendTerminalCapabilitySetSequenceNumberSubstituteConferenceIDCommandT38FaxProfileT38FaxRateManagementT38FaxTcpOptionsT38FaxUdpOptions T84ProfileTerminalCapabilitySetTerminalCapabilitySetAckTerminalCapabilitySetRejectTerminalCapabilitySetRelease TerminalIDTerminalInformationTerminalLabelTerminalNumber'TerminalYouAreSeeingInSubPictureNumberTransparencyParametersTransportAddressTransportCapabilityUnicastAddressUserInputCapabilityUserInputIndicationV42bisV75CapabilityV75ParametersV76CapabilityV76HDLCParametersV76LogicalChannelParametersV76ModeParametersVBDCapabilityVBDMode VCCapabilityVendorIdentificationVideoCapabilityVideoIndicateCompose VideoModeaalaal1aal1ViaGatewayaal1ViaGateway_53 aal1_1080 aal1_1157aal1_32aal5 aal5_1092 aal5_1169aal5_42 aal_1079 aal_1156accept acceptedackAndNackMessageackMessageOnlyackOrNackMessageOnlyadaptationLayerTypeadaptationLayerType_558adaptationLayerType_769adaptiveClockRecoveryaddConnectionaddConnection_959addConnection_967additionalDecoderBufferadditionalDecoderBuffer_1147additionalPictureMemoryadditionalPictureMemory_276address address_545advancedIntraCodingModeadvancedPrediction al1Framedal1M al1NotFramedal2Mal2WithSequenceNumbersal2WithoutSequenceNumbersal3al3Mal3_563al3_774 algorithm algorithmOIDalgorithmOID_1211alpduInterleaving alphanumericalphanumeric_1205alsduSplittingalternateInterVLCModeannexAannexBannexDannexEannexFannexGannexHantiSpamAlgorithmanyPixelAspectRatio applicationapplication_425application_888arithmeticCodingarqType arqType_583 arqType_605associateConferenceassociatedAlgorithmassociatedSessionIDatm-AAL5-BIDIRatm-AAL5-UNIDIRatm-AAL5-compressedatm-AAL5-compressed_151atmABRatmCBRatmParametersatmUBR atmnrtVBR atmrtVBR audioData audioHeaderaudioHeaderPresent audioLayer audioLayer1 audioLayer2 audioLayer3audioLayer_841audioLayer_854 audioModeaudioSamplingaudioSampling16kaudioSampling22k05audioSampling24kaudioSampling32kaudioSampling44k1audioSampling48kaudioSampling_845audioSampling_858audioTelephoneEventaudioTelephonyEvent audioTone audioUnitaudioUnitSize audioWithAL1audioWithAL1M audioWithAL2audioWithAL2M audioWithAL3audioWithAL3MauthenticationCapabilityavailableBitRatesavailableBitRates_47bPictureEnhancementbPictureEnhancement_226backwardMaximumSDUSizebaseBitRateConstrainedbasic basicStringbigCpfAdditionalPictureMemorybitRatebitRateLockedToNetworkClock!bitRateLockedToNetworkClock_1179bitRateLockedToPCRClock bitRate_811 bitRate_853 bitRate_878 booleanArray bppMaxKbbroadcastMyLogicalChannel"broadcastMyLogicalChannelResponse&broadcastMyLogicalChannelResponse_940 bucketSizecallAssociationNumbercallInformationcallInformation_957callInformation_965canNotPerformLoop cancelBroadcastMyLogicalChannelcancelMakeMeChaircancelMakeTerminalBroadcastercancelMultipointConferencecancelMultipointModeCommand cancelMultipointSecondaryStatuscancelMultipointZeroCommcancelSeenByAllcancelSeenByAtLeastOneOthercancelSendThisSource capabilitiescapabilities_522 capabilitycapabilityDescriptorNumbercapabilityDescriptorNumbers capabilityDescriptorNumbers_993capabilityDescriptorscapabilityDescriptors_18capabilityIdentifiercapabilityOnMuxStreamcapabilityTablecapabilityTableEntryNumbercapabilityTableEntryNumbers capabilityTableEntryNumbers_992capabilityTable_17cause cause_1112 cause_14 cause_20 cause_694 cause_726 cause_738 cause_746 cause_753 cause_901 ccir601Prog ccir601SeqcentralizedAudiocentralizedConferenceMCcentralizedControlcentralizedDatacentralizedVideocertProtectedKeycertSelectionCriteriacertificateResponsecertificateResponse_939chairControlCapabilitychairTokenOwnerResponsechairTokenOwnerResponse_937 channelTag channelschannelsTimeoutchannels_1221cifcif16cif16AdditionalPictureMemory cif16MPI cif16MPI_232cif4cif4AdditionalPictureMemorycif4MPIcifAdditionalPictureMemorycifMPI cifMPI_181classReferenceclockConversionCodeclockConversionCode_310 clockDivisorclockRecoveryclockRecovery_1081clockRecovery_1158closeLogicalChannelcloseLogicalChannelAck collapsing comfortNoisecommandcommunicationModeCommandcommunicationModeRequestcommunicationModeResponsecommunicationModeTablecommunicationModeTable_904compositionNumberconferenceCapabilityconferenceCommand conferenceIDconferenceIDResponseconferenceIDResponse_928conferenceIdentifierconferenceIdentifier_1018conferenceIndicationconferenceRequestconferenceResponseconnectionIdentifierconnectionsNotAvailableconstrainedBitstreamconstrainingFieldcontainedThreadscontainedThreads_162containerOfObjectSetscontainerOfObjectscontainerOfTypescontainerOfValuescontrolFieldOctetscontrolFieldOctets_775controlOnMuxStreamcontrolledLoad crc12bit crc16bitcrc16bitCapability crc20bit crc28bit crc32bitcrc32bitCapabilitycrc4bitcrc8bitcrc8bitCapability crcDesiredcrcDesired_976 crcLengthcrcLength_573crcLength_595 crcNotUsedcurrentIntervalcurrentIntervalInformationcurrentMaximumBitRatecurrentPictureHeaderRepetitioncustom customMPIcustomMPI_312 customPCFcustomPCF_308customPCF_308_309customPictureClockFrequency customPictureClockFrequency_267customPictureFormatcustomPictureFormat_268 custom_161data dataModedataPartitionedSlices dataType"dataTypeALCombinationNotSupporteddataTypeNotAvailabledataTypeNotSupported dataType_909 dataWithAL1 dataWithAL1M dataWithAL2 dataWithAL2M dataWithAL3 dataWithAL3M deActivatedeblockingFilterModedecentralizedConferenceMC decision decision_11 deniedBroadcastMyLogicalChanneldeniedChairTokendeniedMakeTerminalBroadcasterdeniedSendThisSourcedescriptorCapacityExceededdescriptorTooComplex destinationdialingInformationdifferentPortdifferentPort_653differentPort_765 differentialdifferential_978digPhotoHighProgdigPhotoHighSeq digPhotoLowdigPhotoMedProgdigPhotoMedSeq direction disconnectdistributedAudiodistributedControldistributedDatadistributedData_177distributedVideo distributiondistribution_534$doContinuousIndependentProgressionsdoContinuousProgressionsdoOneIndependentProgressiondoOneProgression domainBaseddomainBased_507dropConference dropTerminaldsm-cc dsvdControldtmf durationduration_1202dynamicPictureResizingByFour#dynamicPictureResizingSixteenthPeldynamicRTPPayloadTypedynamicRTPPayloadType_711dynamicWarpingHalfPeldynamicWarpingSixteenthPel e164Addresse164Address_538eRMeRM_619 elementListelementList_729 elements elements_647 elements_760 encryptedencryptedAlphanumericencryptedAlphanumeric_1207encryptedAlphanumeric_1210encryptedBasicStringencryptedGeneralStringencryptedIA5StringencryptedSignalTypeencryptedSignalType_1200encrypted_1212encryptionAlgorithmIDencryptionAlgorithmID_997%encryptionAuthenticationAndIntegrityencryptionCapabilityencryptionCommandencryptionDataencryptionIVRequestencryptionMode encryptionSEencryptionSyncencryptionUpdateencryptionUpdateAckencryptionUpdateAck_1059encryptionUpdateCommandencryptionUpdateCommand_1058encryptionUpdateRequestendSessionCommand enhancedenhancedReferencePicSelectenhancedReferencePicSelect_290 enhanced_79enhancementLayerInfoenhancementOptionsenterExtensionAddressenterH243ConferenceIDenterH243PasswordenterH243TerminalID entryNumbersentryNumbers_748equaliseDelayerrorCompensationerrorCorrectionerrorCorrectionOnlyerrorCorrection_1085errorCorrection_1162 escrowID escrowValueescrowValue_689 escrowentryescrowentry_687 estimatedReceivedJitterExponent%estimatedReceivedJitterExponent_1145 estimatedReceivedJitterMantissa%estimatedReceivedJitterMantissa_1144excessiveErrorexcessiveError_977expirationTimeexpirationTime_1198extendedAlphanumericextendedAlphanumeric_1204 extendedPARextendedPAR_317extendedPAR_317_318extendedVideoCapabilityextensionAddressextensionAddressResponseextensionAddressResponse_936externalReferenceexternalReference_540fecfecCapabilityfecModefieldfieldOfClassReferencefieldOfEnumeratedfieldOfObjectReferencefieldReferencefillBitRemovalfinite finite_610 firstGOBfirstGOB_1029firstMBfiveChannels3-0-2-0fiveChannels3-2fixedPointIDCT0floorRequestedflowControlCommandflowControlIndicationflowControlToZero forwardLogicalChannelDependencyforwardLogicalChannelNumber forwardLogicalChannelParameters$forwardLogicalChannelParameters_528forwardMaximumSDUSizeforwardMultiplexAckParameters"forwardMultiplexAckParameters_693fourChannels2-0-2-0fourChannels2-2fourChannels3-1frameSequenceframeSequence_165frameToThreadMappingframeToThreadMapping_159framedframesBetweenSyncPointsframesPerSecondfullPictureFreezefullPictureSnapshotfunctionNotSupportedfunctionNotUnderstoodg3FacsMH200x100g3FacsMH200x200g4FacsMMR200x100g4FacsMMR200x200 g711Alaw56k g711Alaw64k g711Ulaw56k g711Ulaw64k g722-48k g722-56k g722-64kg7231g7231AnnexCCapabilityg7231AnnexCMode g7231_367 g7231_834g723AnnexCAudioModeg723AnnexCAudioMode_385g723AnnexCAudioMode_881g728g729 g729AnnexAg729AnnexAwAnnexBg729Extensions g729wAnnexBgatewayAddressgatewayAddress_54generalStringgenericAudioCapabilitygenericAudioModegenericCommandgenericControlCapabilitygenericDataCapabilitygenericDataModegenericIndicationgenericModeParametersgenericMultiplexCapabilitygenericParametergenericParameter_515genericRequestgenericResponsegenericVideoCapabilitygenericVideoMode golay24-12!grantedBroadcastMyLogicalChannelgrantedChairTokengrantedMakeTerminalBroadcastergrantedSendThisSourcegsmEnhancedFullRate gsmFullRate gsmHalfRategstn gstnOptionsgstnOptions_1005guaranteedQOSh221NonStandardh221NonStandard_5h222Capabilityh222DataPartitioningh222LogicalChannelParameters h223AnnexAh223AnnexADoubleFlagh223AnnexADoubleFlag_1072 h223AnnexBh223AnnexBwithHeaderh223AnnexCCapabilityh223Capabilityh223LogicalChannelParametersh223ModeChangeh223ModeChange_1067h223ModeParametersh223MultiplexReconfigurationh223MultiplexTableCapability h223MultiplexTableCapability_77h223SkewIndicationh224h2250Capability!h2250LogicalChannelAckParametersh2250LogicalChannelParametersh2250MaximumSkewIndicationh2250ModeParametersh233AlgorithmIdentifierh233Encryption h233EncryptionReceiveCapability#h233EncryptionReceiveCapability_27!h233EncryptionTransmitCapabilityh233IVResponseTime h235Controlh235Key h235Media h235Modeh235SecurityCapabilityh261VideoCapabilityh261VideoModeh261aVideoPacketizationh262VideoCapabilityh262VideoMode h263Optionsh263Version3Optionsh263VideoCapabilityh263VideoCoupledModesh263VideoCoupledModes_321h263VideoModeh263VideoUncoupledModesh310SeparateVCStackh310SingleVCStackhdlcFrameTunnelingwSARhdlcFrameTunnellinghdlcParameters hdtvProghdtvSeq headerFECheaderFEC_570headerFEC_588 headerFormatheaderFormat_592heighthighRateMode0highRateMode1highRateMode1_883higherBitRatehighestEntryNumberProcessed hookflashhrd-B hrd-B_215 iA5String iP6AddressiP6Address_665iP6Address_681 iPAddressiPAddress_658iPAddress_678iPSourceRouteAddressiPSourceRouteAddress_669 iPXAddressiPXAddress_661identicalNumbersimports importsArrayimprovedPBFramesModeindependentSegmentDecoding indication infiniteinfoNotAvailableinsufficientBandwidthinsufficientResourcesintegrityCapabilityinterlacedFieldsinternationalNumberinternationalNumber_546invalidDependentChannelinvalidSessionIDip-TCPip-UDPis11172AudioCapabilityis11172AudioModeis11172VideoCapabilityis11172VideoModeis13818AudioCapabilityis13818AudioModeisDynamicPayloadTypeisDynamicPayloadType_1238 isdnOptionsisdnOptions_1011 issueQueryiviv16iv8jbig200x200Progjbig200x200Seqjbig300x300Progjbig300x300SeqjitterIndicationkeyProtectionMethodlcselinesPerFramelinesPerFrame_821localAreaAddress localTCFlogicallogicalChannelActivelogicalChannelInactivelogicalChannelLooplogicalChannelNumberlogicalChannelNumber1logicalChannelNumber2logicalChannelRateAcknowledgelogicalChannelRateRejectlogicalChannelRateReleaselogicalChannelRateRequest"logicalChannelSwitchingCapabilitylongInterleaverlongTermPictureIndexloopBackTestCapabilityloopbackTestProcedurelooselostPartialPicturelostPartialPicture_1054 lostPicturelowFrequencyEnhancement lowRateMode0 lowRateMode1lowRateMode1_885 lowerBitRateluminanceSampleRatemCTerminalIDResponsemPImPI_306mREJCapabilitymSREJmaintenanceLoopAckmaintenanceLoopOffCommandmaintenanceLoopRejectmaintenanceLoopRequest makeMeChairmakeMeChairResponsemakeMeChairResponse_933makeTerminalBroadcaster makeTerminalBroadcasterResponse$makeTerminalBroadcasterResponse_943manualOperationmanualResponemanualResponsemanufacturerCodemastermasterActivate masterSlavemasterSlaveConflictmasterSlaveDeterminationmasterSlaveDeterminationAckmasterSlaveDeterminationReject masterSlaveDeterminationReleasemasterToSlavemaxAl-sduAudioFramesmaxAl-sduAudioFrames_879 maxBitRatemaxBitRate_233maxCustomPictureHeightmaxCustomPictureWidthmaxH223MUXPDUsizemaxMUXPDUSizeCapability maxNTUSize!maxNumberOfAdditionalConnectionsmaxPendingReplacementFor maxPktSizemaxWindowSizeCapabilitymaximumAL1MPDUSizemaximumAL2MSDUSizemaximumAL3MSDUSizemaximumAl2SDUSizemaximumAl3SDUSizemaximumAudioDelayJittermaximumBitRatemaximumBitRate_1217maximumDelayJittermaximumElementListSizemaximumHeaderIntervalmaximumHeaderInterval_961maximumHeaderInterval_974maximumNestingDepthmaximumNestingDepth_80maximumPayloadLengthmaximumPayloadLength_94maximumSampleSize maximumSkewmaximumSkew_1149maximumStringLengthmaximumSubElementListSizemaximumSubElementListSize_82 mcCapabilitymcCapability_125mcLocationIndication mcuNumbermediaCapability mediaChannelmediaChannelCapabilitiesmediaChannelCapabilities_154mediaControlChannelmediaControlGuaranteedDeliverymediaDistributionCapability mediaDistributionCapability_169mediaGuaranteedDelivery mediaLoopmediaLoopTimeout mediaModemediaMode_757mediaPacketizationmediaPacketizationCapabilitymediaPacketization_638mediaTransport mediaTypemediaType_551messageContentmessageIdentifierminCustomPictureHeightminCustomPictureWidth minPolicedmiscellaneousCommandmiscellaneousIndicationmobilemobileMultilinkFrameCapability"mobileMultilinkFrameCapability_92&mobileMultilinkReconfigurationCommand)mobileMultilinkReconfigurationIndication"mobileOperationTransmitCapability%mobileOperationTransmitCapability_85modemodeChangeCapability modeCombosmodeCombos_269modeUnavailable mode_618 mode_650 mode_762modes modes_1222modifiedQuantizationModemodule mpuHorizMBsmpuHorizMBs_292mpuTotalNumber mpuVertMBsmpuVertMBs_293multiUniCastConference multicastmulticastAddressmulticastCapabilitymulticastChannelNotAllowedmultichannelTypemultichannelType_849multichannelType_865 multilingualmultilinkIndicationmultilinkRequestmultilinkResponsemultiplePayloadStream multiplePayloadStreamCapabilitymultiplePayloadStreamMode multiplexmultiplexCapabilitymultiplexEntryDescriptorsmultiplexEntryDescriptors_728multiplexEntrySendmultiplexEntrySendAckmultiplexEntrySendRejectmultiplexEntrySendReleasemultiplexEntrySendTimeoutmultiplexEntryTablemultiplexFormatmultiplexParametersmultiplexParameters_530multiplexParameters_533multiplexParameters_692multiplexTableEntryNumbermultiplex_1095multiplex_1103multiplex_1172multiplex_1180multiplexedStreammultiplexedStreamMode multiplexedStreamModeParametersmultipointConferencemultipointConstraintmultipointModeCommandmultipointSecondaryStatus"multipointVisualizationCapabilitymultipointZeroCommn-isdnn401n401Capability n401_626nackMessageOnlyname name_1239netBiosnetnumnetworknetworkAddressnetworkAddress_537networkAddress_980 networkTypenetworkType_982 network_679newATMVCCommandnewATMVCIndicationnextPictureHeaderRepetitionnlpid nlpidDatanlpidProtocol nlpid_427 nlpid_889noArq noMultiplexnoRestrictionnoSilenceSuppressionHighRatenoSilenceSuppressionLowRatenoSuspendResumenode node_662nonCollapsingnonCollapsingRaw nonStandardnonStandardAddressnonStandardDatanonStandardIdentifiernonStandard_482nonStandard_905nonenoneProcessednormalnsap nsapAddress nsap_684 nsrpSupportnullClockRecovery nullDatanullErrorCorrection numOfDLCSnumOfDLCS_118numberOfBPicturesnumberOfBPictures_227numberOfCodewordsnumberOfCodewords_445 numberOfGOBsnumberOfGOBs_1030 numberOfMBsnumberOfMBs_1056numberOfMBs_1139numberOfRetransmissionsnumberOfRetransmissions_609numberOfThreadsnumberOfThreads_157 numberOfVCsobject objectArrayobjectReferenceobjectSetArrayobjectSetElementobjectSetReference octetString offset-x offset-y offset-y_273oidopenLogicalChannelopenLogicalChannelAckopenLogicalChannelConfirmopenLogicalChannelRejectoriginateCallparamSparameterIdentifierparameterValuepartialPictureFreezeAndReleasepartialPictureSnapshotpartiallyFilledCells passwordpasswordResponsepasswordResponse_929payloadDescriptorpayloadDescriptor_640 payloadType pbFramespcr-pid pcr-pid_555 peakRatepictureNumberpictureNumber_1065 pictureRatepictureReferencepixelAspectCodepixelAspectCode_315pixelAspectCode_315_316pixelAspectInformationpixelAspectInformation_313 portNumberpresentationOrder previousPictureHeaderRepetitionprimaryprimaryEncodingproductNumberprofileAndLevelprofileAndLevel-HPatH-14profileAndLevel-HPatHLprofileAndLevel-HPatMLprofileAndLevel-MPatH-14profileAndLevel-MPatHLprofileAndLevel-MPatLLprofileAndLevel-MPatMLprofileAndLevel-SNRatLLprofileAndLevel-SNRatMLprofileAndLevel-SPatMLprofileAndLevel-SpatialatH-14profileAndLevel_786programDescriptorsprogramStreamprogressiveRefinement%progressiveRefinementAbortContinuousprogressiveRefinementAbortOneprogressiveRefinementStart progressiveRefinementStart_1041protectedPayloadTypeprotectedPayloadType_767protectedSessionIDprotectedTypeprotocolIdentifier q2931AddressqOSCapabilitiesqOSCapabilities_153qcifqcifAdditionalPictureMemoryqcifMPIqosCapabilityqosModerangeOfBitRatesrangeOfBitRates_50 rcpcCodeRatercpcCodeRate_604reason reason_717 reason_721"receiveAndTransmitAudioCapability,receiveAndTransmitDataApplicationCapability.receiveAndTransmitMultiplexedStreamCapability'receiveAndTransmitMultipointCapability&receiveAndTransmitUserInputCapability"receiveAndTransmitVideoCapabilityreceiveAudioCapabilityreceiveCompression!receiveDataApplicationCapability#receiveMultiplexedStreamCapabilityreceiveMultipointCapability(receiveRTPAudioTelephonyEventCapabilityreceiveRTPAudioToneCapabilityreceiveUserInputCapabilityreceiveVideoCapabilityreconfiguration recoveryrecoveryReferencePicturerecoveryReferencePicture_1057 recovery_621reducedResolutionUpdateredundancyEncodingredundancyEncodingCapability!redundancyEncodingCapability_129redundancyEncodingDTModeredundancyEncodingMethodredundancyEncodingModerefPictureSelectionreferencePicSelectrejrejCapabilityreject rejectReason reject_954 rejected rejected_970rejectionDescriptionsrejectionDescriptions_737rejectionDescriptions_745remoteMCRequestremoteMCResponseremoveConnectionreopen repeatCountrepeatCount_1042repeatCount_733replacementForreplacementForRejectedrequestrequestAllTerminalIDsrequestAllTerminalIDsResponserequestChairTokenOwnerrequestChannelCloserequestChannelCloseAckrequestChannelCloseRejectrequestChannelCloseReleaserequestCloseTimeoutrequestDeniedrequestForFloor requestModerequestModeAckrequestModeRejectrequestModeReleaserequestModeTimeoutrequestMultiplexEntryrequestMultiplexEntryAckrequestMultiplexEntryRejectrequestMultiplexEntryReleaserequestTerminalCertificaterequestTerminalCertificate_921requestTerminalID requestTyperequestType_962requestedIntervalrequestedModesrequestedModes_749reservationFailure resizingPartPicFreezeAndRelease resolutionresolution_781resolution_804 resourceID response responseCoderesponseCode_968 response_750 restrictionrestriction_1001restriction_1216returnedFunction reverseLogicalChannelDependencyreverseLogicalChannelNumber reverseLogicalChannelParameters$reverseLogicalChannelParameters_532$reverseLogicalChannelParameters_690reverseParametersreverseParameters_1099reverseParameters_1176 rfc-numberrfc-number_641rfc2733 rfc2733Moderfc2733Mode_761 rfc2733_523 rfc2733_649roundTripDelayRequestroundTripDelayResponseroundTripTimeout roundrobinroute route_675routing routing_670rsCodeCapabilityrsCodeCorrectionrsvpParametersrtcpVideoControlCapabilityrtprtpAudioRedundancyEncodingrtpH263VideoRedundancyEncodingrtpPayloadIndicationrtpPayloadTypertpPayloadType_133rtpRedundancyEncodingrtpRedundancyEncoding_644 rtp_1196 rtp_1203sREJsREJCapabilitysRandom sRandom_922 samePort samePort_656 samePort_768 sampleSizesamplesPerFramesamplesPerFrame_1220samplesPerLine sbeNumbersbeNumber_1117scale-xscale-yscope scope_1141 scope_1213 scope_998 scrambled sebch16-5 sebch16-7 secondarysecondaryEncodingsecondaryEncoding_155secondaryEncoding_780secondary_645secondary_758secureChannel secureDTMF seenByAllseenByAtLeastOneOthersegmentableFlagsegmentationAndReassemblysemanticErrorsendBufferSizesendTerminalCapabilitySetsendThisSourcesendThisSourceResponsesendThisSourceResponse_946separateLANStack separatePortseparateStack!separateStackEstablishmentFailedseparateStreamseparateStream_525separateStream_652separateStream_764separateVideoBackChannelsequenceNumbersessionDependencysessionDescriptionsessionDescription_908 sessionID sharedSecretshortInterleaver sidMode0 sidMode1 sidMode1_887signalsignalAddress signalTypesignalType_1194 signalUpdatesignalUpdate_1201 signal_1193silenceSuppressionsilenceSuppressionHighRatesilenceSuppressionLowRatesimultaneousCapabilitiessingleBitRatesingleChannelskewskippedFrameCountskippedFrameCount_1146slaveslaveActivateslaveToMasterslicesInOrder-NonRectslicesInOrder-RectslicesNoOrder-NonRectslicesNoOrder-Rect slowCif16MPIslowCif16MPI_241 slowCif4MPI slowCifMPI slowQcifMPI slowSqcifMPIsnrEnhancementsource source_714spareReferencePicturesspatialEnhancementspatialEnhancement_225specificRequestspecificRequest_990sqcifsqcifAdditionalPictureMemory sqcifMPIsrtsClockRecovery standard standardMPIstandardMPI_307startstatusstatusDeterminationNumber status_1109stillImageTransmissionstopstreamDescriptorsstrictstructuredDataTransfer subAddresssubAddress_981 subChannelIDsubElementListsubElementList_732subMessageIdentifersubPictureNumbersubPictureRemovalParameters subPictureRemovalParameters_291 subaddresssubstituteConferenceIDCommand supersedessupersedes_504suspendResume suspendResumeCapabilitywAddress!suspendResumeCapabilitywoAddresssuspendResume_613suspendResumewAddresssuspendResumewoAddressswitchReceiveMediaOffswitchReceiveMediaOn synchFlag synchronized syntaxError systemLoopt120t120DynamicPortCapabilityt120SetupProceduret120SetupProcedure_541t140t30faxt35CountryCode t35Extensiont38FaxMaxBuffert38FaxMaxDatagramt38FaxMaxDatagram_475t38FaxProfilet38FaxProtocolt38FaxRateManagementt38FaxTcpOptions t38FaxUdpECt38FaxUdpEC_476t38FaxUdpOptionst38TCPBidirectionalMode t38UDPFECt38UDPRedundancyt38fax t38fax_892t434t84 t84Profile t84Protocolt84Restrictedt84Restricted_448t84Unrestrictedt84_426tableEntryCapacityExceededtableEntryCapacityExceeded_24tcptelephonyModetemporalReference"temporalSpatialTradeOffCapabilityterminalCapabilitySetterminalCapabilitySetAckterminalCapabilitySetRejectterminalCapabilitySetReleaseterminalCertificateResponse terminalCertificateResponse_938terminalDropReject terminalIDterminalIDResponseterminalInformationterminalInformation_949terminalJoinedConferenceterminalLabelterminalLeftConferenceterminalListRequestterminalListResponseterminalListResponse_930terminalNumberterminalNumberAssignterminalOnHold terminalTypeterminalType_1229terminalYouAreSeeing'terminalYouAreSeeingInSubPictureNumber threadNumberthreeChannels2-1threeChannels3-0timeout timeout_1235 timestamp toLevel0 toLevel1 toLevel2toLevel2withOptionalHeader tokenRatetranscodingJBIGtranscodingMMR transferModetransferMode_567transferredTCFtransmitAndReceiveCompressiontransmitAudioCapabilitytransmitCompression"transmitDataApplicationCapability$transmitMultiplexedStreamCapabilitytransmitMultipointCapabilitytransmitUserInputCapabilitytransmitVideoCapabilitytransparencyParameters transparent transporttransportCapabilitytransportStreamtransportWithI-framestsapIdentifiertsapIdentifier_664twoChannelDualtwoChannelStereo twoChannelstwoOctetAddressFieldCapabilitytype typeArraytypeFromConstraint typeIArq typeIIArqtypeReference type_1021 type_1126type_48 type_730 type_759 type_895 type_897 type_899uIHuNERMudpuihCapabilityundefinedReasonundefinedTableEntryUsed unframedunicastunicastAddressunknownunknownDataTypeunknownFunctionunlimitedMotionVectorsunrestrictedVectorunsigned32Maxunsigned32Min unsignedMax unsignedMin unspecifiedunspecifiedCauseunsuitableReverseParametersuntilClosingFlaguser userData userInputuserInputSupportIndication userInputSupportIndication_1186 userRejecteduuidv120v140 v14bufferedv34DSVD v34DuplexFAXv34H324v42bisv42lapmv75Capabilityv75Parametersv76Capabilityv76LogicalChannelParametersv76ModeParametersv76wCompressionv76wCompression_442v8bisvalue valueNode valueTreevaluesvariable-deltavbdvbvBufferSize vcCapabilityvcCapability_31vendorvendorIdentificationversionversionNumberversionNumber_1151videoBackChannelSendvideoBackChannelSend_284 videoBadMBsvideoBadMBsCapvideoBadMBs_1049 videoBitRatevideoBitRate_818videoCapabilityvideoCapabilityExtensionvideoCapabilityExtension_179videoCapability_178videoCommandReject videoDatavideoFastUpdateGOBvideoFastUpdateGOB_1028videoFastUpdateMBvideoFastUpdateMB_1034videoFastUpdatePicturevideoFreezePicturevideoIndicateComposevideoIndicateMixingCapabilityvideoIndicateReadyToActivate videoMode videoMuxvideoNotDecodedMBsvideoNotDecodedMBs_1137videoSegmentTaggingvideoSendSyncEveryGOBvideoSendSyncEveryGOBCancelvideoTemporalSpatialTradeOff"videoTemporalSpatialTradeOff_1136 videoWithAL1videoWithAL1M videoWithAL2videoWithAL2M videoWithAL3videoWithAL3M waitForCallwaitForCommunicationModewholeMultiplexwidthwillTransmitLessPreferredModewillTransmitMostPreferredMode windowSizewindowSize_620withSyntaxElementwithdrawChairToken zeroDelayf6'6'6'\:m\&P+<7w?8]?2.2.`.Hi[0[[t[\\\ 4\ \ \X\\2p\2x\3 \4H\5d\:@ypV 0123456789 ]!]!\oq(s<'s@sH]U ]U(]Q]Q]C]C]> ]>(]u]u]B@]BH]u]u]G]K]Y]Y]F]F]E]E]]t^ ^]`]޸^"(^"0^T^U ]W]W]p]x]݀]݈]ݐ]]4]]]]]ـ]وBAD-SYNTAX:CONT:BAD-SYNTAXM:CONTM:$,8HdHHH@H,HHHHH@HHDHL@PT`dlpx|HHHHHHHHHHHH (H8HL`lHHH,8DP\dpHHHHHH H,8D|HP`pHtHHHHHHHH ,08@HP`hx (,8DP\dltHHHHHHHHHHHHHHHH HH$(HHH8H<HDP\hHHlHpHHHHHHHH HHHHH(HH4HHHHHHHHHDHHHT`HlH|XHHHHHHHHHHHHH$H(8,PhHHHH(HHHHH H@4H@DHL`dhlHHHHpxx|HHHHHHHHHHHHHHHHHsH (04@HDP\hHpHHHHHHHtH|HHHHHHHHHHH$,8@HT\hpxHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHH__L_<_Ј_ _____ɘ___h__t__x__(_H4PB|d hHP\xlt(4xEdkA``0@`0HH323 IP Phone**BUF**! a h450systemmaxCallsd maxServicesh4509 maxServicesh45010dtcwsystemmaxCalls maxChannelsRASresponseTimeOut manualRASmaxFailallowCallsWhenNonRegmanualRegistrationmanualDiscoverydefaultGatekeeper ipAddressip portregistrationInfo terminalTypevendorvendor t35CountryCode t35Extension manufacturerCode productIdTest application versionIdRADVISIONterminalmc undefinedNode terminalAliasrasMulticastAddress ipAddressip)portrasPortcompare15bitRasCrv maxMulticastTTLalternateTransportAddressesannexE1 ipAddressipportQ931responseTimeOutconnectTimeOutcallSignalingPortmaxCalls manualAccept earlyH245manualCallProceeding useAnnexEprotocolPreference raceAnnexEh245 masterSlave2 terminalTypedtimeout capabilitiesterminalCapabilitySetsequenceNumberprotocolIdentifiermultiplexCapabilityh2250Capability<maximumAudioDelayJitterreceiveMultipointCapabilitymulticastCapabilitymultiUniCastConferencemediaDistributionCapability1 centralizedControl distributedControl centralizedAudio distributedAudio centralizedVideo distributedVideotransmitMultipointCapabilitymulticastCapabilitymultiUniCastConferencemediaDistributionCapability1 centralizedControl distributedControl centralizedAudio distributedAudio centralizedVideo distributedVideo&receiveAndTransmitMultipointCapabilitymulticastCapabilitymultiUniCastConferencemediaDistributionCapability1 centralizedControl distributedControl centralizedAudio distributedAudio centralizedVideo distributedVideo mcCapabilitycentralizedConferenceMCdecentralizedConferenceMCrtcpVideoControlCapabilitymediaPacketizationCapabilityh261aVideoPacketizationcapabilityTable1capabilityTableEntryNumber capabilityreceiveAudioCapability< g711Ulaw64k2capabilityTableEntryNumber capabilityreceiveAudioCapability< g711Alaw64k3capabilityTableEntryNumber capabilityreceiveAudioCapability<g7284capabilityTableEntryNumber capabilityreceiveVideoCapabilityh261VideoCapability qcifMPI cifMPI !temporalSpatialTradeOffCapability X maxBitRate stillImageTransmission5capabilityTableEntryNumber capabilityreceiveVideoCapabilityh263VideoCapability sqcifMPI qcifMPI cifMPI  maxBitRate unrestrictedVector arithmeticCoding advancedPrediction pbFrames !temporalSpatialTradeOffCapability errorCompensation6?capabilityTableEntryNumber capabilityreceiveAudioCapabilityg7231 maxAl-sduAudioFrames silenceSuppression7xcapabilityTableEntryNumber capability+receiveAndTransmitDataApplicationCapability application t120 separateLANStack maxBitRate8capabilityTableEntryNumber` capability9 capabilityTableEntryNumber capability1234capabilityDescriptors1capabilityDescriptorNumbersimultaneousCapabilities112?342123x1timeoutchannels1 nameg711Alaw64kdataType audioData< g711Alaw64k2 nameg711Ulaw64kdataType audioData< g711Ulaw64k3nameg728dataType audioData<g7284nameg7231dataType audioDatag7231maxAl-sduAudioFramessilenceSuppression5nameh261VideoCapabilitydataType videoDatah261VideoCapabilityqcifMPIcifMPI!temporalSpatialTradeOffCapabilityX maxBitRatestillImageTransmission6nameh263VideoCapabilitydataType videoDatah263VideoCapabilitysqcifMPIqcifMPIcifMPI maxBitRateunrestrictedVectorarithmeticCodingadvancedPredictionpbFrames!temporalSpatialTradeOffCapabilityerrorCompensation7namet120dataTypedata applicationt120separateLANStack maxBitRate8nameh224dataTypedata applicationh224hdlcFrameTunnelingwSAR maxBitRate(x7!(x7;(x7\(x7R(x7H(x7(x7(x8-(x8 (x7fG(x7fk(x8l(x7!(x8l(x7;(x7\(x7R(x7H(x7(x7(x8 (x8-(x7fG(x7fkR(x7!8l7;7\7R7H778-8 7fG7fk36=`;`;`;8`;T`;p`;axaaa$a`ahap``P`X```8`l`a4aaaa/taaa@aa@aa a a)X`hshfhtb bbbPbbbb0bLbhbbbb,b@b\bdbbb b b<bDb`l001cccbcbbbbb b0b,b<bpb|bbbbc8c8c9cc8c9(c9pc: c;Hccccxcccc4cc c!c!c"c"8c"`c#c$c$c%c&c($c)c,c.Tc*c/c0 c0Hc2c6c6c0hc6c7c7ca`cXxcXcXcXcXcXc\`c\c]c]c!c"c]dc]c^c`\c$c%c&c($c)c`dcaXc*cTDcTlcVcW,c6c6cW c6c7catccccc c< P  voice_countryedcba >]} @@9۠dd F  FT,0d `dߴ<X\d/,lpx/,lpx/,lpx@< G G| $D m }/,lpx L  <D<,<@Dx$d<qLd 8d`dxVd4PdtXd$ldl<V G0dR`dS`dWt(d[$Ld]pxd_dgX G0du$V4 G0dPd<pdì|dpd V G0d$ G0d8d  G0d0ddìT(dV| G0dhd`d}d{ 4d8, pd;dìLXd=ppld@VdD G0d:Td<V G0dpV G0dud<$dv\ G0HV G0dyp8dzt<, $<\|,L\p ,<DLh@Hm$,8H$L$$<,<TI$t,/@/@@@@p@@/@>/@]/@} /@@>@9L9T9`9p9|9;X;p;;;;;<<<0>@gFtXgDgF8DgCD gDD\$gD|ЬAиI,k gDg0\$gѸAgA$gA0g(A@g(APA`Alg A|fdAf\Af AfAf AfAfAf0tfLAߴB flBfXBg B(gB4fB<fPg\gA`gBDUg:xBHg<BXg=Blg>4Btg?Lg;BnB0;gh BgDָBg֜Bg58րBg5dBg6lBg7XCg8DCg90XC g9C(pLCH֌LCh֨C Cg|CgCg8CgCgCgpCgDg<CgCgCg\CgCgtCgDgCg|CgCgTCgCglCg&Dfgg Tg g DWg Ѹָ֜րdЬEg,gglE4g@E<gEDgxELgxgxܼEXg`EhgH܈  g0܄EpgEgEgEgEgEgEgtEg\E gD܀EEEhܔ9FFF FfFF,F8FHFXELf>$ Og@\gg\$AgFdgPFlg?FtgFFlFFFgD ggg4gg|g[gHg Fg$߼Fg߰FgFgg߄4g`@FgFLGG GGG,ߐ; G<GHGXFGlGt#gu g}gpgHgdg`gg\GWgvHGgvGgwGgxdGgxGgyDGgyGgz$gzGg{Gg{F g|<g|G#n<, $<\ | ,L\p  !,H<@DHH(H<gt$H@guHgp`gqgspDQgpHTgn$H` gnHpHgi<gkgm|\$QgjHgj`HgY0HgYHgZT2g[$Hg[H0H$X$Egbgfgh\$QgbHgcPHgdpGge<DgfI(mg`I gad 'Ig_pIg_IFg\LDI,g\xI<g]pIdg^8IPg^I\,8H9gLDgMIpgNTgNpI|gODIgQhDIgR8IgOIgP gT4I gV4IgRIgSIgW|IgXDJgXJgM J J8JHJXJd@f JxJP $J|JJB4pD8$߰߄@߼ܼ܈J NNP: \܈9ܔܸ9:D4:d@`:2l݈:Dݔݸ:d:2 : P9\ތ:|$ޘ:D:d 4:DHt:d߈4: ߼4 :|@0@:2 :2,Hw(Txw(: 9x(: @l:|˨\x9: :|@ :| < <:PL`:|4p: 8\0,4\0$@:|9: <9XTx9`:|4 :| 0Tx@:|@P@:|@\: `9 4: 4:|09`(4 :|<*\@:|\H@:|\8@:|\,9d2,4:|<9d0l4:|`<4:|<:| :||,|:|p:|p: 9X,D:Px::  9 u0,L9 u0\:| 9:9XL: X4:|t :|@9|@9t:$x:| I9d4:| :| :|p : ,X9h999X9d7`: : *\:|`x9d4:| :| :|p : ,X9h999X9d7`: : *\:|`݄:L4:|t:| ::BD :|4|:|990:2<49Xl G0ddL G0x< G0@ G0Ǥ G0<4< G0X` G0l| G0 G0P G04 G0Ęt G0`8< G03X G0E G0 G0 G0 mX G0,: 8L: Xl:|Lx|::| L4:|0݄:| K4:|t:| ::BD݄:| :|˸$x:|x:| GfFfZf{\9gPE,)glgg : OOOOOOOU0%hpVU@ R@hìUX$hUt R@h\U#hDh""Th%<h&\h( h)h"h$tYWh)@DS h*Hh*"Y"OOOOOOh #@Dh Ph" Yh!@": UU9'`UV9<V(,:DV`WP:OV,:DVWP:OV$9Wtm-+*i\j<jXh$hphh$jW@jXjY(j[Hj\iYi\ jh6  t] ]0]D]T]d]t]]]]]]]]^ ^ ^0^<^P^\^hhk)hhmhphwhxG h)hk`) hkhnhtlhuhrhsD_hy$ xhy@m@hz\  h~ *˜hz@mHh{mLh{mXh|8m`h|@mhh}p@8hk+$hlhohvThw(hshsD_h  mth~mx[hm h*mr`i8i9rLi8i9rTi8i9wi:Xwi:i9w(i;lw8i; wLi; w\i<8bLDd L$ 8Ld 8L`xH @$8Ph(<Ldx  l $8t<hl $x $ $q\N% 0@PXhxkgkgkhkhki kikj,kjT8kjHkj kkTkk\\kkkg`. kg$ӘӘӘӘӔӔӐӐ݄CkWPk8+Xk+dkDkdLk°XkD34hklxkۈk(ۘkl۬kĸ*\kLۼkk,kTk|3kɜkd3ӠD3@$3348D<0,ktkkHk/security/lbi/pubkey.pemkkk4Pkkkk5k5k4kkkk6kkk6 k5pk5`kLkt|77 kkPk0ktkkkPk0k0kkLkkPk0ktl^kklFkkkkhkߴkXl_ l_H,lDkְkߨ߈\0 ޼ިޔ|X0d7ߨ߈\0  ޼ ި ޔ | X07xp l_8la<laX@lat@la 4l_8$l` l`<,l`X7dl`7 Xl`lala unknowndate_timeprecedencedscprightsrangeunsigned-integerintegeruser-definediprangeboolmask_hwaddresshwaddressin6_addripmaskipaddressipportrangeipprotoipportbit_mapcomboenumtrstringqstringstringtpmb_ftype* al amABD al0 alO al,4<LXpc.  "$& (0832 / ^  .t(S08)@HPX`qhltD|Cs  mX5x5|OF X   X , 4 < H T ` h t&  + w  { m n     k *   !!PX{!B! !(v!0o!8!@ !H$l%!P !XE!`t!l!t!!P!5!p!!P<68 $*4fd/0$0P0011D112(2t23 3X334<445 5l5/qH6666666<H7$nj(Anenjh7,nk4Anenkt7, nl@Aq7$ nl@AqnePB nenfng8neDAng\ \$ngC nh0C74nhTCt7@nh7Lnh7T ni,CpniC7`ni7dniYC( Y7pC7l`T Y-PY7C7-PCCtC::4o&dDPo'o&o(o):@G o*XDl:Lo!DDo"o!o#o$G o%<D :ToEoooo:\Go :pGo :o,EooooG oPD:WoxWo:@G oDl: oF8oooo|DWo˜Wo@:G oHTWoH:o:o:Wo:o \:o ;o T_o ;(o ;4o ;DWo ;XWo;po(;xo;o;oP; oD;o;o:enenenD d:>>:>?$A: ?,<(:?\$: ?<(:(??:>=<0: ?=@K>@( i0>NV@D i0=Nì@hJ\ov@@Ixot\E`@HouT,@K@o]0@ i0o\A(AdN=oc===H>`O =odh=odBD oOooooLXYoD o opD o2D oP4oD o`PlD,o`D8 E\ObxYX(X8M9Wbxp8Qp<p<p9p;lpppCp,p=(Wp=Xp=Xp8Qp80p8Pp8p8pDSpp \$pRN`pXR$X(Xbxp&dRp+hp+p&p*pppCpX0p.X4p.X@p.XPp/Flp/4?Xdp/TTp/tXpp/;(p2Xp3@Xp3Xp44Xp4Xp50Xp5Xp6Xp6Yp6Yp7`Y$p7UY,p7Y8p7YLUY\Y`YdYhYlYp9PX(p%Qp%p%p&$p&Dpbxp Up p p"lp$@pppCp<p!,:pp!xYtp!Yp"YpQpp p \p |pbxpVppppHpppCp pW4Ypp p Qp4pTpppbxRUX(XYX(Xb,b4b<bD&bLb\YbpbYbbYbbYbbYbbYi Dfpfxf&(p(YpPdpdp$D#pHYp8p0pp,pxpp4@App˜;ppdp[$d p[ bL p[bp pP[b p[b p[b p4[b p[bpDp@YYYYc<,[0b,b4b<bD& pP[pxppppp`DGpt\$p[و[ipߜ\4 ppphp$p@pHDWp p˜pipip]Pipip<ip|]4  p]0c<]@b,b4(]\iiip`]Dp޴i p܈]j]P]4][[$j^j,j4j<jDHfffdddffZfF0gq|q3^q4\q5pq6<Aq6qYq6q q7(qq7hq7Dq.x`q/ q/q0q2Xq38q3tqP_'s<q)ha,q)q*q+Hq-q-0q-Lqp`$U8Uq|`_Tq(x_q4q(q q(qq(qq)q@q)@Dq-T(iq(P`q`q.ySqfdxqfDqg qgqhqhqiDqdHya$y$b ey0i;Jx y8 yH D4yLbt yXy`ylby|3yy2yy/yys@ yy.y's<Syy)yyyc4y :q_fq_q`xqaqaqb,qbxqdHq\ cq\Hq]xA q^@cHq_dydydc(babhaAq[ qicH:@ qk4cD\$qd\c(x\qYxlqYxqYxqZڈqZ@xqZhxqZxqZTq[bxqZxq[xq[0yq[Xiqdbhqe aTqepa˜qlhPqeyq[Aq[ qbcH\$qd\c(x\qYxlqYxqYxqZڈqZ@xqZhxqZxqZTq[xqZxq[xq[0yq[Xiqdbhqe aTqepaqeyq[frspuknlbeplzqo0iqolqqqzqzqsqtDGqtlqwt\$quHjz jijzqjpqDq{q\{q{(qh{4q{@qkqqDqlDqq@{LW@{xeP{s`{p{{| |8|X|t|||} }8}T}x}}}}~~ ~<~`~~~@h    X p*0*0*0188@ 8@0?HDFP`FPMXPT`T`[h$bpHbp`pppp~~8Xp,XpqnhtqoHq@qq qoHq qq oT  qloqq (q 0qh<q0Lq4@`qLtqqtqqpqxqTqqqoHqHq`(q|D4oHqpqTGreenOff Solid FlashSlow FlashFastGreen,Orange,RedOff Solid FlashSlow FlashFastGreenOff Solid FlashSlow FlashFastGreenOff Solid FlashSlow FlashFastGreenOff Solid FlashSlow FlashFastBlueOff Solid FlashSlow FlashFast  q`uq,qDqvqq\vq(8qv\(vh4<HTv`hpx|vvvv\cencstringpasswdencpasswd0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz./wq״:P0h0d$l!X`10BaseTHD10BaseTFD100BaseTHD100BaseTFD1000BaseTHD1000BaseTFDautoUnknownErrorUsedDisabledListeningErrorRetryingNoLinkResolvingNoLinkConnectingNoLinkConnectedUpRecoveringNoLinkTriggerUp(UnknownUnavailableUsedUnavailableListeningInitializingRetryingDownResolvingDownConnectingDownConnectedUpRecoveringDownTriggerUpUpUpDownDownInitializingInitializing DUnknownUnavailableUsedUnavailableListeningListeningRetryingDownResolvingDownConnectingDownConnectedUpRecoveringDownTriggerUp$@UnknownDisabledUsedErrorListeningNoLinkRetryingErrorResolvingNoLinkConnectingNoLinkConnectedUpRecoveringErrorTriggerUp>]} @@d E);prFrB p;rLrK$xrOpD W H TrOP D    d @x @q    @HXlhˌrOlD LD  @  < X0 X< | LH,4 HP\hxtrQprRrO8H$dtrtr{PrWr]rYr[r\X<<DThtrXr    , < X h    's<y| y0ytr~d  DӬ 0 $ HD)ut  x d8 B4uB<  X  t B4uGl   | B4uh           0  @  L ?9 @ X p u0uH  E  d  @ E p(4 `@HPX ` h p x u 0          , D X ` p       ,4<JJB4 duDu0u|uuu uuuuuxuu`uuLuu4uuuu 9dulu$uDu0u uuuuuxuu`uuLuu4uuuu 4 Dtt ttt$,,8<pDtT\`#D u98u uŬuPuPud0<P uuPH ,4@L\l(u E @  @ D G Etu  u@t     (  H `  x        u<    4    0GG GG@; FG<GHLThXu|D ` t u, * ( ( ( ( @uԔ( @upD T  L ?du tD pbD  D  L  @ @ @ `8`D?XJJB4|hˌTL8$ p h$8L`th$8L0hˌTu@uu,u009u´$h,<LL\X\huմtt4 @uuuuu u@Tutuuuuu,uäx4u!@#t # # # # # # &#\4"#up####$ t$ $8$P$h$$#u#D  '8P &$ &$ &t$ $ $ $ % % %( %< %T %h % % % % % % % % % % & &&&$`&0&&H&L&P&X&`&d&h& ߜߨߴ    &'D; F&&h'8&&&t!&'&&&&&'''v (D''' ' (( G( G(,(hˌ(<v@)4(P(t@ )(  )(())),)<)L)`-Pu*)t)) ) () ())u*) u@) uX)) `+x+ tl`Xv*+@u S@m da Y d,,tTv*, u S@ - D-,=0--`t<Qv*`-u S@=   ;  ;  . /h /P//0\t<mv* 0XLAv*@/(    u S@=  0`0+x+|+*@G+11l11\tt<t<v)2d@0v*2,@u S@= u S@=  3d  3` @  . 3D H3PQAX3p33d3D0- 3v)4  334dutdudddud,DviT5P,`,l ,vi@D,8,6\ D,7-  7- 7- 7- 7-P 7- 7-, 7-< 7-X 7(-t-7ˌh-D7- 7-P 7- 7- 77.D9.T.d.t˜ . 0= 04P= 0TD 0t D  > vs>` 0|  0 00 ?`01 ?\1 1LX1pX,1> D ?1vp1vx@4D A  @ 8 @(@4<HT@`hp|AA@@?1AH2222,B824B2`22220t)vyBx22222Ct2CL33T3d3p3|3)vyC33333E3D3l4$404@4P4d4x4444444)vyE@44|55<55, 5@5L(5X5\5`G<5G,566qv|G|6$6< 6L HD6`G6|6666664@647v|H 77( 74 7@ 7P 7` 7l  7x ( DvIvvd<vv7v|Jx4vDvv\J7J47J4%&vMӬvLPv`MD$vM($v$v($vt%v%v %(vX%<v%Tv%hv%v(%v\ ,vLDvp:Mf::::M4&$`:MP ߜߨߴ    4vK v:M; F&vNTv#tv(#v\#v#v#v#v,#v`MMDM(L Switched to 'Trace & Debug' prompt. Return to Normal mode by typing |CRvАCC v8|D`RvАD v,ݴD v,EE$ vCC v8E<EDELETE\EdElExEEEEEEEEEEFFF0FPF`FlFxFFFFFFFFFFFFGG GGG$G0G<GHGPG`GlGxGGGGGGGGGGGH HH$H4H@HLHXHdHlH|HHHHHHHHq:D8servmgr_intfservmgr_serv3M`MhMpMxMEM vv wHVMZv4pMXvHMMWvNN Wv<N0N8UvN`NlUv8NVv@lNVvWP SP Nv٤8@S@O\VvvvvvvWPSPNM:O,WP SP@OvP8@S@OVX:dOWP SPOv٤@: OVX@:dPV4@S@P4V(@: P`VWPSPO8: @P: PP: PifmfilterVWp\w8: @W: Wenvallw!Xp_wiX wXX_wXX_whVY pwY  pw YP]YTYP:YT:Ypuser_conf_fileZZ w'ZZcw)[ dw+$ì[4bw-\[XdLw*PV[xcw.[ w/[\\[\],: [[: [\4: \<\X: \d: \+A: \: \[:@]?Tw1 N0_|u$N`_{u_{u``z0t`8`D t~l`\yLu`to4u`nu$}`l<q@`kXq@aju$a$a,j(w1?t?|???<7x8?0$0( 6<??VA: a@B: a`8:}alq8;B: aq08:}aq8B: aq0T :Daq:<bHqb :Dbq|b:<bqlp9dbqX8:}aq8@8:~<gDq8 :~gpw0tdgw@gsۈwOgsh@:@hgsdhL@:@hXgsL0`: h|s00h:|ghr$gE: hri@: i,gsl:|jilsii: isi9it84: js(j4: j<s j9djr9jrk 9% ksk@:DkHt k| :Dks :<ks:|ikrH:~l t(lX: l`sl: lrl9msmT:Dm\sm:Dmsm9dmtn9B@nsnD:|inPsn: nr4A: os|8:~ToLq8olB: ots|8:~ot9pt8:~oLq8p,B: p4s|8:}oLq88: pHq8@:~gptd@: pu$c ~tpttu$tu$too~uu$tq8tdnlw6htPtHw3t8t(nltt n Lsn Lssssn sn sn Lssssn 4s|w4xstw6sln sdsXsLs8s0n s(n s n sn sn rn rn rw5rw5Xw4sw2rrrrrrtrdrXrHr8r,n r$w7rn s(n rn rn qn qn qn qn qn qqqqXqnlq|ql L wBwAxu0dN0uP\w8N`uw9uw; u `w<v@vL `w>@vt `wB0  ì8\0vp:$8\0v8\0vw^waN0xwI\N`xw]x,wYxyw\4y0wNtyLwWyh Āwb MW6  D  l || 8\0y8\0y0y8 zzh:|zp9zz:|{{l:|{p{9{{@: {8\0{8\0{{@: {8\0{8: |@Dy{@: {@: ppballcreatepbtotpballwsV Šwuwotìpww| ŠwtWPDWP:8,9wfd{@: @: @9@9qballctdall        ww w<8w4$0Tw4VX wpwìw( wLNO (08@ H P X ` hNO (08@HPX`hH@pWP : WP:(H(P(@: WP(: WP:N :|8@9D@9P@9\@9d@9|p@9|P @: 0: @: :|pbrgfilterwJ@`8\0T`8\0T\0lD:|\9{@: {`8\0t{@: {`8\0|{@: {`8\0{@: {`8:4@\0lD{@: {@: p: T`9 B@|Xdw0V$ww8ìwtwXN0dw|N`wwtw`w`$wD|wEl$w$w8 xYY P  Ơ ``666666HH6YHwhN0wɀN`wրxw(wTdwh wҐ( w׬  ` 8   p8\0D8\0d\0998\048\048\048:T@\0@: pwUP,U8lEp ȐED|ìp| Ȑ|V Ȑ|ʰTìl ȐV Ȑ<DwXdlw| ȐwƤw Ȑw w8ww`,V, ȐwTd( ($LB: mX:Dx:?8:mX:D\b :D :<x:?p9d8:WP:?@WP:?d,:D@9x:$99: E: H!8: p: :Dx:$99: E: H!8: p: :Dd:9<9 \s: V:dE: 9c ,:PhX9t`L8 N@tP̠lw\n LHw4@8nl0(w n Lw4nln L$n n n n dyndnshdyndnsgextdyndnsgdyndnssdyndnscw`x`xxp|՜x 0ìx  x4V xdϨ  pD(x<Vt xTd x$ìӈx xV xH <H ,<HTWPLU8:X:dw:?9$i9X9WP0@Dì,=TV@?@ABCD,E8FDGPH\IlJxKLMNOPQS0T4U@VPW\X`YdZ|[\]^_`abcdefghijkl mno$p,q4r<sDtPudvxwxyz{|}~ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ,XFBìAxVA05TXx , < X d t0HXl !"#$4%D&\'t()*+,-./01$3,6D7d:x;>?@ABCD,E8FDGPH\IlJxKLNOPQS0T4U@VPW\X`YdZ|[\]^_`abcdefghijkl mno$p,q4r<sDtPudvxwxyz{}~ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 8|Dt 6pE p6HECp9 5x,9 5 8496 ,9D`9`:N; 6 87 87( @ P87P :57x  87  87 , <7@y,y`y`y`yy`yy`ypy 4(n n nly n n nlpy `XTP@, n n y n n nl@ynlyn n n n xyl`XyHn L8:58: @8:5 :t# x@90#@9#8:5 :t# x@90#@9#:(4:|+D9dh8:58:5 :t, p8:5:t, p9`B: : 8:6B: 8:58: @8:6olB: ot8:58:5A:dA:? 1$A:LA:,A:DA9 xA: DmXA: XxA: A: p9m9d8:8p,B: p48:8 Py0$ ݠyP0y: WP:Y@Xd9x\WP:Y@Xd9x\WP:Y@Xd@WP:Y@XdolB: XWP:Y@Xdp,B: XWP:Y@XdWP: Xdl:Yx:Y:  @Ut \d  YTDìSp,RolQVQLYX(4PhlhxO( X|8N, Y`Z Z@Y$08PNY\ Zn dnlnln n fD 0? 8^% V h^H%al \$ [$`\fD 0?y:8::aT!!$8:a<!"$t"0:|["<$lZ"X: "d$`:aT!$:aT!$: #$#9Q#$#9Q$$| ``!!,`$t$l!$`!$$!$!yP$|!yP$"%"`a#D#da%%nl%U&b}&(ny.y&Dy5`&dly6$|&gy;0ƈ&fyD0&&exyH'L'X'\Ԉr`rLrTwww(w8wLw\***ì*+@+++$+0+<+H +T@+`+lp+x ++++++@@)x+++,,T`,,(,4,D+$+0..S݄9&4:|d&|:!'ۈw Aۈ,:D' q:|e 'd:'x:'':|e''9'(: ((D: (T(: ((:(:)*:ld):**\:ldh*H*d:|dT*p*:|dD*D:|d*,T: ,`,|9,,9,:)4:|eP-݄9-<:|eh-P4:|eP--p:|e\-x-:2--: -%N8:p:(:4yV:X:ddyXH:yY::y[:: y]@;;yf(y;8(yjZ;\}yN;|}yO;yP;;{yQ;;{yR;<zyS<0tE8W>@Z+X+dDXV:|uH-P:)4:|u<<: ==4A: =@:|uH-P:)4:|u<=|: ==4A: =@=A: =9=[:2>:|uX>[:2>:|uh-P[:2>:|uh-P:|uX>:|uH-P:|uH-P>H: >P: >x:>݄9c>>9>4:|u?:?WP:?,:?@?T:?`*:lut?x:|uH-P:|uH-P8: ?:|uH-P:>4:|u<-?:|u??: ?:|uH-P:>8: ?:|uH-PWP:@8: ?8:8<EPVEdyl:|-P $datEEEEEEdVXE VX`FFF8$FPF\8FxFFPFVX $d;GDT}G(TG`SpGxSìGLSVG ހSh\G ހTG ހST}ITJJ  TJ,J8 T|JXJd ހT8JxJtTJJT| $d`tLLLL $d`tLLLLLLLLLLLMMMVMTEM ހUhNUNN4UNNPUJXN ހUOO ހUO$O0 ހUxϘ͔;NNPS8SL $dat3@PX`CmS\ dat3@PX`CmS\yr,F:|FSp:ISSp:I4SSI`:|IlSSWP:ISSp:$I4SSI: ISx:|IS@:|KTPTH@:|KTdTH@:|LTdTHL:|dLT8dL0:|8L8T@8LL9LTT0Lh9LpT$:|LTtLA:|Lp:MTTBP:|P UP,:AP<U|: APU:| U:|R$SR\:|tRdVP@R:!RVHv`:|RV@R:|,RV4,RA:| RV S: SVS 9S(UHH$8SSHhHSSSSJJTHT@T8T0T,T$TKJTHT@T8T0T,T$TKK`TtyqM@MTTTTTMM(UPU8U$UOPO\UU|OOUypOO@UypPPSymVPVHV@ymV4V(VV VUyn`U?-($igmpproxyintfX(XypYyȬY(pyˠY\YhyYY ylYZ y8ZDyEZl y$EZ yd|l|t[[[]]<d|l|ty@L ,: 8Z8: @@8: @@8Z :|[$@:|[8"X@: [h: [[9Q[\89Q\<\9Q\9 \]@: ]L]: ]hD yz zz |rr(r<rTrlrrrrr z$hzKz?zLPzL~HH}}˴HH}}~~r@~(~8~L~`~x@>LXhx#4N{(  ,4Llx<d9P,@Xxp{I\{H{H{I {J{J,{J4{J {DD{ED{EL{F{Mp{M{M{N<{L0{L{M${MH@zzz<zxz{R{Ol{P{S{U{K {K{Kl{K{L({R{Ol{P{S{U@zzzLzz{R{Ol{P{S{U @zzTzzz{R{Ol{P{S{U @zzdzz$z{R{Ol{P{S{U 4TdxÐèü$Pt<>&'"      {H{h{{| `{|?{T{8{T|-{|1{|2|3pD{{@{{pŨ{Đ{Ę{0{8{p{x{ {{{0{{08DLT$ p{d{{${D|,x|,|-|p|0|0@|0|/04H|6|7|7|8 X T8H|ψϔϠϬϸH ,8DP\htЀЌИФам X$H HPWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V``PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O  ʌ08DLT$ p̬ D!Ɛ hA d x   ̸     ޠ'T'D @)( 4edXDd`Vp `4`HhΜ<dd f8B: $p: ڀ0`\„xŒ¬ Ԁ۰ Pی4@Ҹ۰HhpшèôФڨ h WP:0(یX:dWP:0(ی:|hČ$X:dWP:0(@WP:0(@90|8@9t,WP: (:|:|0`: pPƜ9Ƥ90|89t,:|X:tWP:WP: 9D: H:ܬ:<ܘ8: @:<ܘH:dܬ,:Dʈʨ9ʰܼ9܀P9\:Dx:$܌P0`ìPlL̐Lh̼hްh4Tސèdph͘ VʹWP:d`@WP:d`X:hd4WP:d`:|hČ,X:hd4WP:d`:(dWP:d`:(dWP:d`T :D(T:<H:Dd@WP:d`WP:d`: Ѵݐ8:@9,ݘt:DҀTҨ:DҰH :< :D U8:D08mT:Ddm:DӠm9d:DݸP:DXݰ9Ԙ9݄<9Hxn: Մ,: WP:!d`9,ݘL: XTָ: H:|(<: ؜xU8,˘8ڈ ڈE lEll%Baa,XFHT\,ڼìD`@VȀLP`8۰ĴpńŰżXdǤHȜ( ɐɜɬxP ɸLr@ HŰ0 \Űt|м@ŰN۰4$\lPlHl@l8l0l(ll lllln n ٸn ٬l٘n ٌ`ــn x`n ڀn nl$8kX,k|nlth`XPn Dr@Dr@n @kX4kn Lܼjܬnlܤnܘl܌q܀qkxihdrTnlܤoTsp4nl,THt@n Ldnl| nlDr@`TH@nl8,n i ihn n Ln Lݸn Lݰn Lݨl\ݠݘݐ݄jxj`pn xn Tn Hn <wdt|8$(L `( $v@,XFvv , < X d t0HXl !"#$4%D&\'t()*+,-./01T2$3d45,6D789d:x;<=>?@ABCD,E8FDGPH\IlJxKLMNOPQRS0T4U@VPW\X`YdZ|[\]^_`abcdefghijkl mno$p,q4r<sDtPudvxwxyz{|}~ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx W Wߔ,ìV ` L  `z:  WP: tWP: 4 :|!`":t v8t@90h@9\`:|dv0`:(v(|@:|X$PXW!@":@ ` p n xx\xn |tzhn \n Ln D   0$P L|}~FG HIJKLMNOPQRSTUVWYZ[\]^_`abcdefghijklmnopq rstuvwxyz{|} ~NU@iot{\M^wn|a[ L>UgclVcXH\Q\ib<h6\<T(dRatb"~r\D]qPteҴS<R (R\b<i8LLUA(iA0\X0qpXOPe4mXHQ`r$L(br@\z P$UkcLhHHpP cn O`;pX`iYbiT~Qp~OPmmLmzW^apbYczi{6xPְHR(\֠_k|֐G}l_L@P^lրcTD{ k`/a`bT^\b g pIiTi.TP S`Z<aN\G(aXt[pJ*|Z`_t  WKx`MV2opl\j#HL ,aH{<w{$r0JQa`cۤUfqz"Tf<z˨J6`&b gtH{^8MW(d!Pc8|<bh]&IxadfaYt}3lWlb8|3] WG8lDXj`@|}GG@Wcb\fTG0`VeB8 X_[o90g{`]^a\Gdc~cP| TNV| GPaWa_ w|i4\pŀvwb r rX\clq[0[0LV.ȠX ^Xv}|cJ,MNU|TVհV,_3^@b+H$P4]w$d)\]@ddՠR+W{WzLSmR^,D:d{L(Րv`}^PՀbp/DJNWq`PZ T`v,Pm.@ZXZ|_0v^|_a]FR W~Xv|14aX<rG$|T@ PcTa@evy@IK@Q j;_4l({t\bPWW8R0\Pb}4L`N\k|z^bXenQP_(,Jb]Dg$j<I,$T JTn=pK`B G6XL~Tsk[r$DIJkVRN&Pfykrpdp mOQp^x`c>do2ibM`epW?(W.H_ce8R8q@<ROWAX԰ԠwTY(Ԑ|FF^<NYcz{LNPHic`\ : iPiRp4Sx@Wc`)`UTJ'PaUfqLj]_{Jhagw,Ő_Cb|MS%hl!ԀO[4]bsb$lV6 n@}}zTa(r2TS\VclLL[p`bfKbv7XvpKNP| Q(PD]oټ_a@ZcV]{p`ILrOdTF^0[XlQY$ileT`cPb[x  KNWh| T8]8^igPPbKNPp~hG|KLG0HlN8nF8NȬ~ߜg+b`X@V\\XDag}<|IXIJܤUMT / aR__4|TQ$[" N]|k`aRe NSӠch\_1lӰN,ӠW]4W^٨^w#VafCXf$kt:Ӑa]TbӀbPXpQxd\=^Ƽj]C}3FK(Q]$\rbbitoYaX`yPDŽ\$af4}=LPMp`eP|tVeW)fe`bUX]lU _r{PeHUe$@c0a@bfQ<WWs , KĬ`db }R^"(_kip]U({KlKjN`b4|}$q8TWt``zȌ[ӔI@pR+Oph֘O#xWz {\`gP<{Yb`imhp}q {MH lM0ON^l`\|bOvc*w{lFV_dX[{lUgU]G{_al^]YkDz:uҰJMJҠa |R a{b[TVe0RI^{(`ېiQz a}8y_@Lz8zҐ ]bj@t]dn_]hpyt`{HUԌV,eQXbjCxhLr_lqÌy]Uc"PxQB XРccҐ{R Ҁ~v LJX[p_,\}@c4e~pfJ4`PHPW5j x\PNtzZLc.T`_@z_" u2PbT0KQP[м P{bljJ3cq UdjHD`b$f7DHl"{p,HtXA`ihpOJ/NzNO8X(bsTdHQ Qd([wHkP4^j4FTG|[NAYXy`cQ{ELƀP^^\:P\`*<jVr|]V^$PkVKgˈbltpnR3TgvOwTY }3FV{_0crd \{uR$h MѰѠS`Q[`i*plOaVtaLGNUQQsPil_]`_dѐR$|_b{|b z u|QXda%/ON`_a`z NTbhl Hg@_xl$cvzр^%blHzDW_X(hXpXWY@`arcQlnP(V\XX PK:$N@XmbMFRLPkxQb\0T3X `PQUe^DJ0y`zQ|]\}|~( RMvHndcbNX~>FM4R t,~tPۀblgĜIb@l p{\FbaxqYPip NRl]a^ntvf${1c\k||Ht]<^|PZ`jeqXKQ[]Z]=0xINamnմQa8 XZn0ooNb"tMh[dTbDaV,aƠUbiw4ȸ{fFR)b{]{bUWb{ tP~ݘrP XpHlUаvxb'РKUX^`Vnxݐhjdf{K M|aSF|J`Xj!8~T`1tc,aPc"InϤАPtf@lb,bRtbMЀo_L RPeP{8| 0QHp{o``@eƀ^l@$~y l`#|wc(cXbDc9MXOQr19\.P~Gpn: \Lq _P]و@NjW@r ${ED LzdQQfTVXqe]zU`NÀd_jDdmzD0 `,b#wT<VY_NTcj^ G@DRL@F` UbpI`PgPkN^]~nJ/ppd u8frOH^u,bxqOYcPg20UaWbf{H+]E_}ɠXMa.hk9sX~n?UZ\(cDN4{0}RQa^0naxMŰI_I fHQ'Sn`Ha<ϰϠ]{^M`nH}^^h~ XIϐG|},`;HӀX0πTThiO^pf¤{H]h`:``Pv]{@H0:\RGKMTPb~L0n+a|`;aMwM_QeO {M`ބ`^PcNLaWS.WHLUdVSBW YPRt_^`qaPnՔLFphq@]|Kr|cTlkHJ20vjK<y]!bnPNU4Y͜kv|`b}XFeĸP&iFdHiv{TR my}4\ŴarHP^ΰz$FR@Z\bhc]m5py}k<La{QQw <ΠqT[s[ b̈^GeDΐ_u`8΀l|HLdMhj,OLS0`n u||]Q^8pPT]RxcR$c\_laPluqHO@Z |c/WX&hUQ0`/\NÌ]9LapfM`|2J$\PlT^PJbGaZ@dkHy|0XN;p b,^`bxUeUWN |~x^l^lJ\4aw~buVK\ 4PJ@QfH_A0{>|R6]zozWcd ]Em|^bf{\kl|^+IQqHbbhJLNPn[T5^f4HWtaQkr:xVtP8r$roz~_^8a#xb\cx6TUS8}3t z,ͰF@KR#a|bQqFP c\HlܰHLKXa_b8J2k:NN`@\cLe|}Qo8Xc`sxa`@ejW_AUl[XTJLN4{_ _^|RX`ehd  (avpO ͠]> [0^b~naX|N|`W\(͐e j=Dz\?e RSaQ ^Ҡm\zLNT[b̀M|cin{MpcpƠNsj+chpoCKQ,T>bJX@qT4]Ez GB]9}4`ivn 4Wayz`8J/PzgQb]cJTyHM$W-H8WAbp\x_(QP0Q9PqZhzLk\n*addXLeLTTjUmP['fB`@T94PYY_,fT=K`q_0]ua_i<rG]END]S8`!QiQ|P_ b6b},^bLL4QLbcrxf<h XxKRphh 0cc9PU\zUuTUbQWn bx_H RdPco|N2̰_db`b~GypNIxQm}9SA<̠̐W^f. nPX40jOudNyv_Nb?̀\KlcM4 (aYp]>{I ``7a`~e8}8 W"]kPPR<^_hLU^X;|2@S(_a0aSH@M0Nv(d Sz> PR[p4`evnwo aw/KdaXbgB,DR]V$axo0fORgVLg8]MmlelLPHXW][loa$^'XI]r 8Ll ^yacXxQ@g4M4}| ]EiPH0N^4bTzPn0n Uqdf]Pj `bJaDX\]݈]l^ m/Ur cڬGXNpxR` L_ndq~Oi<l!H˰wtPHU$] eL|ZWDH8ZXd r2QFot`5ˠXVHb ahKH Wx^{\HPW /$`$kEu|`;TːzY4~p{,JXkpˀ_^ۨpp${NdelvFF`4B8Ndv|k@kGEU?TVk\i] x`cR(zP@`0ac]doc2ިq<wGoZX` Z0PzLbL}P SD~l,IxaUaVezP`t_Ela|Sȴ}0U|c($ymGO\\t|aZl&z{cX0X_RDasMp_-Oo<\d{S,a_wwyQxLPlK_,xp_pc;@\I_bkXv`t 4ZP\QE(KPW a!hn>h~sPMH\ FpDy݈VIfnt X5_WHzPp]E@vhY |?$`oi?lwnfzJ8`bTb|_}boSҠ`ejJRPGbU:qmNT{l:aKlzi0SsHa~ʰFRNlhXuPuDNPkcQfHdSr@fh(NWǴWʠʐ|PlzUTcdUb qZj(N Z|U> _^a eѰʀo,pg,TpGHN|X`RGCJhcx߈R^"0aY\nVRIT|dsbPzHW@NhPPdxPoW@J,cPfjFUhn20Hi4{0P}ƐJ_(q!K T%4cclgL_lMGH|Ky^8`3a\ ^Ja`Spz<Jb%XFn`Ra`(O]d@_tadZllK4dRKqLabPHQcvi{aLLg/[q>G _W, PiRb<}Hc$jNu HPuPb0aYDh$LXsD_ @aThGMt|Zt]naT]]ulb\(8ɰcHv|nHɠl"hJ\q,Pz (hqxy_|8uihXByoOzNzH^$jdN(N>dgzbpVɐSX7Zen^4a̠XH`gp\=h4icLbV(gDɀjN c"8xpGTGJpQ0Z0{[iH0m/DZFeEh0LLaJxK3`"@^db}|~g_T`P`\yF`|hj?xMXa8Nf|McdjiPVlabJ [Y0SPo8@J \@{J{PaPQNL<0ohcw OXN0i\ n1z[a_h}<OQW`aZLnpQFQc8RTXLWP0`h\pV`c Hbuh[aoxHD{\r&P]QS@`eW_x`0f,viO\OQ@^^ʤfc[~%Kh LKX?P\gjlV`5D˨yma,vP`aKedRLb|bS|QcXmFpz$hO\2p`M8lvWuTWDL] ^݀Z`68s^ȰRczllF_UQPX՘l{ȠMs`K$LȐ|]WȀQ@ hHDäVQhr%<bo4r oF$y}pkԼGW&]aD`DP+]CflLKP p`X@MbfAR`Tl~`c"`Tc`eD0K ~Q^<f0P^0I D HRIhcR|a\\^LpcqeK/$q0G{H{VD `=H$[XhlQx|yLpbm^V eibMb Nj lXV|_clMz^]`2~M"YLJfL8[b/|S(q=dH0b:lL}QX\MaWcrb`NT ]>(a ls#(P/Qxa|TJ`W1]#rK@W|0W'zN,GtTV-lYbb r@|W`0PaŬ T8]}biS W4 IxlvQ8_xb{hb [8SVa^Vbi~n,Z[f܀fqL{RaFmpFDX#}N,_8NKLQW(lFwGZUprF`N]yx`ULb$M\bzo+~DP$_WP}/q$,eh@hDutKz~w RFq`oRX"^ 0RW^V\4{<v<a X_<T `dlOPz8bxcW,~Y(NX[X0}.~w8 HX Ir;[]caXk$~j^X{XN z%| H\Q>~H(KX4[NXVVaNpKe p`R(QGEW_ atcQtPbhP\Ua)XIK\amlNUpbHGzP|Gop0JPT'Ta@i+0c iExXNb|bQ E]UXLtc|0cj(o<r-GìM^ UfhaXRUh@LLSԌb _(LL{qSLSkLJxxR:a|S{P?TX`Yq`gxLm0ah@b$c`dTp$`_f1Iqhz,SypgH \_H] WpfA`e@XMd}ԌFa@_|3pG4a̰lLc `3i]P]xkvPY߄qTTCzoNQL`pzP\clnKv'\GDILN~Vtc^@aY, G|oP_ibjE40zXRY@^}.YThVd_~ulR*Ux@er~jpbU\^8JZl^DN,[QpaWLvJR_h[^|bLPMJ)`aHpPd]ݐą]k\<bkFmVW`]d_5p-RL\\ v{lbo1q~V\S]4N_@ZklQQo0 eOEU8bT\jaXv|~{To1H[ ,`3b1HqgRV_g_ N{ieKr({XT$<b]V`d^h$h| `#<Gƌ^p|J&b `f|H̤NR4Rhj jLp|bXzXvzaX$ [hX4bMrQ,XVd bv8h|Xh]&KM(RDV~ ^bG^WȘaq z,W}LRAVb {tHMHt`vb\(}bLV  H\ppq$n4Hbnڼ_cbp`p} ƄRfo|HYSjBx| IUr$lky<b@ON\L^v7x^Nco@\PbRJxVC@o@}?0Y[ vflJN(N0WDWyhb m;QH\K$P;ah|DoHN}ch*u4Q`lmaXYhH`}3o0}oZzU0֠SudtV2U`[h{<I^tW4eE4KC@[l||Lba_hexQla$kq[GPT7pVq4V/_5j{N<Ra$_K9laPbTK0^l9a#L}Z_;zdGP4^l^{,,8j*8SffHPLW0cy@~ca`bpXYq[PSdILoHfHY@qX{t\NfB| <a^PaUgl"8QAHWztYat]8jUXQ^JJrMlWipdx`b7h]hyH]<HXnOXQWbb_txi]B@`a,J$OPXcPnTcXKr<Rc`R`mnz\\P{XkdN[XP_a c @\[tc֌(]a0W<nI|XtkOyH @ITNPP^p hKJKaYgGtc7ibpzVp`e fs_i\XcjT_lP-d_6b7].XTu4l^abl,FI@J[Tq)O(.yRlJ^4cbimY\pOQX]WZRX|]nO`le~c^lq^c6K6t|-^d_4kx,bjdJ XviLeDQtQyTaT a8u{dSӴ^|b@S4pMb0R^q"x``Ka=`bk8HAÔSӨJM(Mvb(_ tc0PaUv$Q\] opq:[X0@pj=$a0bjPaO}2gpNVTb|t M^HXW(R.{X}]o,aMbPl#p̔FIhhY\^.0aV^dqpoS^[n8HOx_hLHXbl~Iu[ybV4c@Tk;Rm@Ulb' c@_6$_b]aRTefGG^ HLP_ a\|x jB_PRtj+LVG@bmuwN_`=<jTGJ,lX\c`zNXlnT]F\ƜXbrabmtr O\=<[m:x_dMp]90NU^a\i.,[y`4n`iEkPMRV<@oN\\HPx^Ơ WXH0j0 D [PvReQ/ft{`6`nbDH8N cސo5H-uUGFN}mxay m$nC$WԬqZTC4bӜ])mE~{HG^ LDahl \RVPPtW}yU/eLT1|^HbBpab{SLZ(R`| apKZdhyPPvx{VXDz {=\|]=8l <r1{o;k0pkT$h l`fXdRbHhlFRMxNR`d y~^{|XEX-|\:@R-p|VP]`aZk J]LcmXFoɰ\*ar@eVfdDZZ}S"DH@d`@]D[Fch`c\_RK0N` GFK?dS`Ud]p0b ^d^%Qb]a\Q~U-`;8c|h8DqYJ&|,Rh`UXDcH W|hHzʠa|TRZnkRbUfZP_@hh(fnLXU4_^b4RXFdbZPJdDbj]|ZnZN͸T>,S|\}4PWȐy Z\adD|}3L^PQaY]o]y\rz pVca^8a]ѐHbTa `wtbKR sL]`fU~``d jA,i}jlikXJ]}b|oSo|${q WvN8XXW(bAU,X bkWbHTRk{h0KҼ],{xj\k `zm<[vVc\`b<h a\HǴQVWpfV+XclS]R kw0K@|1H8lՈ`^|tc)_HiacJ_tfZ(Uh_?HkxSfU$VUPPI,WxY]Qu~bDnM8S(n ]:^}aVrɸPPpQuH@|HkhFUxP.`r_XV c`kӴ0PepNvT g@0 XVZ}W`e|pP?4eGFp^ˤp z<HR {J4 C Jk;HT\@,XJl_ c]lhS\lxS4lafZ T0T%[{ZbLc pKNb fgVPaq`Fuc0h KlvLQYl]lLo/or]^x`}f8`kPu,OtUdZLRRbjiPoQTxa[b\NPcaJj0^}xe[nxaǰWl,b[n\R(`%cHLj[U`I Nk$Ko$a[rFI P c`nøU`Q_R`VdnpRT^hl^P[Wb:DU<XLwzSke qZHLQ@z|^]pglwX'\[|bfJl[P(WW0xa{M$Vj]C`Pj9KU||lJƀz"d@`~`;hT^zcXfV|kfHepTNThH,]@]r9TNsR#$eX(l_ J&$0dbh_ڼez`W+D^LlRmn X(bR _`uTQpSwqK݀V PFTJtpdr!`T84aPfFEh|D_ `dH~4Qa$oNNJ\qXz,lFr:0 qzְLXKQ|Pt\}cfLl @mn RWx9|3KaVvЀ gH`OiR X(er=$K~lr/`dO ND]rDZ`%h7lZ]aXzv`vk`QyGHF^aul_`e5LNRJ$ibDbil~X]daWdb0b,|8WD]4]< Lfkb~gмipduTZ^`LN]uh~kx_O5`^!L{R\c,VadFXuJYP_UbK}2a_c]8Hjx[xgRpZՐbUe7{cXgiql`_bffZ0}g`x|^P{P]s)x^$a`p|I RTϴj^P NPWm|K1h{tUq@aixuo|yKK G|KV{J{jRl(]^aZ|ei}GCv_bhG nAtabPl:IQ]_,@ip>,oQTzHNQTpHn`PQ4R_,Lel`ZWP|WEfn>LK,_6PbQa]zalNTWhba@dxr4Q,~S0PzlX`t@RnQzDVOZh.bpH VDX`cr0MtX=P,^u5 Wt{XMUlqX`YTntqGH4Q>cdLl R~4^`;vG{_TbpITSK1_ uMaƄc`J.`JRLMg`f|bWHj;T LfvdlpR#0QU|kEH@\N:n\PPJ[ HXV\4q$R~GKT:p`J&,`2iP@c`~mhHRKdX1_x0P\hG(pbN`dɌz?]{4aHaFe ^ 0Fr~tRkn4^k|KK^߸hP@^V@Z bk~z0Iq[~dM`^cv{pooD0^xnacl0\bac_cb9wcj)Di~Xhvp MZe W3d_gg qH<Qcc T|SW @}[Gi= m~,[W`ivxP,ljjL`Nu^4`Lc4PX_bZ\bt(U%$QX~a^b]GO  \p\<Kt|{XR@]_ )xVQRT]*au>^@`z{MbVq|U ,Rd~,c}{°-n8OxQ6Z]>m`iwDLXo|bZd|`U j `GQ^PX^<^}de `LYr)} @~qa `j`TahJPJ `Cr+pH8T3]%dnTpp$SXPwDqn4cMn~Fp^}.yy]HtzN\hzjhklpa#unX_ `iiLi]`dbHu[Dy(UaYL|NdIxN`VtaĬ`P^\:STS|F$X+ax$eEK?PhS}@0]Vxk@N$G UHac7kdHlx_`bq[XT^zpoXUueHlxQoxgɔNyQU$W@SWa8<HLQ|YѬ{ GXXI0{ݜTZhKtTc4`QXUlVP\ejTq>$]ZU,]ej8d jXz0^bwTO7JOS1`uAUXXAaRV$ROnTzYh[`LzHƼGx`Yo~`l T j9|aR{ZZdf0XՐ`)X^hb5f<n´J]||`=X$h \>\_8IXJ& _k8inڜ{<gDw"Ph LmP@{8hXgfw`H^T?^l}2NT^b0Qg]uVgXJNȘPZ^^<eGDT ZaYcJTcreM RUl[<qO3|%}30U/]a^aZ}3a\P`(vgzL |K2Zq<X|px`b4Y_$[zpza Ul]cXnS$XcQ oVPXPZ_]4HT@xLrjd  N]:<bdbDeJP_xcLT0^99bXWb^akfh yuxfn0Sa[$ {nE|]x]L^#`pqc8FRH] I`fD {@KLLpXp_Pbn^^la}b[uM0HQVaaZd0qِzXGdPdUA_$,{F@O\cNWW\`"n- me8Wt^X_`aXGJ<NuX0n.NLcPm;$cܰ`dLi<a^b˸R'VIZ`FClNU^^^b8]`r`PoN Q^Ɣam] |@N]Mz,RT g9vlPocq0bTp|ɰ^X/|,c%mn”`Nw0]uH}.dc@PP~]U d0@@ \~VO@N0x`iL^P d{8z[( ڐ ]݀tzhK]d[[[+@}2hT`W]Q_<l9xPNS@S]BHbR8blIU`oYlLTNSSAPn;\5d0 HFcx_bD\hq$YP^hJPR@d%NNrFK_|2FJI\kW8Q<S{I\O$anPy_Tj[HuF_^ٌc{hzedKVܔLfR@ QD:$Oda\DHhKa[xLNy@q|\C $^zo[ cPHHPRuWc<pqH?g,`IuP ?8ednMkazamPq(@S^HaeDoO$|mHQ|g0iWvk@lVPP _< @tr2P4WcJg|{X[rlm~vpR\΀eoNSRhagP\XK,NDN`8W*c!~(,(J#qH O"}2^]AjBXPx]N|cZOHHm8^~MR(`4_XuoY}Bp^lVS|ҬGxQ4}`q[LXWm${Nd0];t{UVX>Th-|la HU}^4evDk\h`l{,^@j,^%FKhSHbom5 Hlth$\FT^NU7xr%\Ѵ^XlN|-pbpR=Pj{l4nhJ-Lh$`n/R`T4U W0jCPTX P@V7a|0vpJs,w@~o FoG,Qn59c6ag$<hP&|j=dvGF`U,FV9l}c{jь~(N-(UNVgː]4zLbRKha]UcHYDd Pb,U߈WF`44Kh\`hiHFW@bZ e|IN<VHX^Tzd`ۀa~cqHviQLbu,{tvV ]?PeFWGP4KQIhG{Df?h r#lk\{HQ}GFT0{(h fqn9Uz([|aƬca[4e70 THa4Q|VXY"_ V`a8aŒ:|Pp\Ta :Oa`|LSU%fV4XI 6hHKX(XN\4HqLS d^la<_Ha$GJFiw pq)@Sb^xTFX$Hjp,^ǐ`ccD`K2U jPH LX{hj 8MXPU]<@0 0[\xf\D{J@LKTU_]`cPr$G `Mq]\^@Ygeq}mU`|L[PV@P@X\߀biN_Hb{Y]|NNWXTcOhXtq?|v*Gx_,4N]p`XKJ0O҄[t\nLk<qZP0aq7Rm$__Z~k{HN^xw p`z|{TJ~gNQaOd_lb}4OX@t{IiqYFN8bb P._hpoHV`S$4cP^G`obPx@qZ@J.hc0aYN$ ib TMmbPaT|0nJ`mz ,QS\^_L\YhNydylFV *XLb|v3N0Wr^a0fh{XP\A@fv`xeS%0Àu]P<x`z{L{GX@QQ{XelTq(b%}/PbV nxc^ iP_ 8FPUhPjTK>|P.Pl1H\0lpB`@N0nKHX]N]WL\YSfY| 0O`38JM|QPjpNKh-R]<^~h}U8VH|b(lXC^cSU^Pix` [hapHJ]yo4L|]hPt`PK`[x^xvhOU"dd#0]PVi5lbli}XX}}X}^iY@RJ4Rh_yr,^Rma~80k^ڴ{Tz]S[_8^vj@IVbh qLXP`0`b!eMHM_pWaOXC?}bn^PTJcW MNwSƀW,ae4mbvpSLaK JY0kml,GpFJH[O; N~]dU`ݘd*PMP|P,sy`zTM]{k4or zHOF4V|QQWf 0XbOHJZi|NHN8Xhb9$jDGHNW$_} LnbP v:QT|l{GH^`mLl_Nhzh,HWPÜIPP~x Q_vpQdujxbQPHR <aXlj<QLXakbcu0o4[x~dtϤUbWxr`R` e<hLPcDVXM@_b@GCC: (GNU) 3.3.2GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.4.3GCC: (GNU) 3.3.2FX @ FFDFhFpF0F8FF(FЀ F FP F(FF F4F``F`Ft(F F xF"PF%F'F(dF)DpF)ЀF+XF.LF.TF.\F.xF0xF1F2 F3 HF3HF4̀HF5@F6@F7pF8x F8Ѐ@F90F; F|0G?p@GA(GAGB,GB@GBTGBGBGCGCGD(GDhGDGDGEhGE`GEGF(GFpGFGFXGG GGpGGGGGGGH4(GHGH0GI GJ<GJDXGJ؀(GLd(GM(8GM|(GOd GP48GUGX@GY< GsHGt(Gu0pGwd?(GxG{ G{D(G|G|HG}G`GpGt`G`GhG\`G`G`GhGԀhG`GH`G؀hG`G0hGhGhGxhG0`G`GH`G؀hGhGhGl`GhGȀhG`G`G`G@GD G(GpG G@ G GЀ G(GT G8GdGlGtG|GG(GG 0G8GpGGGGHGxGGGG8GhGGGGGG(GHGhGGGGGGGG(HG@G8G`xGd(Gp0GGGHGx@G<HG(G (Gp0GGGGG̀?GGG(8GG0GƌGƬG̀(GXGxGȘGȸ(G8G`G(GԀ0GЀ Gp(G@G8@G,XGՀGռ0G0GHG<0Gx(G`G@GG@G(Gd G(G܀G(GG|Gp8GĀ0G`HH8H80H88HD H H(H @@H @H dH H H 0H \(Hl(H(HH8HHHpHH@HlHH0(H؀0HP(HPH8H|@HpHTxH0xH H$?H8?HD?H<H$(H h H Ȁ?`H(XH-0H.(H/tH/ H/H7HH9H:H<Ѐ0H?HA0HD HD(HF HFxHG0HHHJ, HJ HK HLPHLd0HMH(HM(HN HO HPx0HQ HQHQ(HQ0HR 0HR?HTЀhHV\HHWt(HWHWHWHWHW@HZ?H[<0H[H[hH^܀ H_|`Ha@HfHHg`Hi HjxHj(Hkx(Hlt(Hm8HndHn(HnЀ?@Hr0Hr؀0Ht0HuT8Hw(Hx( Hxx HxȀ Hy 0H}`H(H`H8H0H@H\H|0HH̀0HH 0H0H0H0H@0H0H H؀0HԀ(H(Ht(H (H0H@0H(HHHLHL0Ht0Hl0H|0Ht0H(H0H0HL0Ht0HȀ0H؀0H0HL0H0H0H0HH0H0H`?8H ?8H0H0H|0H0HP0H0H܀0Ht@Ht0H0HԀ0H0H$0Hp0HƼ0HǴxH0?Hɰ@H̤HH00H80HX0HӀ0H0H40H\0Hl0H|0HXpHH伀0H0H40Hp0H鬀0H 0H<0H휀0H̀0H0HP0H(Ht0HL?8HЀhH(H\(H(HH(HH H0H8Ix I I (I(I@I D(I(I`I؀8I$ILItI(I (II(I$I 8I I$tPI+I+I,I,$ I,`I5h@I:؀8I=4I=8I@I@p(IA 0IB0(IB(ICIDIDDIDlIDIDIDIF`IGIKDIN؀pIV@I\ HIehIktIn8InX@It ItX ItItItIu@Iu Iv(IwIwDIwlIwIwIwIx (Iy@IyIzI{?IHIXI(Il0I(I`0I8I<I\HII4I\IIIH(II`(I(I`(IIILIII܀(I(I(I?8I0I IITIpII܀(II Ih(I(IpII@ I(IH0I0I(I IԀ(I(IH8I8I`(II@ I (I?8I<It?8I܀ I(I$I (I I  I I?8IðI@I,`IŨ I I|IưII (I IP Iȴ I I| I IX I I( Iː I I` IȀ I,(I( Iΐ II4IxIϼIIDIЈII ITIшIѼ I I| I܀ I< IӜ I IDIԈIĀ I$ IՄIոI( Iֈ I IHI|Iװ I IpIؤI؀ I8 I٘ IHIH IۤHIX III\(I0 IިIЀ0IT?@IL?@I 8IXIIH0ItIII(II0IXIxHIII0IXIIIЀ(IxI I IT(II II؀I I IIxPI0I0I(I`0JT?8J0J0JȀ0J8Jh(J?8J ?8J 8J `J (J d(J JJJJJJlJ܀J PJ0JLHJ4(JJ܀ J, J|JJJXJ(J0(JĀJ@Jh(JJ$JL?PJJJ`JЀ?XJ \J# J$\(J$J$(J&J& J&J&J&$J&,PJ'P(J)J*|J-L(J.`J.h8J/J/J/8J0 J1 J1(J1D0J20 J2 J38J4(J6?XJ8?PJFHJHJK8JM| JM0JP0JPȀ(JQL0JRL0JUHJXJYJY0JYP0JZl@J\4(J\̀?8J]hJaDJa`?8Jb8Jd\?8Je?8Jg?8Jh؀?8Jj0?8Jk0JlĀ?HJoJpJqLJq(Jr8JtJtJuJvpJwJwJxJzJ{XJ|(J|HJ}ЀHJ~\J~J~?HJȀ@J@ J0J̀PJ`J J@(J؀0J(J JHJx@J@J J`JTJJJJTJJJ(J\(J JPJ4JT?JĀ0JhJ8 J@JJT`JJ0JȀJJJJ(Jh@J HJxJ̀(JpJ`?8Jt8J(JŒ?8JÌ JJ(Jƀ0J,@JʨJJ(J(J(JL0JϤ8Jt0J@?8JHJ0Jذ(J0Jp(Jܤ0JJ0J 0J$@Jx0J܀0J<0J(J0J笀(JЀ0J(J꬀(J뀀(JP8J퐀?@J,(J@ J0Jx0J|(J؀@J, J(J (J@0J@JX J J8 J J@HKd(K8KKĀ(K@K8K KPPK؀(KĀ@K pK K (K < K (K  K K DK K K| K0K@(KPKK K\?XKK0K8xKd0K0K\KdKhXK@hKxKLHK xK$p(K$xK'K.K/$PK1h K1K2K28 K2 K2K3K3@8K4d0K5lK6tK8K8hK8K8 K9K9 K:$(K>|(K?dK?@KC@0KH 0KH8KJ0(KK(KLX KLKM KM(KN(KO`(KP  KQ KQ| KQKRXKR(KTKTKTKUpKp0Kr(Kr|8KsĀ@Kt|@Kt8Ku8KvKv؀0KwKw؀(Kx@Ky\KyKyԀ8K{L?PK~l8K0Kh?`KԀ@KKpK(K` K K Kd KKD(KK(K|KK,0K؀0K?PKK@?XKd K8KKKTK?@K(KXPK8(KXKĀXKhK `KXxKĬXKhKҼXKԀ`K̀@K؀PK4(K݀(K@KHK⼀ K8 K0K䴀0K夀 K@ K 0K縀0KPK꬀0KȀ@KPK切(KKK(K(K(K(K((K(K(K(K$(K(K(K(K< K8K,0K0K0Kx8K(K܀(K0K0KȀXL?8L?XLl0L@(LȀ(LPHL (L ,(L L L $XL XL ,XL XL4XLXL<XLXLDPL LPLtL(LLxLL L L` LĀ L( L LL LPLLLLL@LpHL`L0L$(LLLL|LLL L<LlL@LpL0L40LLL4LdL@L hL 0L!,0L"L#8L#L$0L$0L&8L&hL&@L'dL'0L(((L(L(L)$L)TL)@L*TL*|0L+(L,TL,L,L,L-L-<PL-L-؀L.,L.L.ԀL/(L/|L/ЀL0$L0xL0̀L1 L1tL1ȀL2L2pL2ĀL3L3lL3L4L4hL4L5L5dL5L6 L6X8L8P?HL;PL>PLB8LD?HLFLFLG LG,8LI0LJXHLJȀHLK,HLKHLLHLLHLLxLS(LTxLZ(L]PpL^P?L`LcxLe|LfhLiPLjHLj@Ll @Lm0PLnLp|?Lr(Lr LsPLutPL|L~8LL@LtHLp0L<0L(L0L@L@LLLlL0L0LL4(L̀0L?HL?8L0L|?HL?XL L(L؀0L@LDLd(L0L L@ LL8L L LȀPLXL`LHL LHL<L\HL(LLLLlLL?PL8L`LhL<L8LLXLp?L8LpL(L(L`LppL|(L(LԀ(LX0L(LL(Lༀ0L0L(L吀(L樀(L(L HLHL`?L܀L؀LԀ8LMMMpMHM|M0MMMMM@MlMXMM MDM8MȀ0M p?8M"0M%M'M)̀(M,d(M.?M1M^ M_pM_Mb0Mg` MgĀ0Mh(MhĀ0Mi?8Mk?8Ml8?8Mml0Mn0Mo0Mp܀0Mq?8Ms`0Mt|0Mu0Mv0Mw0Mx0MyȀ0Mz?8M|̀0M~0M?8M?8MH0Mt(M?8M\8M܀0M?8Mt0M0M0M0M0M 0M(8MX0M|0M0MĀ0M܀0M0M0M$0MX@M@M40MH(M8MT0MhPM@M`PM0(M ?8MT0Mp0M0M0M0MM`M MƐhM(XM` M԰pMPMX M㰀HM8M縀0MMȀ?HM M(M?HMLMh?@MXMt@M(M(NhNNN(N@NhNhN<(NNN(N(N((N(NHXNHNp(N N @N lHN 4HN (N @N @N HNN8N`NHNLNpNNlNNNN N0NN NN(8NЀ NN$ NNhN N (N!$N!`(N$N$N%( N%N&N&PN'̀N) N)Ā0N+<N,x N-(`N2Ԁ0N4 N9HN;@N>d N>Ѐ?HNA܀@NDNE|8NGx`NH(NIx0NJ\8NK(NLЀ0NN0NO8NOT0NP NP NQL NQhNRl(NSNTp NTNTNUNUNU@NUTNU|NUNU NVTNVĀ(NWX(NW?N[X8N]8N^l N_ N`8N`@(N`Ā?8Nc Nd Nd\@NkPNs(NsNs Nt(NtNt Nu (NuNu Nv((NvNv Nw0(NwNwĀ Nx8(NxNx̀ Ny@(NyNyԀ NzH(NzNz܀ N{P(N{N{ N|X(N}N} N}(N~N~ N~(NN$ N(N N, N(N(N4 N(N0N< N(N8ND(NN؀(NlNx0NN(NT0NtN(N00N<NH(N0NN$(NԀ0NN(N0NN(N(NX0NN(NT(N0NTN`(N0N0N<(N0N N(NȀ(N`N(NP NĀ N8 N@N N4 N NNN  N`0NN(Nl(NN0N, NNNN0NЀ(N N(Np(N\PN(Nh N?NPN\Nh(NN4(NN(NNNN NP NN N, N(NNNNN N,N8NDNP(NN0NT(NÀNÌ(NN0(NNԀ(NdNx(NN(NƬN(NPNd(NN(NȘNȬ(N<NP(N(Nd(NNN0N<NDNPNXN͸N8Nи`NNNN NDN\N|NNNNN(NL NĀ(N,(NN0N(NpN|NNN(NH(N0N0N N((N N< N| NЀN 0N O OpOOOOO(O(O0O8O@ O O(O OOXOt O OOOOO(OHOhOOOO O؀ O@0OO (O @(O 8O  O (O Ѐ(O  O( O0O< O0O OT O O OP O O OL@OHOp OOOO O Ot?8OOOhO"(O#<O#xO(ȀO- (O.$0O/ O/((O/?PO3  O3tO3|8O5`hO7O:d O; (O;0O<؀PO>8OBPODPOE OW OWЀ0OY(O[40O\Oa`(ObhOdX@Oe@OgOnXOnp(Oo<8Opp OpOv؀(Owp@Oyp(Oz?@O|pO8O@OO0(OOOOO8OPO8OppOx(O O$OP@O?8OO0O0OxO(O@0O 0O؀0O0Op0O,0O0OĀ0O8OO0OH(OHO(OİHOP(OOd(O O O@(O O҄0Oߐ OHO(Oh O O$PO0?hOd O䰀(O唀(Ox(O80OP ÒXO(Od O Op?8Ol OĀ0O4P(P P4P<PHPPP\PPPPPP(P PЀ PPPPPP P P  P Ѐ@P Ȁ@P P (P pP@PԀ8PT(PP$P,(PP8PP0PT(P\ P PP Pl(PPPPPP(P tP (P!@P!x(P" P"D(P"P#P#P#(P#@P#HP#TP#`(P#P$,(P$P$(P%P% P& P&P&؀(P'L P( P*P*0P+0P,l0P,0P-d(P.P P. P. P/T P/(P0` P0P08P10P2\(P3P;T P; P;PP?4 P?PP@(PAPHP`PI,`PJ@PMPV@0P[P`XPa Pb(PcPc0@Pd܀(Pe(Pf PgPPg?@Pi0Pk Pk(PkPlT Pl̀(Pm|@Pn܀(PoPoPoĀ Pp(Pq((PrHPt(PupPz܀0P|$XP~HP`(PHxP@0PL?8Pt0P(P P@P P P0P0P@@P| PP0(P(P Pl(P P\8P8P\P8P`?xPL?XP$XP@8P P` P(PPPP P P8(P(PPPPPPP؀(P(PlPt0PpHPԀ Pt(PPP PP P PpP|PPP(P(PPԀ P PPP\Ph P0P(PPD(PPP(PP(PP P4(PȀ(P\(P¤PPPPPP PpPÐ PPP P(P4(PP̀(PXhP4hP`PlPxPDŽ(PpPɐ P(P(P@PЀ(P\0PD0PH(PԀ(P\P,@PԴ0Pp?@Pt@PԀ8PۀPЀ@Pd@P@Pޔ P P0PHPP(PPPP$P`Pt PPP@P?HP8PȀ0Ph0P倀0PPD8P@P P踀(Pꀀ(Px(P,(PԀ(PHxP`PPPȀ0PH PP| PP@P?`Q?Q\Q Q Q pQ `Q|pQHQXQ08QDHQQ'Q,XQ/?hQ1Q10Q2XQ68Q7L@Q80Q9hQ>@Q>PQAH8QB ?@QCLhQE(XQFQFQP$8QPQ\@Q]h(Q^P Q_HQaQa8 Qa?8QcX@Qd(Qd8QfH(Qf(QfHQiXQm00Qm0QnQo8 Qox QoQo0QpP(Qp(Qq4hQsP8QthQwPQxdHQy0Qz QzDQzdPQzԀ Q{ Q{XxQ|xQ|XQ}p(Q}0Q~0Q(Q$ Q Q`QpQ QQ(QQ@Q8Q$HQQQ@PQ̀ Q0 Q Q Q Q QH(QQ0Q40Q܀pQ܀Q 0Q Q0Q QQQQQ4QtQQ0Qx0Q Q,QL QQ@QX0QH0Q<@Q @QX(Q Q QL Q0Q܀(Q8 Q Q(Q Q  Q@Q<QP?@Ql Q܀(Q(Q QLQ`Ql Q(QL Q QT0Q Q0Q\QQ0Ql Q Q  Q\(Q QL8Q8Q QQ Qt QHQ,8Q8Q Q, T>8T?Ȁ0TA8TCTC4(TDp@TF܀`TITIH(TI(TJ(TK TK00TL TLH TLhTM4 TM̀8TOTO TO TP00TQp8TS\(TS؀(TTTTTh TU(TUTU(TVTVTVTWt(TX (TXtTXTYLTYT[tT]<T_Tah`Ts܀8Tu4T?HT@T(TЀ(T@ThTT(THPTT0T(T<(TЀ@TԀ@TDTX"T(T((T TLjHTȨ?HT (THT̤ TPTPTT8XT⸀T̀hT눀0T TT(T@THTPTXT`ThTpTxTTTTT0T0TH0T0T0TD0T0Tl@TL(T(TTT@0T8TT 8T0T @T T<0TTT0TԀ T08TTTЀ(U@UU U U$XUX(U0U8UH U U U ,U HU dU U  U HU dHUlU(UU ?HU U@(U U\Ux@Ul U\?PU(UUU00U HU U HU"d0U#@U$(U%$ U% U%(U&h(U&8U'xU+P(U+(U,\8U-t U-8U/0U/(U0U0@U2U2 U3D@U4@U5U5U6(U68U7xXU> 0U?T UA( UA@UM `U`?@Uc UcH(Ud(Ud`UeUe(Ufh Uf Ug Ug UgԀ0UhP(Uh?`Uk(Uk?HUl܀?HUmЀ0Un(UoT Uo(Upp(Up(Uqd(Ur 0Us (UsUs0Ut0UuT(Uù(UvDUvp(Uv Uw0 Uw8Ux@?XUy܀ Uz(? U|(U}TpU(U`U U0U@UpU0U0@UPUxUUHULUX8U,HU(Ud`UhUP0UUU0U8U`(U(U,pUU@UЀ0U$0UԌ@UHXU XUԀ@UЀ@U߈0UԀ(UЀ0UЀ UXUU U UXUU(U(U, UUU4?8UlU@U< UhUxU0U4U|UPUĀ8U8XUUԀPUXUXU|XUlXV\(VVXV HV8V@V8V VLVpVVV0VVV VVV V,V@VdVHVHVPHVȀ V`XV@V?HV" V"xV* V+X@V-l@V.(V/HV1V2V2V2V2<PV28V3|0V4X@V6  V6V7VA(VC@8VDЀ@VG@8VH|0VI0VI@VK`VOPVQ@VR@VT@XVVVY8V\\?8V` Va(Vb Vc4 Vd HVe(Vg?HVk\?XVnHVq4VuPV~ ?@VxxV?@V hV ?8V<VH`VhV؀`V8VXV Vt VV|8Vl(V0(V(V$V@0VV؀8V\ V V VD VPV`0V0V?V?HVĀHV@V0VXVpHVt(V0VdhV<pVVܔ(V\(V`(VԀ0V߀(VĀ(VD(V܀(Vt(V 0VV V,@VVt`VV@V대?8V섀`Vd0VHVHHVp`V0VȀ(V0V (V`pW\@W W@8W8WLHW HW HW Wl@W?hWW@WP WXW"Ȁ(W$(W%(W&0W&(W'Ā(W(l(W(Ȁ8W)(W*(W+D0W,((W-0W.HXW0x8W10W2(W3d(W40W5$8W5@W7 XW;8W>d(W?(XWAX(WA؀0WBxWBWBWBWB8WDL@WEWEWEWEWEWF@WG8(WH(WH8WI8PWK`WOL8WPt0WQ(WRp@WUĀ@WWthWYt8WZ0W[ W[ W\@W]?PW_0HWa88Wc0Wd8We\`Wl,`WrPWrWr8Ws@Wth WtЀ(WuT@Wv Wv(Ww@WwȀ Wx0(WxWx8Wyh8Wz0WzLWzTWzt8W{?HW|0@W}H0W~$W~X0W(8WȀPWD(WЀ8W|@WPW0WPW0WPW0W|(W@W?HW(WW8W88WW(8W?HWpPWHWȀ WD?PWHW W(HW WhHW W0W\0W0WĀ8WhW(W@8WD`WH(W W8W`W?HWWLPWWh`WhW,?HWt@WHW0(W8W@ WǴ0WȐWȘ8WD8WPWx?PWx0Ẁ@WHW W$(WԬ0W`8W(8W@W`W0@WĀ8Wܸ WЀ@W0WĀ@Wx8W8W㐀8W䨀0WX8W8Ẁ`W?PW가?PW`?PW?PW  W8@WHW<HWHW?PWPWpHXL0X܀0Xt0X0XHX4hX(?hX hX ?PXHX?`X0`Xh@X0X?`X!(X"\(X"Ѐ@X# X$H(X$̀8X%h(X%8X&@X' X(`X)Ԁ`X+?PX-|?HX/XX1?HX2?PX40?PX5@X7 X8p@X9 X:؀0X;0X<@XT@X?P?HX@t XA8XA؀ XB(XC8XC@XD@XE@XFHXH4 XI0XIȀ0XJl@XK8XL8XM@(XMĀ0XN8XOP8XPLHXR0XSXS0XU48XU8XV܀0XW(XW8XX@XY@X[@X[?HX]l0X^<0X_ 8X_Ԁ@X`@Xb @Xc0XcXc8Xd8Xe?PXgȀpXj܀hXl4?PXm؀?PXo| XpHXqHXsD?PXtHXv Xw8XxXXy`@Xz,XzX@X{h X|HX}XX~@X8X@X@XX|@X X0X`X؀XXD X?hXHX$(X(X4(X(X(0X,(X(X$(X8XL(XЀ8XĀ@X@0X(X\(X8XPXPxX(X8XD@X8X@X@X@@XxX|pXЀ@X?PX?PXhXXĀXHX@X@XpHX0 XP0XxXXX XРpX XՐX՘ XX 0XX؀8Xt@XXX`?PX Xڨ8X۴0XH0X@X8XX8X(Xༀ(X`0X@0X㴀(XX0X帀0Xh(X0Xx?8Xp?`XX가0X HX@HXl0XP8XL8X8XP?@X8XXXXXXXXXXXXXXXX0XP@X(X((Xp(XL`X\8Xh(X|XXȀ(XXXtY?@Y $Y؀(Y? YĀ?8Y8Y(Yh(YpYl@Y"Y$Y'd#YSYXh YYYYȀ0YZ(Y[0Y\(Y](Y^x(Y_$PYbpYhHPYkYk0(Yl ?hYnXYqx8Yrx(Ys؀8YtXYx`PY{PY~PỲ(Yt?Y(YPY<@YPPYHYHY?@Y(Yh@Y((Y؀(Y(Y(PYXYLPYPPYT0YL8Y܀@Y\YP(YPY0(YY(YXỲ8Y8Yl8Y<8Y (Y@Y0@Y(Y@0YĠ@Yǐ0Yl0Y(@Y(YYYY00Y8Y͜`YѬ(Y҄@Y@Yմ@YD@YYhYHY߄@Yሀ?@Y 8Y8Y8Y?XYYY Y,Y@(Y Y@(YĀ`Y4(Y`Y(PY(Y@Y@Yt@Y@YH@Y@Y0Y0YLYh@Y@Y@(Y Y YT8Y?HZ(Z0Zl8Z0Z8Z`8Z 0Z8ZT(Z0ZXZt Z̀0Z@Z <0Z @Z T8ZHZ8Z?HZ@(Z0Z8Z0Z8 ZZ(Z (Z@Z@Zd(Z?HZȀPZd@Z?PZ?HZ"PZ$?HZ'?PZ)T?HZ+dPZ-?HZ/PZ0(Z1 Z1<Z1X@Z2p@Z3,@Z4D@Z5@Z6@Z6Ԁ@Z7@Z8@Z9@Z:|@Z;@Z@Z>̀@Z?@Z@@ZAĀ8ZB@ZC@ZDT@ZEl@ZF0(ZF0ZKZL0ZNZOH0ZPPZU80ZU8ZW@ZX?@ZZ܀XZ[HZ]hZ`ZbLhZe(ZeZhXhZklhZn0 hZqhZtZ|(Z}X?@ZpZZZhHZZЀ8Z ZZ,ZlZxZZZZ ZZZZZZZ$ZHZlZZZZ Z`8ZxZdZZ ZZ4ZPHZZ 0Z@0ZXHZPZ|(Z(ZZZZ0ZZZZƌ0Z40Z܀?XZZZZ0Z,(ZxZZ(ZPZՐ(Z?@Z<(Z0(Z$Z`Z۴Z Zl0ZZPZZ대?Z\ZЀ(Z?8ZZĀZZX0ZZ @Z0Z ZH[Ѐ?8[[X[?@[ ?@[ ,P[ [X [ [ [([ [8 [Ā [0 [̀ [D0[8[Ѐ8[@[@[@[l@[X8[ 0[" 0[#t0[$܀0[&D0['?H[)X0[+@@[,H[.0[0L0[10[3,8[48[6?@[88[; [;<@[=TH[??@[At?@[CH@[E8[F?@[IH[KP?@[M00[MĀ [NP[Q<H[S؀@[U`H[W`0[XT([Y0?H[[@[]@[`L8[b<8[cl([dT 8[kH[nx[n?@[p4?@[q0[r0[sH[u([v[wH([x8[y[y8[z([{([|?@[~0[0[@0[h8[[H[?P[?H[0[Ԁ [PP[t[Ѐ?H[(8[| [h [[8[؀0[Ȁ?8[Ā0[Ѐ@[ [< [?@[@[$?p[([܀0[0[@[8[@[`@[Ѐ@[ [$@[00[L[,[L[l?@[p@[м@[(@[Ӕ@[8[̀P[ـ@[ۈ@[ݐP[P[0[4H[l[倀 [H[X@[錀@[d0[[쨀([0H[̀?p[t[̀8\?P\\ 4\ (\ H\?P\X?P\(\(\(\(\D(\(\t0\X(\8\ D(\! (\!(\"`(\#(\#?h\$(\%pH\(8`\(Ȁ?@\*P\+0h\,8\.P(\.@\1H0\2p\2x(\3 \4H(\5d?H\:@\:P@\< \< \=<\=D \=\=\=\=(\>\(\?$(\? \@, \@p \@ \@ \A4\A@H\C0\Dx\FT\H(\I?8\Kl\M(\NT(\N\P0\R,0\S8\T0\U?H\X0@\Ỳ@\[|@\],@\^܀8\_h(\_܀8\b(0\dH\g@\iP\lx?H\nLP\p@\rp\yX\}H\(P\@\(\ \,(\(\Ȁ(\(\x(\8\T(\P\?H\L\h0\8\<0\?8\(\?H\Ԁ0\8\8\\8\(\(\` \(\\(\(\8\D(\ \x8\ \\\ X\Ŵ?8\Ɯ\@\LH\<(\D0\΀8\t0\ѴP\ՌH\ԀH\޴(\߀ \T?P\\xH\$\0\ \0(\P\p8\\0\ ?@\4@\(\|@\P\ \`\(\0\?@]Ѐ8]̀H],0]8] (] 8] (] x(] \0] ?@]d@]p0]l8]8]8]8]p@]0] (]?@]X8]|0]h?@] ] ] ]!]!(]!\]!x]!]!]"]"`(]#(]#]$ ]$\ ]$(]%d(]& ]&?8]'P])4])P(])܀ ]* ]*`]*h]*|]*]*(]+4(]+(],0]-Ѐ0].@]1l(]2 (]28]60]7l0]8]8]8]8 ]90]9L]9]9]9]:]:<(]:|0];t0]]> ]>(]>0 ]> ]> ]?P0]@d(]AL]Al]A]A ]B@]BH]BP]Bx0]B]C(]C]C]C]C؀(]D ]D ]E@ ]E]E]E]E]E]E]E]E]E]F]F]F]F88]G?P]J?8]K0]M0]N|]N(]OĀ(]PD(]P̀(]Q]Q]Q]Q(]Rx ]R̀ ]S8 ]S]S]S0]T(]U ]U(]U0]UX ]UЀ ]V$ ]Vx ]W ]W]W]W]W8]Y(]YȀ ]Z$]ZL0]Z0]\8]^]^]^8]`|]`(]a]a ]b ]bD0]d@]d`]d|]d ]d0]h,0]hԀ(]i,]i\8]j]j0]k0]lL?@]n (]ǹ(]o8]q$(]qȀ(]rD(]rĀ?8]s(]t ]u]u]u ]uH(]u]u]u]u]v(]w$0]w0]xP]x]x]x ]yx]y]y]z]z|]z ]z]{]{4]{P ]{]{]| ]||]|]|]|̀@]}]}]~, ]~@] ]` ]] ]L]] ]H ]]]]p]] ]h]]]]l]]P]]]< ](]]]]]] (]]]]0](]Ѐ0]0](]0] ]8]L(]  ]]@0]0]Ԁ(]8]]]]]]],(]]]< ]Ȁ ]H]0]8]@]L0]] ]T0](]]0]l]]]]]]]$]8(]0]] ]40]] (]]]p]Ѐ0](]]] ]H@]d(]D0]h?8](](](]8]L(]]]]](](]((]Ȁ(]h(]?8]p?8]ô(]T0]0](]ư0]\0]l(] 0]ɸ?8]@]t0](],]H(]Μ]θ]]X]ѐ8](]Ԥ]`]P]ـ]و]ِ ]]8 ]ڜ0]ۤ(]܈(]4]T]p]x]݀]݈]ݐ ] ]$],]4]` ]޸]](]ߘ0]d0]]Ȁ8]㤀(] ]`(]0]Ȁ(]]<]`]縀(]谀(]\]]餀(]D]Ѐ0]h]@8] ]t]|]]]0]x0]`]8]] ]0]4]<]P(](]0]p^^?8^̀(^^0^@ ^0^^^^Ā@^p^ ^ 0 ^ ^@`^؀^t0^H8^0^(^`^d0^^ x^D^^0^p8^@^ԀH^0^܀@^8^Ȁ?P^ (^ 0^!L@^" ^"(^"0^"@0^#^%^%^%(^'4^'^((^)0^*@^,D0^.0X^40^58^7?@^94P^;(^<؀0^=0^>00^>^B^G^G@^K0^LH^O`^R0^S\@^T^U ^UH^Upp^Vt ^VP^W8^X(x^[| ^[Ѐ ^\,^\P ^\ ^\(^]< ^] ^]Ѐ(^^T0^`(^a(^cX(^c(^d(^e^e(^gp(^hH^y@^zp^z(^{(^{\ ^{^|(^|(^}x0^~h^~(^ ^p(^(^̀(^?8^ЀP^^00^^ ^@^Ԁ8^8^ ^Ԁ(^0^,^H(^؀ ^4^P@^`0^P8^Ѐ(^(^D^`^|^^^^ ^ ^d ^ ^ (^(^(^^ ^^D^t^^ ^ @^^^ ^<^X^^^^(^D^`H^|(^Ԁ(^,0^?8^lP^$^@(^(^(^l^^Ԁ ^0 ^^(^<^\ ^^^^^4^P^l8^؀ ^$ ^4^@^L^X^d^p^|^ ^Ԁ ^?@^^^^d^?@^T^`^|^^8^p(^Ԁ0^P(^0^0(^0^P^l^x^^0^^^^^,^H8^^4^P^l^0^0^x0^l^(^`(^(^P^(^0^L^h0^^4^P^l8^(^\8^|(^Ԁ(^,^x^Ɣ^Ơ^Ƽ?@^ǐ0^t8^<0^0^ʤ^^ H^ˤ ^ ^d ^^(^̀^ ^< ^ά^^< ^x^Ϙ(^4(^0^^(^Ҡ ^(^Ө(^X(^ ?8^\^^0^ب^܀ ^p^ٌ^٨^^^^^$(^ڴ ^^P^l^ې^ۨ ^^ (^ܸ^ ^݀^ݠ(^8^l ^^ (^߸^ ^^ࠀ(^8^@^᐀ ^ ^x^─0^8^l ^^ (^^ ^^堀(^8^@^搀 ^ ^x^甀0^8^l ^^ (^^ ^^ꠀ(^8^@^됀 ^ ^x^씀0^8^l ^^ (^^ ^^(^8^l ^(^ ^^4(^ ^(^Ȁ0^l^(^ ^t^(^D0^^(^ ^ ^8(^0^^(^< ^ ^(^0^P^l(^ ^X ^(^T0^^(^ _ _`(_0__Ԁ(_d _ _4(_0__(_8 ___̀ __ H_8_ _ _ _ _ D_ t_ _ _ _ _ X`_ t(_ _ _ @_ l _ Ȁ _h_X_x_(_ _T _?@_8_Ԁ8_x(__ _<8_0_p?8_`_d_(_,(_܀(___(_?@_ 88_!8_"$(_"_"_"8_$,0_%?8_&l`_(_(,(_(؀(_)(_*X_*x_*_*_*(_+_,_,4_,@_,L_,\_,x0_-0_-?8_/DX_0_0(_1l(_2(_2_20_3_3?8_4(_58(_5 _5_6$_6P_6_60_80_8?8_:D_;_<(_<Ā(_=t(_>D_>`(_?(_@ _@L_@h _@̀ _A0(_A؀8_B(_CL_Cl_C_C0_DԀ0_EĀ?8_G_H_I(_I(_J\(_K,_KL_Kh(_L@_L\_L8_M\0_NT_Nh_N0_O?8_PЀX_RD_R`(_S (_S(_T_T_T _U0_U؀ _V,(_V0_W_W,_WH8_Xp_X _X_Y (_Y _ZH_[Ԁ8_\8_]4_]` _]_]_^ _^`_^l_^_^_^_^܀(_` _a b?(b?Ȁ0b@ b@(bA bAЀ(bBp bB(bDbD\(bD؀(bF?8bG bH$(bH܀0bI bJ (bJ bJ(bK bK bL<@bM@bMbM0bNxbN(bObO00bP bPD bPbPԀ0bQdbQlbQtbQ| bQbQbQbQ bR8bRXbRtbR@bT\ bTbT؀(bU@bU\(bUbUbUbUbUbVbV bVbV(bV4PbXp0bYbY0(bY bY(bZPbZ\bZd(bZ(b[\b[xb[b[b[b[b[(b\(Hb\b](b] b]b](b^b^(b_t(b`Ā ba@(baԀ bb$(bb(bdH?8bf(bf؀0bg bh0bh bhԀ(bit bibi(bjdbjp bjbjbjbj bk8bkX(bk܀ bl,blHblhblt blbl̀ bmbm8 bmbm bnbn bn<bnDbnPbn\(bo(bo(bp`0bp bqH(brbr(bs(bt?8bvЀ bwT(bx<0by byl(bz bzD(bz b{hb{tb{|b{b{ b{؀ b| b|<b|Xb|tb|b|b|b|b|b|b| b}| b} b~ b~L b~(b~ bDb`b|bbb0b,0bL b(b(b b, b(bbbbbbb, bpbb bb  bPbl@bbb$b0b8bDbP bbbbbbbb(b4bL(b̀(bLbT bbbb(bTbh b(b8bLb` bbb0b8b0b b b`?8bpbbbbb b b<bDb`b| bbbbb0bLbhbbbbbbb,b@b\bdbb bbbb4bPblbbbbbbb00b̀(bLbl bbЀ0bpb bbb0bbb(b0(b0b`0b0b0b0(b(b(b< bb0bLbh bbb b\bxbbbbbb b<bXbtbbbpb(bD(b(bb(b (bbPb8bt@bb b$(bPb4 bxb?8b0b b܀(bbԀHbb40bl?Hb Pb(@bP8bT bb8bb bDbЀb$0bD8b`0b̈?hbl?bHbȀbӜ b؀(bԠ@b pbX8bĀ@bܐ b0b\@bĀ bb(0b(b|(bpbbb(b退(b(b(b묀(bbbbbbh bĀ b b| bbp@bpb|bbb b؀ b b\bxbbbbbb b<bXbtbb(bb(bt(bЀ bbb b0b<0b,b4(b bp0b8(b(c(cD(c(c(c0c4PccX(cl?8c (c T c X?XcH0cLcXcdcpc|c(c(c8c8cccccxccc0c8c(cl@cc0c4c\(c@c @c!c!c"c"8c"`c"0c#Pc$ c$8c%8c&@c($Hc)Hc*Hc,hc.Tc.c/c0 c0Hc0hc2?8c6c6c6c6c7 c7c7c7Hc8c8c8c9c9( c9p(c: c;H c;c;c>d?c@PcF@cJ4cJT cJ cKD cK0cL(cMcM4cMT0cNhcPcPcPcQcQlcQt(cQԀ cR( cR|cRcRЀcTDcTlcT?cVcW cW,0cXxcXcXcXcXcX(cY@(cYc\`(c\(c]c](c]d(c](c^ 0c^Xc`\c`dXcaXca`catcacaPccPce88cfL8cg`?Hch`Pcicicjcjcj8cjTcjpcj(cjck ckd(cl$(clcl cm8cmTcmpcm(cn(cnDcn`cn|cncncncncoco$co@co\coxco@cocpcp4cpPcplcpcpcpcp܀(cqxcqcqcqcqcqcr(crdcrxcrcrcrcrcrcr(cs(ctXct`ctl(cuH(cu؀0cvĀ(cw(cx|(cy@cyTcy0cz(czlczcz܀(c{h c{ c|0(c|(c~0c~(c?8cЀ cT(c<0c cl(c (c(c(cHc cc4 c0c4cPcccXctcccc0cLchcccccc c<cX ccccc c(cDc`c|cccc cP ccc(c0c c0c(c@(c0c(cd c(c(c`clcccc8(c0cc(c c(c(c\(c?8c`cc4(c cPhc@ c@c(cP(c (c`c@@cHc`cXcc<c0cXch(c4(c(cd8c 8c c  cH0c` c8cԀ8cDc  chcp0c@c`c̀(c(cЀ c(cΜ(cl0c\?8cѬcdcӀ(c cp(c(cc0c֌ c (cטc8cڬccԀ(cۤ0cܔcܰ cD(cݬ(cD cސ(cD0c?8c8pcc (c㜀 c(c䤀(cT c圀@c(c\c(cꔀc먀cTc|?xc0c(c\ cccccc,cDc`0c̀ cHc(cD0cccccc c`Xc 0cc c c 0cc(c`(cЀ0clc(c@ c?Hcc(dPdp(d(dHd0dT d̀0d0d0 dXdh`d (d d 0d ,0d (d 0d 0d(dD@d`pd d d(dd(dd?hddd8d d!@d!pd#0?d%d)\ d*Pxd0@d0l8d2,@d4?Xd7ԀPd9|0d:T d:(d;d?d=pd?d@?XdDdIL(dIȀdM0dNdQl(dRxdShdWthd[$d]`d_dgX?dl<8ds8du$ dud0dvdvdyp dzt`d{`d}?hd`d(dd8d܀Hd<dd4$dtpdȀ@dddd ?d$d|d8 dx?Xd?pddhHd4Hg?L g@0@g@8gA`PgBgBȀ0gC8gDDgD|gD@gF8gFtgFXgKgKgLgL$gL0gLHgL gM gM(gNT gNgOD gO(gP(gQh gR(gR gS(gT(gV(gW|0gXD gX(gY0 gY gZT(g[ g[ g\L g\Ԁ g]p0g^8 g^Ԁ g_p g_(g`܀ gad gb gb(gcP0gdp(ge<(gf(gfԀHgh(gi gj(gj؀0gk؀?Hgm|(gn$ gn@gp` gp@gqhgsp@gt gu gu gvH(gv(gw(gxdgxgyDgygz$gzg{ g{g|<g|g}Xgp8g` g gHXgd0g\g0gȀg g|gg g4g(gg(gHgg?g$g(ggg` gЀ g@ gȀ(gP(g0g0g0gԀ g g0g ggggxglgxgxg`gHg0(gggԀggggtg\gDg g,(g8gĀ@gD@g@g@g4HgĜgHg<(g g,hgɔ?hgpgxgˀgˈgː(gHg̀(gpg gLgϤ gмggggg gըg PgHg (g4g蜀Pg ggggg,gLglg쌀@ggDggggt@gHgXg0(gg0g0gpgx?xhHhphh hȀ0h\ hhԀh Dh dh  h 0h Lh h h h h 0h LhDh$hh$h@h\hx8hT@h(h0hȀ hX8h hЀhh hh0hh4 hh00h $(h h ̀ h!@Ph"  h"h"0h$t h%<(h&\8h( 0h)h)Ԁ h*Hh*h*?Hh- h-Ph.@h08h2T?h64(h6Ȁ@h7l@h8D(h8hFHhG(8hG8hH, hHhHhH܀0hI0hJhJhK?hLHPhSЀ8hT@hUXhk`hkhkhk؀(hl0hm?8hnȀXho؀Xhp(hr hs hs hs htl(huԀ hvT(hw((hw0hxȀ hy$(hy(hz\(hz(h{h{h|8(h|Ԁ(h}p(h~ 0h~h (hh(h(hphhhhhhHhhh0h`h|xh(hThx hЀ(h(hh8h8hX0h(hhh(hDphhh$ hp h0h$hp0h0hL0hh?hL h h`8hЀ?8h0hl@hhhh@hΌ@h(0h 0h(hp0h(h֘hXhh䠀xh紀(hXh0(hhh`(h hL0h8hXh`i8i8`i@0i(i(i l@ihiii*pi* i+(i,$0i-D(i.,i.Txi5lpi7P(i7Ѐ0i80i9i9 i:X i: i; i;l i;Ѐ i<8 i<i= (i=?Hi? (i?L(i?8i@ (iA0`iExiE(iFdHiH08iJ`iO iO\iOiOiP iPiPiP@iRЀ0iSiTxiW iX`piYi\ i`p(ia(iaiaibDibpibibib8ieHig܀8iiin iot(ip Hir@iu iv8ivLivxiviviw iw4iw@iw`8izd iz i{ i{i{ i|i|i| i}L i} i} i~`(i~̀(it(i((i(i4(i(i$@iiЀ(il i؀ i<(i<i\(iĀ0i<0i8i@iԀ(iPitii i((ii, i(i؀(iPiXHii(ii8 ii?i iii iH8i`i i 0i i`(i i (i i(i| i܀ i(iiL?i͠iiii ii?`i0ip i i ix(i@iĀ i iL ii?8id(ili攀0i爀?Hii48i$iDip@i<0i0i숀Pi0i(i,(iȀ?HiT8i0i8iHii(iD0i?8j(HjȀ@jp(j0j4?Hj 0j 8j Ȁ j 8@j `j?HjD0jЀ0jT0jT@jjjL(j(j(j@ jj0j0jj(jlj(j0j j  j!8@j"0j"(j#(j#H0j$?Hj'80j((j)D0j*8j*X0j+L(j+(j,(0j,Ѐ@j/Xj7(j8(j9 j9|j98j;T0j;8j=$j=Dj=d(j=Pj?xj?(j@4(j@Ѐ jA, jA jB jBXjBx jB(jCxjC(jC0jDdjE4hjIHjUX jU jV(jW@8jX?HjY(Pj[H?@j\?@j]j](j^ j^`jd 0je00je0jfjp,?`jrPjy`j0j,XjdXj8j@jtjjЀ(j8j@j`0j8j(j(j0jT j jj<jXjt0jdjjj<jjjjԀ jpHj8j8jj(hjj08j(jhhj j\?pj8j j(j$(j@j(jP0j(j8j @j@8jp@j0(jj̀PjPjjj$(jÔ8j8jl(j0j 8jɘj͔jĀ8j` j0jь0jҀ8j0jt j jD0jxPj0j@j88jj؀0j j(j\?@j40j@j?`kkl`k(k (k 8(k (k l0k `kxkkP?khXkD khk$0k%@pk-``k5(Hk70k8`8k:lk: k;8k<8k>PPkDPkEkEԀkM0kN0kO kP8kS kT$@kWkW8Xk[؀kdHHkfHkfhkf kf kg`kgkgkg(khkhki (kikjkjTkjkjkkkk\kkkk kr(8kskt(kw0 kw8kx,0ky<k{k{k{k| k||k}Lk?Pkk(k(k8kL0k4k0k$8k` k klkHk@k\(k(k(k@k`kkHk?kt k̀(kT0k((k(kHkx0k\?hk|8kpk8k|@kl kk `kk8(kkkdk°(kDkl(kk(klkĸ(kL(kk,kTk|kƤkk k@kt(kH0kdkɜkԀ(k@@kԀ@kh@kk,kLklkτ@kӴ(k@kHkԼ@kd kЀkְ(kk(kt kk kh(kȀ k kߘkߴ8kX kᴀ kL k⤀ k kX kk`k攀(k(k00k谀@kL?8ktk|k$kP k k k@ k k k0 k k k@mAHmEXmFp(mGmU`mXH`mY\(mYXmZD(mZ(m[,m[\(m[(m\|m\(m] (m]m]m^m^m^dm^xm^ m^m^m_ m_Tm_m_ m_m`t0ma<0mb8(mb mb?Hmd me88mh0mj40ml,0mn@mtHmzDPm?Hm?Hm\8m@m8@mԀ8mp@m?Hm8mm m$0m0m@m(m?Hm|?Hmmm m@m@(m0m(Hm,(mpm8mPm(m?8ml?@m mLm mX(mä8mŔ?mȤm  mx(mĀ@mhhmL0mμ?hm҄m8mpmHmtm8xm̀ mD8m$0m,0m m8m0m(mЀ mL8m88m|0mp(m,xmP(mn?nn4nT(nn n4nl(n 4 n ܀`n (n L(n (n @n (n(nn(ǹ0np0n0n(n@8n8nn0n4nxn"@n%(n&Ā n'0n'n(Pn*(n+0n-(n.(n/0n/8n1?@n2n3 (n3(n40n6(n80n9n: 0n;?@nhn>n>(n?(n@(nA(nC$(nDP(nE|(nF(nH(nI(nJ(nK(nL4(nM8(nNT(nOX(nPt(nQ(nR(nVnWPnWԀ(nX(nYd(nZnZ(n[n\(n]p(n^d(n_@n`̀@na(nbp?nePnene(nf(ng8ng\ngnh0nhTnhnhni, ninininj(njh(nk4nkt(nl@ nl8nm؀@np̀8nrnunwnwnz(n{$ n{Hn~|n~n~Ā nhnDn,nXnH0n\(nԀ nh(nĀ(nh8nXn@nHn@ntnXn|0n 0nTn\(n?8nHn 0n(nt0n0?8ntn(nn@n؀(n(n(nX@npnn(nԀ(n(n(n(ntn”n´(nøn0n$(nƘǹ?8nnn(nTHnϤ(n@nX0n n0nP nՔnմ@nؼ0nxnڜnڼxn n,nL@nT0n nHnhn@n,nL@n8n?8n(n0(nȀ(n4HnHnH0n` nԀ oo$ o o(o(ò(o| o0o0o܀oH(o(o0o \ o (o (o (o 0o 0o (o(o((o o(oP(oHo o o, o0o8oԀ0oȀ oP0ox(o(oHo o(o0o(o o (o (o!D o!؀(o"0o#Ԁ(o$Ā o%<0o&d o&(o'0o((o) o*Xho+8o,Ā@o/o/o0 o0o1H(o1܀(o2p o2Ȁ o3 (o3Ԁ(o4o4o4o4o40o50o7P8o900o90o;0o;0o<0o=8o@0o@\o@0oBXoC$oCoDx0oEToEoEoF$oF0oGoH0oH0oJP0oK$oK?8oM(oNoNoO$oO8oP40oQ(oRoR8oSoS0oV(oVoW0oX(oYloYoZ8oZo[ ?8o\(o]0po^0o_Lob,?@oc8odh od؀ oe<oeXohxojP(oohooooop0 op8or (ororos@ot\?pouT?Pov?Xozozozo{0Xo|o|$ o|` o}to} o~Xo,op?o4o`(o` oo opoooLoo0o(ooo@o oH0oToȀ@oH?o(ohoh(oo$o ?8oopohoo< o(o8o ohhoX0o¸?`oŸ(o88oxoP(oHo`oˀo˘o˸oo olǫ oo,xopo4(o ?8o@ o`o؀(o oټo\ o8o\o((o8o?HoppЀPpp ppp p ?p xp ?pԀppp4 pp p ppp p4pT pppppHpp p(ppppp  p \p |p p p  p!,p!xp!p"p"lp$@p%p%p%܀ p&$p&Dp&dp&p*p+hp+ p+p,8p,p.p.p.p/p/4p/Tp/tp/p/p04 p2(p3@(p3(p44(p4(p50(p5(p6(p6(p6(p7`(p7p7p7p8p80p8P p8p8p8p9?p;lp<p< p=(p=p=p>,`pB`pB0pC`0pD?@pEЀppH̀(pI܀(pJ?hpNx?ppY,hpfpjT?plĀpnp}p} p~@0p 0p?@p p?hp|hppp,p$ p p, pPp$8pDXpXp0pLphpp0p0p8p܀0p8p08p?ppp0ppppd0p8p8pHppĜ(p(pŀ0pƠ0pp(pdpȄPp|(pp(p`0p̔0pԀ0ppxph0p`0pptXp`p܈p޴pߜpĀ0pԀ(ph(p$p@pH p(pp؀(pppp<p| pԀ pPpx0p蘀p0ppp`pt(ppHpp0p88p0(p(p, px p0pppp@pppȀ(p(pP(p(p(p4(p(pp(pPpp$pT?Xqq0q<qHqTq`qp(q܀qxqqq؀ qtq(qHqq (q 8q ̀(q Ȁ(qԀ0q(qЀ0q(qq(q0q0qL(q0q (q ؀(q!(q"x0q#q# q$,q$Hq(Pq(xq(q(q(q)q)@q)h q)0q*Ѐ q+H0q-q-0q-Lq-T(q. q.x q/ 0q/(q08q2X(q38 q3t q3Ȁ q4\8q5p8q60q6q6q7(q7hq7q7Xq:Ѐ0q;(q<0q=d(q>$(q>؀(q?|(q@<0qA,0qBqD,8qEqF0qH qI(qJ\ qJ܀qYqYqYqZqZ@qZhqZqZqZq[q[0q[Xq[q[q[q[q\ q\H0q]x(q^@8q_(q_q_(q`x(qa(qa qb, qbx qb؀8qdHqd\qdqe qepqeqfqfD(qg (qgȀ0qh qh qiD qi8qk4Pqlh(qm8qo0qol@qqqsԀ@qtqt quHquxqwt?@qz(qzhq0q$q@qhqqqq0q܀(ql0q?8qԀ0q0q\0q0q@q8qXqqqhq0`q4(qL q(qt(q qx q܀ q@ q q(q q q q(qqqqHql q q|@q@q`qqqq(q\(q(q,(ql0q0q?q̀xqxhq?q@qPqq@qh8q q8q$q@qXq?8q q8 qq00qh`q0q0q̀0qLPqĀ q|(qXxqq HqpXqPqِXqqHXqqqq8qXqxqܘqܸqqXqpqޤ@qqqqLqqDqqDqq0qȀ(qq,q`q攀(q (qq뤀(q qL(q?8q$?qlqq?8q(q0@qqTq qq0q`0q0q܀0qrl@r r0r`r r< r rr(rr$0r @0r r @r `r 0r $8r 8 r 0r 8r(r?@r8r0r r8r0?8rHHr8r0?8r$0rrprȀ0r 0r!`r"r"r"0r#r$r$Dr$Lr$lr$r$ r%< r%(r&P r&r'0r( 0r)8r+p0r,̀?8r-Ԁ8r/Dr/`0r0 r0lr0r14(r1r1r2r2T(r2(r3l r3r4(r4r4r5(r5pr9T(r:x?8r;?8r=$Pr@\r@|r@0rB rFrFrFrFrGrG$8rK@ rK(rLHrMl@rOPrOprOrO0rQp(rR0rUt@rW(rX܀(rY(r[(r\X(r]0r](r^܀ r_\ro`rp(rsxrtpr{Phr~hrr8rr0rXrx?hr0rr (r(r؀?8rh8r r8Xr@ rɸ8r|Xr 0r܀?8r\?8r؀`rTr?0rlr؀prڴr?@rxr rX8r@r`0rP0rr `rhrsԀ0sXs?`ss4Xs`s`s dxs`sp?`s܀(s4Hs8`sĀps0s*̀ps.`s10ps8XsTds_tsb(sclsk0?hsn8suxs}0psxssX@s0 s0ss\ssl0s(0s0sxs,8sshss܀0s0(ss0ss(s(s̀0s0(sԀ s,sL@s@sЀ(sȬs s挀0s@s|?Hs8s(s(s؀(s0s`(sDstX8t,Ht(0tHtt4t!T`t#\t((t) tA?htC4tF pt[p8t]P?Xt_$Ht`X@ta((ta`tc?@tc tdLXteXtg(titti(tjtj0tl$0tm(tn0ts(tsPt{@t~p?tt0t(t0ttĀPt t4(t @t0t0tD(t؀(tl8tPt\`tXt<(t(tĀ8t?8t(t؀0t?htXt\tD t ht (tϤ8t`0t,XtȀPtDHtxXt̀8t?pttt`0ttttHt0`tЀ0tLhttpu|8uP`u?`u uЀu0uЀ0uù0uu#(u%l0u&(0u'@(u(@ u(̀8u*@u*`8u+0`u,xu.Ȁu0?u2u5 (u8u:Ȁu=Xu>Ȁ`uAuDXuFȀ(uH܀XuMuR$?`uUHuVxuZ40u[0u]P`udtHuiЀ ujduj?@ul(un0 uo0uoHuqH@ur@ut@?huw(uy uyd uyXu|(u}@u}`8u~uu4uT8u8Puu u u uL(u|(u 0uxu u u\?@uH0u8uu(u$uD@u,8u8@up(u(uȀ`uhuu0uԀ(ut(u(ut(u(ut(u(u0u(uH0u(u,0u0 u u u u ux u u` u؀ uL u u4 u u u u u| u ul(u$(uD u u0u?pu  u(ut0ud0uH(u8u0uĀ0u@ u´ u, uä u0uŬ(ù(uPud(u,uP0u܀?@uԔ(u(uմ0u(u|(u?`u@(u0u؀0u(u਀(u(u☀(uTXu退 u@uXHu`uXuPuh(u$up(u(u(uHu@u`8u8u8u u@uXupu8vv@v  v ?v Hv'\8v)v)v*v* v*@v*`v*v*v*Pv.P0v/(v0h(v10v3@v5?8v7Xv7x?8v8@0wAȀ(wB0wBPwBpwB wDL@wFwH@(wI\PwMwNtwT|wVwW?PwYxw\4?Pw]?Pw^wawbȀ wc( wd`@we@wfxwidwn|0wǹ0wo 0wotwsԀwtĀ8wuww|?hwyHwyhwy(wzw{lw|tw|@w~؀@ww?Pw4 Pw<w4?pwww(?wĀ?wL(ww$wD w0pw`(w|ww`wtwPwPwwHwHwl8w(w؀?Xw8?xwXPwtPww`w8PwPwww(wɀxw\whwwҐ?w(?PwT?Pwր?Pw׬wh w4wTwt8ww?xw䈀?w؀w谀Xwww8?w(wT(w(w40ẁ w`Xw` wPwPw?xTxx<x?xx px 0x PxPx xx4xTxx$x?Pxx x`xx8xX?x?x px(0x*P?x- ?x.,x/?x0̀@x6 x6T x6x8@x=8xG?@xK|xNxP@xQ xSxU8xV\xV? xYDxYHx]x^$ x_`x_x_x_x` x`xb܀xe?xgȀ?xixl$?xn@(xp@xs|xwxyxzx|,x|x~dx4x\(x\x؀(x܀xx$ xx?(xLx`8x(x x8xDxx? x xDxdxxxĀ0xPpx@x@?Px ?x܀pxxPxx8xp8x?xx\x| xpxĀ?xѴ?xЀ?x؀x؀xp?x؈?xِ x\ xܸ8xPxpxݐ x`xޠ?xx?hxP?`xXPx0xlxxx x\xxxxLxxxx<x(xHxP@x x0Px?px?px xX xx,?x8?xx0xPxp xЀx@ x x(xx(yL(y y(y܀ y(y`py8y 8y8yPy@(y y,yL(y0 y yPy y(y؀ yP0yЀ y@ yyy(y(y8y,L(y.y5` y6$hy;0hyD00yH?XyJ yK yKЀ0yMPyNĀ?HyOPyP̀ yQ?yR?yS?yT<yTD8yV yVȀ?8yXH?8yYȀ?Xy[Xy\l(y]@Xya?hyd,?`yf(yjPylhylp ylylPymym(yn`0yp0yp؀(yq(yr,(ys yt`8yux0yvЀ(yw8?Xyy4yyyz|(y{Xy{(y|(y|y|y}y~?@yt(y @y @yЀ8y@yT(yyyHyy$y(y(yyy(yy8yЀ@yĀ y?8yPyp?Pyl y8yXy00y0y yyyyy y<y`yyydxy`0y(y0yyyyyyy@yl y؀ yTyy@yy8yLyh0y(y4pyD`y(y@y(yt yĀ?8yĀ?8yPyyyp(y(y@y0yh y(y(yy0yD(y,(yPypyİ?yǸxyȬ?yˠy΀yԀyl?yxy$yȀ y y@Hy݈yݨyȀ ypyX yL(y0yy∀(y(y y䤀@ypy攀@yHyyLyp(z0z0z,8zz z |z (z Pz (z0zHzȀ(zD(z0zhzz (z"d(z"?8z$h8z%pz7(z8܀0z:(z;Ԁ0z=(z>z?@zKzLPzLzLzL(zN@zN\zNzNzO@zS(zSlzS(zS0zT(zUT zUhzX80zX zY40zZL8z\\(z]pz^ԀHz_8z`L?xzaHzb`8zc zdzezfzh,Pzi08zi8zj0zk`8zl8zl0zm08zm znt(zo? zv`zv`z0zPzz z`0zz z z4(z z z`(zPz(z(z(z`(z80zԀ0z(z0z8(z0zL(z(z̀(z8z8z`(z z,(z(z zx(z (z8zH8z(z(z(z(zĀ zzd z zd(z, zl z z(z`zz(z8z zP0zĀ z, zh z z0z 0z z(zh(z<hz|@zHzЀ`z z$8z (z?`z, z(z0zpz<pz8zHzXz zȌ zȀ0zHzʠ(z˨zĀ(z0 z̰ z8z 0z z| zz8zĀ z4 zҐ(z|(zX(z@(zȀ(zְzشzz݀zĀ(z@(zz z< zx z⸀ zz zL z㈀ zȀ zzzPz䐀 z؀ z zT zz堀 z z$ zd zz氀z,(z(z阀 z(z꬀(zx(zz@(z@x{@x{8{Ā8{H{&$H{,{-@{0P({1X{5`{68{7@({=\({>p{C`({CԀ({DD({ED{ELX{FX{G({G({H4({H{H{H({I ({I\{I({J,{J40{J0{J{K {Kl {K {K {L({L0 {L{L {L {M${MH{Mp {M{M({N<({N0{Ol?{PԀ{R8{S{U@{VH{\p{aH{d@H{j@@{q P{th{x{{{@0{0{8{X {{{h{({{8{{Ā8{0{X@{{{8{D({D({({8{{{ {Ȁ {T{({({00{T({t{8{@{0{0{8{8{{Ā({t {{({ԀP{?@{Ȁ8{Ԁ {,{P{\{h{t{{{{Ā {H{X{`{l{{{{{{{({{{{{{{{({{ { {0 {({({\({({ { {@({{Ȁ({T{p({{@({{ {8{X {܀({`0{0{h0{( { {H{° { {<{X{t { {H{h{Đ{Ę {0{8@{<{T{t {({{{${L{X{d{p{x { {?@{{{< {Ā({ϐ({0{܀({X0{4H{\?@{ {{0 {{H{۰{{ {p({@ {ݜ({{<{\{ބ?@{{ {, {p({({{8{0{d{섀({$ {{ {T{t {0{؀ {@{({{ {<({{ {{|8|0|(|||(|0|P|l(|؀?H|, |t ||Ȁ | | (| (| | 0| <| H| T| `| | | 0(| X|0||܀0|0|8?H|Ѐ |\?H|Ȁ|L ||,x |, |-|-|-|-؀ |.`(|/0(|0|0@ |0|0|1|14 |1(|2@ |2|2|2|2|3 |3p|3 |30|5 |5x(|6(|6|7(|7|8H|>|?|?$ |?(|@?|AH|C(|D0|F$8|G(|H8|IX?|J8|K<8|K0|LԀ|M|N|Pl(|Q|Q4|RX?8|S(|S |T@8|VL(|W?8|Y|Z|[Ā@|\H|]H|] |^(|^P(|^|^|^|^?8|b@ |b|b|b0|c܀P|mH|md@|m@|n؀(|o(|o؀H|q|q X|s? |v|v|x |y(|z\(|{h0||(|| |}$(|}0|~x|~?8|@|0|||0|L|d(|0|,|l(|h| |T |(|p|(|(0|(|d|`||||||(|t0|x|,(|(||00|H|||P@|?X|`| |`?8| |( |h||||||@|0|`?X|\(|| |8|X|p |H|(|ɰ |0|d|||ʜ|Ҭ (|00|X|X?P|P|<H|0|@ |||̀(|D|d|l} } } $} @0} X} $(} 8}0}H}`}@}L }@}}4(} } }} }(} 8}}}}(}4}L0}L}d(}08}, }@}"8?H}% })h0},L0},}-$}-d}-}-}-}.}. }.d }. }/H}/P }/ }/0}2 }2}2}2}2}3}30}3P}3\}3d}3l}3t}3}3}3}3}3}4 }4P}4l}4`}6@}8 0}9h}=0}?؀(}A }A؀ }Bp?8}D }D(}E,8}EЀ}G}GH}H}R}RĀ(}S}S(}U8@}XX0}Ỳ0}[}\?8}]}]}]}^}`,(}` }aX?@}h`(}h̀0}i8}kȀ}n}n }w}y,(}y(}z}z}| (}}}~0}} }}@H}x0}<8}0}܀(}}}<8} }pH} }@}|H}@}@}P@}@}48}Ɛ@}ɠ?H}Ȁ@}ԌH}8@}ἀ }?x}@~B`(~C,(~C8~Fp(~GpX~Op8~V(~WP0~Xh(~Y(?8~[8~bh(~c(~cЀ(~d(~e8(~e(~g(~h(~iT(~j(~jĀ(~kx(~l,(~l ~m$ ~mh(~n(~nЀ(~ò(~p(~q4(~q(~r(~sP(~t(~t(~ul(~v (~w (~x (~y 0~z08~p0~0~0~8~ ~t8~8~8~Ԁ8~8~D8~8~8~8~?H~8~?H~T8~Ŭ?H~8~ ~8~ ~(8~,8~(8~$8~(8~,8~ݘ8~ߜ8~᠀8~p8~ 8~8~ꀀ@~x?H~`?H~`?H~ ~8~`8@@@@@ @ P?H`8 88@8@؀8 8#(8&P8)x8,8/H4A?XM88Q8T`8X8[?f4Ho?Hl88@TPp8`8Ԁ8H8ʤ88\8Ѹ88(8@8h00@p@x08 8P0XPl0?@0\048P PH0(808Ѐ?H"D(#|H%P((0)8-P3PP70098:Ѐ?XB8@D,@F0F0G0Hh0I0J0K0L@0L0M0N(0NЀ@S@XY@Yh?8[@?8]P8_l8aà0dX(e eff88h (h0ih(i(j(j`(j(k(kX(k(l(l\(l`n0oԀ@qHq@r@0r̀@sp0t0u, u v0vvvwd(wwx x\ x8z8z0{ | 8}hh00hpX@hp ($( FX@.shstrtab.interp.reginfo.dynamic.hash.dynsym.dynstr.gnu.version.gnu.version_r.init.text.MIPS.stubs.fini.rodata.eh_frame_hdr.data.rld_map.eh_frame.ctors.dtors.jcr.got.sbss.bss.comment.pdr.mdebug.abi32 @p@((@@@%@+ A3Cm;oEB:HoF88 WFXX]F:`cP@P0o@@@\uנ@נ}@H@H  O OD O O O OxPx0PxA<Px7hP&@V V